Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR134W (CAF130)3.497ON1122112259010.0
Smik_6.2303.497ON1124112647290.0
Skud_7.4453.497ON1123112545480.0
Suva_7.4223.497ON1127113344880.0
ZYRO0D09790g3.497ON1180120123970.0
TDEL0D056503.497ON1077111623420.0
NCAS0E007703.497ON1150116523000.0
KAFR0C020003.497ON1066106922580.0
SAKL0F02596g3.497ON1132118120970.0
Kpol_480.123.497ON1114113119630.0
KNAG0B007703.497ON1038110319160.0
KLTH0G02442g3.497ON1113112219100.0
TBLA0C045103.497ON1307127818990.0
AFR316W3.497ON1191116818890.0
Kwal_47.188863.497ON1105111318700.0
Ecym_12323.497ON120493318370.0
NDAI0G009003.497ON127990118120.0
CAGL0I10428g3.497ON1163112717880.0
TPHA0A056803.497ON1074115715520.0
KLLA0E03961g3.497ON1132104010001e-116
Suva_8.502.501ON411115726.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR134W
         (1122 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...  2277   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...  1826   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...  1756   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...  1733   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   927   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   906   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   890   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   874   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   812   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   760   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   742   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   740   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   736   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   732   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   724   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   712   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   702   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   693   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   602   0.0  
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   389   e-116
Suva_8.50 Chr8 complement(96994..98229) [1236 bp, 411 aa] {ON} Y...    32   6.7  

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score = 2277 bits (5901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1105/1122 (98%), Positives = 1105/1122 (98%)

Query: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60
            MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF
Sbjct: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60

Query: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120
            NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW
Sbjct: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120

Query: 121  KDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180
            KDNDI          ANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD
Sbjct: 121  KDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180

Query: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240
            YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD
Sbjct: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240

Query: 241  NISLLMENDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVM 300
            NISLLMENDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVM
Sbjct: 241  NISLLMENDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVM 300

Query: 301  EHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLG 360
            EHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLG
Sbjct: 301  EHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLG 360

Query: 361  LMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQ 420
            LMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQ
Sbjct: 361  LMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQ 420

Query: 421  LHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLA 480
            LHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLA
Sbjct: 421  LHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLA 480

Query: 481  LEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPY 540
            LEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPY
Sbjct: 481  LEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPY 540

Query: 541  GRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDE 600
            GRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDE
Sbjct: 541  GRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDE 600

Query: 601  SFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSEN 660
            SFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSEN
Sbjct: 601  SFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSEN 660

Query: 661  VEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSP 720
            VEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSP
Sbjct: 661  VEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSP 720

Query: 721  SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSAS 780
            SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSAS
Sbjct: 721  SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSAS 780

Query: 781  INGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 840
            INGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC
Sbjct: 781  INGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 840

Query: 841  TGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKN 900
            TGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKN
Sbjct: 841  TGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKN 900

Query: 901  EDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXXXDGEKISLYSLGLVR 960
            EDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK       DGEKISLYSLGLVR
Sbjct: 901  EDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENEDGEKISLYSLGLVR 960

Query: 961  LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSAD 1020
            LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSAD
Sbjct: 961  LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSAD 1020

Query: 1021 TMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQ 1080
            TMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQ
Sbjct: 1021 TMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQ 1080

Query: 1081 VNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122
            VNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE
Sbjct: 1081 VNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score = 1826 bits (4729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 905/1126 (80%), Positives = 984/1126 (87%), Gaps = 6/1126 (0%)

Query: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60
            MTKKK   N+ ++  LA  D SG SV  + F+PLQELLKDKNYVPSVENLEK+L +ETM 
Sbjct: 1    MTKKKTTVNHVQKPVLAGGDPSGGSVCCERFVPLQELLKDKNYVPSVENLEKVLCDETML 60

Query: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120
            NDQK+  +LL EAL ITLFTT SGKS L+ IQT + K+RK WAQSFENN+S+YASIV SW
Sbjct: 61   NDQKVRFSLLFEALAITLFTTNSGKSILQSIQTFTSKKRKLWAQSFENNNSNYASIVFSW 120

Query: 121  KDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180
            KDNDI          ANKT PL+I+RYNLPE+KLPLSFLIVSKI IPSILLNE YNLLKD
Sbjct: 121  KDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVSKINIPSILLNEGYNLLKD 180

Query: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240
            YLYSITGRIE L+ CS  F++PALVV++ LKDY+RMIEC N Y WY FNAEN  +L F D
Sbjct: 181  YLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECENCYCWYYFNAENSAHLKFDD 240

Query: 241  NISLLMENDEGNAGSGLDDSRFD---HQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297
            NI+ LM   E N  +GL DSR +   + KQP++ +M RTINDQEQIYSFELN DGTLEIP
Sbjct: 241  NIACLM-GSENNTENGLGDSRVNNNNYHKQPKDVVMSRTINDQEQIYSFELNHDGTLEIP 299

Query: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357
            NVM+HSLLRHELLFKILNLT V TPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLF+L
Sbjct: 300  NVMKHSLLRHELLFKILNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKL 359

Query: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417
            FLGLM  +IK+SQ HNDHYDWKFY CFNMQKIIDATM RLNCFDF+ILNSVNNTD++VHW
Sbjct: 360  FLGLMYPAIKSSQGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHW 419

Query: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477
            +TQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEK+PIQLNPFLFSLISLWKNLSCVI
Sbjct: 420  RTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVI 479

Query: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIAT+LNGLVK N+HDFKHESLNTFM
Sbjct: 480  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFM 539

Query: 538  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 597
            SPYGRKL HGALYADLRSH+ASLLA G SIEDVTDLFADLQSGDRFDEDIRYMFDYEC D
Sbjct: 540  SPYGRKLSHGALYADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECAD 599

Query: 598  YDESFSESDHGGLDESVVNPTEKI-ASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656
            YDESFSESD  GL+E +VN  EKI +S  NNVF +RRCNCIFNDDKLVAEDG NE F ST
Sbjct: 600  YDESFSESDDEGLEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFEST 659

Query: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716
             + N E  + NN + V N    TS+HV TS NP SVR+RSTFEFDYSGEDWRDVPRDFNM
Sbjct: 660  CNRNGERRVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNM 719

Query: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776
            YYSPSY FIH+PKLDVIF+LTLRGATEKLN+EESILLVRSVASCV+NEQDQM+LADL++N
Sbjct: 720  YYSPSYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTN 779

Query: 777  FSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 836
             +  I+   EGE +T +SK DNE+LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE
Sbjct: 780  LTG-ISKHAEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 838

Query: 837  MLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKK 896
            MLMCTGYRRILIWF THLELKHSLIYYVFELIMGLRGK FSG+ASDQDKKDDMIYEILKK
Sbjct: 839  MLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKK 898

Query: 897  KQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXXXDGEKISLYSL 956
            KQKN+DAS LPFSRQGPI+LSDIETKMLLQEFFMNAAIFLSS        DGEKISLYSL
Sbjct: 899  KQKNDDASSLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENEDGEKISLYSL 958

Query: 957  GLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEE 1016
            GLVRLICYMVQTLI NDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IKTRLAMEE+
Sbjct: 959  GLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEED 1018

Query: 1017 DSADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYS 1076
            +   TMQHEGR++ DIEKKLN KPAS+LNLKLL+LFPS  A+  ++S INTLR+FI DYS
Sbjct: 1019 NDTGTMQHEGRRSLDIEKKLNTKPASKLNLKLLSLFPSNSADNGENSAINTLRNFITDYS 1078

Query: 1077 FDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122
            FDTQVNPPGR+VVFYDGKILPL KADKPIPLHEYITLAELDVGDSE
Sbjct: 1079 FDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYITLAELDVGDSE 1124

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score = 1756 bits (4548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/1125 (76%), Positives = 968/1125 (86%), Gaps = 5/1125 (0%)

Query: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60
            MTKKK ATN  ERQ L  ++SS D++ ++ F+PLQ LLKDKNYVPS+ENLEK+LYNE++ 
Sbjct: 1    MTKKKIATNDVERQLLLGDNSSNDALRYEQFVPLQVLLKDKNYVPSLENLEKLLYNESIL 60

Query: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSW 120
            +DQKI  ++L EAL I LFTT SGKS L+ +Q S+LKE+K WAQS  ++ S+YAS+V  W
Sbjct: 61   DDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLKEKKLWAQSLRDDDSNYASVVQGW 120

Query: 121  KDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKD 180
            KDND+          ANKT  LQI++YNLPEYKLPLSFLIVSKI  PSI+LNE +N+LKD
Sbjct: 121  KDNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVSKINFPSIILNEGHNMLKD 180

Query: 181  YLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTFSD 240
            YLYS++GRI+ LI  +S   + ALVV+KILKDY+R++E  N YFWYSFN EN VN  FSD
Sbjct: 181  YLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEFHNLYFWYSFNVENDVNFEFSD 240

Query: 241  NISLLMENDEGNAGSGLDDSRF---DHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297
            N  LLM + E +A  G+ D R    + QK  +  I+ RTINDQEQIYSFEL+QDGTL+IP
Sbjct: 241  NFDLLMNSPEDHADGGVIDDRCKSDNPQKHAKNTIIKRTINDQEQIYSFELDQDGTLQIP 300

Query: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357
            N+MEHSL+RHELLFKILNL +VLTPLLELQF  LCGLVDPLMQP+PND+ +ISIDFLFQL
Sbjct: 301  NIMEHSLMRHELLFKILNLPSVLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQL 360

Query: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417
            FLGLM  SIK+SQEHNDHYDWKFY CFNMQKIIDATMLRLNC DF+ LNSVNNTD+ +HW
Sbjct: 361  FLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHW 420

Query: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477
            +TQLH+WLPHGLNTQDLELLYMIDILA+YTIYKLYEKIPIQLNPFLFSL+SLWKNLSCVI
Sbjct: 421  RTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVI 480

Query: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537
            LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA+VLNGLVK+NDHDFKHESLNTFM
Sbjct: 481  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFM 540

Query: 538  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 597
            SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED
Sbjct: 541  SPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECED 600

Query: 598  YDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTN 657
            Y+E FSESD   L+E   N   KI S S+N F++RRCNCIFNDDKLVAEDG NEAF  + 
Sbjct: 601  YNEPFSESDDEQLNED-ANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGTNEAFEISG 659

Query: 658  SENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMY 717
            + N+E  M NN N + +  T  S+   +S NPLSVRSRSTFEFDYSGEDWRDVP+DFNMY
Sbjct: 660  NSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTFEFDYSGEDWRDVPKDFNMY 719

Query: 718  YSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNF 777
            YSPSYSFI EPKLDVIF+LTLRGATEKLN+++SI+LV SVASCV+NEQDQMIL+DL SNF
Sbjct: 720  YSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSDLGSNF 779

Query: 778  SASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 837
             A I+ + E + +  ++K +NE+LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM
Sbjct: 780  -AEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEM 838

Query: 838  LMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKK 897
            LMCTGYRRILIWFLTHLELKHSLIYYVFEL+MGLRGKPFSGEASDQD+KDDMIYEILKKK
Sbjct: 839  LMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKDDMIYEILKKK 898

Query: 898  QKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXXXDGEKISLYSLG 957
            +KNED SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK       DGEKISLYSLG
Sbjct: 899  RKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNDEEENEDGEKISLYSLG 958

Query: 958  LVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEED 1017
            LV+LICYMVQTLIANDKF FTKSECTFELQTLLMTWIG+LPEAKDLFF+IKTRLAMEE+ 
Sbjct: 959  LVKLICYMVQTLIANDKFLFTKSECTFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEDS 1018

Query: 1018 SADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSF 1077
              D  Q++  K+ ++E++ + K  SELN+KLLNLFPS PA  +D+S I+TLRSFI DY F
Sbjct: 1019 DKDGQQNDDNKDLEVERRPHTKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPF 1078

Query: 1078 DTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122
            DTQ+ PPGR+VVFYDGKILPL KADKPIPLHEYITLAE+DVG+SE
Sbjct: 1079 DTQITPPGRKVVFYDGKILPLSKADKPIPLHEYITLAEIDVGESE 1123

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score = 1733 bits (4488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 857/1133 (75%), Positives = 971/1133 (85%), Gaps = 17/1133 (1%)

Query: 1    MTKKKAATNYAERQNLAS--EDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNET 58
            M KKK ATN AE Q LAS   DS G+   +  FI LQELLKD++Y PSVENLEK+LY+ET
Sbjct: 1    MNKKKGATNDAENQILASGVNDSLGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET 60

Query: 59   MFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVL 118
            + NDQ+I   LL EAL +TLFTT SGKS L+ ++ S+ KERK+W +SFEN+ S+YASI+ 
Sbjct: 61   ILNDQEIRFPLLFEALSVTLFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR 120

Query: 119  SWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLL 178
            SWK++D+          ANKT PLQI+RYNLP+YKLPLSFLIVSK+ +PSI+LNE YN+L
Sbjct: 121  SWKEDDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVNLPSIILNEGYNML 180

Query: 179  KDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLTF 238
            KDYLY+I+GR+E LI C+STFD+ A + +  L+ Y+RMIE RNFYFWYSF+AE       
Sbjct: 181  KDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKL 240

Query: 239  SDNISLLMENDEGN--AGSGLDDS--RFDHQKQPREAIMGRTINDQEQIYSFELNQDGTL 294
            + NI+LLM++ E N    S +DD+    +HQKQP++ I+ RT+NDQEQIYSFELNQDGTL
Sbjct: 241  NHNINLLMDSYEDNLDGVSSVDDAGKSDNHQKQPKDTIIHRTVNDQEQIYSFELNQDGTL 300

Query: 295  EIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFL 354
            +IPNVMEHSLLRHELLFKILNLT VLTPLLE QFSTLCGLVDPL QPTPNDKHIISIDFL
Sbjct: 301  QIPNVMEHSLLRHELLFKILNLTPVLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFL 360

Query: 355  FQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNA 414
            +QLFLGLM  SIKTSQEHN+HYDWKFY+CFNMQKIIDATMLRLNCF F+ LNS+NNTD+ 
Sbjct: 361  YQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDT 420

Query: 415  VHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLS 474
            VHW+TQLH WLPHGLNTQDLELLYMIDILAVYTIYKLYE+IPIQLNPFLFSL+SLWKNLS
Sbjct: 421  VHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLS 480

Query: 475  CVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLN 534
            CVILLALEIDRIEEE GTYETPLMVRATIRGAAALRSVIA VLNGLVK+NDHDFKHESLN
Sbjct: 481  CVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLN 540

Query: 535  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 594
            TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE
Sbjct: 541  TFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYE 600

Query: 595  CEDYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFG 654
            CEDY+ESFS+     L E  VN  EK  +  +N F++RRCNCIFNDDKLVAEDGAN    
Sbjct: 601  CEDYNESFSDCGDEELGEG-VNSGEKTKTSIHNGFYQRRCNCIFNDDKLVAEDGAN---A 656

Query: 655  STNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDF 714
            STN+++++  + ++ NA  N     ++H  +S NP SVRSRSTFEFDYSGEDWRDVP+DF
Sbjct: 657  STNNDSIKNEIRSDGNAGSNTAITNANHATSSINPYSVRSRSTFEFDYSGEDWRDVPKDF 716

Query: 715  NMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLE 774
            N+YYSPSYSFI EPKLD+IF+LTLRGATEKL++EES+LLVRSVASCV+NEQDQMILADL 
Sbjct: 717  NIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLG 776

Query: 775  SNFSASINGDVEGEGNTKMS--KIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 832
            SNF+ SI  + EG G+T ++  K ++E+LRRTTPDDIYEIWSEESAFERML VNHDVAWR
Sbjct: 777  SNFT-SIGENFEG-GDTGITSDKTNDEELRRTTPDDIYEIWSEESAFERMLYVNHDVAWR 834

Query: 833  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYE 892
            LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRG PFSGEASDQD+KDDMIYE
Sbjct: 835  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYE 894

Query: 893  ILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXXXDGEKIS 952
            ILKKKQKNE+ SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK       D +K+S
Sbjct: 895  ILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNTEEEGEDADKVS 954

Query: 953  LYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLA 1012
            LYSLGLV+LICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF+IK+RLA
Sbjct: 955  LYSLGLVKLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLA 1014

Query: 1013 MEEEDSAD-TMQHEGRKNSDIE--KKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLR 1069
            MEE+   D T+QH+ + + D++  KK N K  S+LN+K+L+LFPS P   DD+S I+TLR
Sbjct: 1015 MEEDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLR 1074

Query: 1070 SFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGDSE 1122
            SFI DYSFDTQV  PGRRVVF+D KILPLPKADKPIPLHEYITLAELD+GDSE
Sbjct: 1075 SFITDYSFDTQVVAPGRRVVFHDDKILPLPKADKPIPLHEYITLAELDMGDSE 1127

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1201 (43%), Positives = 742/1201 (61%), Gaps = 121/1201 (10%)

Query: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKN------------------ 42
            M KK+ +   +     ++ + +G++++ +++IPL  L KD++                  
Sbjct: 1    MVKKRKSKTNSSNVTESAFNGNGNNINKEEYIPLGAL-KDEDMLDLKMISLEELLAEREL 59

Query: 43   -YVPSVENLEKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSS------ 95
             Y    E L+++L +   + D ++  +LLLE +I+ L TT +G S L L++ S       
Sbjct: 60   DYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALLKPSGSNPSIP 119

Query: 96   --LKERKSWAQSFENNSSSYASIVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYK 153
              +  ++ W    E     ++ ++  W+ +D            N+   L     N  E+K
Sbjct: 120  KCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPCENVNQCEWK 179

Query: 154  LPLSFLIVSKITIPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDY 213
            +PLSFLI SK     ++L+ +YNLL DY  ++    E  +  + ++     + R ++ +Y
Sbjct: 180  VPLSFLIQSKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVI-NY 238

Query: 214  NRMIECRNFYFWYSFNAENRVNLTFSDNISL-LMEND--EGNAGSGLD----DSRFDHQK 266
            NR+ +   ++ WY+       +   S  I   L+++D  E  A S ++    + R     
Sbjct: 239  NRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIID 298

Query: 267  QPREAIMG---------------------------RTINDQEQIYSFELNQDGTLEIPNV 299
            Q R AI                               +N  EQ++SF+LNQDG+LE+PN+
Sbjct: 299  QIRSAIQDISSASLNSGFYGDEDRSALEEYSDNYHHQVNQNEQVFSFDLNQDGSLELPNL 358

Query: 300  MEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFL 359
            M H+ +RHE+L K+L L    +PLL+LQF  + GLVDPL QP PNDKH+IS+D L+Q+FL
Sbjct: 359  MSHAAVRHEILMKVLKLNNSSSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMFL 418

Query: 360  GLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKT 419
            G ++  I+ + E  +  DW+F++CFNMQKIIDA+++RLN  DF+ LNS+NN+D+ V W++
Sbjct: 419  GFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWRS 478

Query: 420  QLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILL 479
            QL +WLPHG NTQDLEL+ M+DI+AVYTIYKLYE +PIQLNPFL SLISLWKNL+CVILL
Sbjct: 479  QLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVILL 538

Query: 480  ALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSP 539
             LEIDRIEEE  T++TPLMVRATIRGAAALR+++ATVLNG V+   HD KHESLNTFMSP
Sbjct: 539  GLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMSP 598

Query: 540  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDY- 598
            +GRKLC GALYA+LRSH A+LLALG+ +EDVT LF+DLQ GDRFDED+RYMF+YE EDY 
Sbjct: 599  HGRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDYN 658

Query: 599  DESFSESDHGGLD--ESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656
            D S  E D+ G D  +   + ++  A       F RRCNCIF+DD+++ ++     +   
Sbjct: 659  DLSSREEDYSGFDKYDDYTDSSKTHARKG----FGRRCNCIFDDDEMLEDEDYENEYEGH 714

Query: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716
             +          +  +      TS  + T+  P ++RS  +FEFDYSG+DWRD+PR  N+
Sbjct: 715  KAP---------KQILPQQNPTTSVSMSTTGKPHAIRSGGSFEFDYSGKDWRDIPRMSNL 765

Query: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776
            YYSP+Y F+ +   + I SLT +   + L+K ES+LL+ SVA+CV+NEQD+++L ++   
Sbjct: 766  YYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDEIVLGNI--- 822

Query: 777  FSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDE 836
                   ++  +  ++ S++ ++ L+  +PDDIYE+W ++S FE+M+  NH+VAWRLMDE
Sbjct: 823  ------TELHHQNGSRGSQVIDK-LKDISPDDIYEMWCKDSTFEKMVYCNHEVAWRLMDE 875

Query: 837  MLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKK 896
            MLMC+G+RR+LIWF+TH+EL HSLI+Y+FEL+MGLR K F  E ++ D  D+ I E+   
Sbjct: 876  MLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLR-KSFD-ENNENDNGDESISEM--T 931

Query: 897  KQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXX----------XXXXX 946
            K+  E  + LPFSRQG I LS IETKMLLQEFF NAAIFL+ K                 
Sbjct: 932  KEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWIGEEPMEDEATIN 991

Query: 947  DGE--KISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLF 1004
            DGE   +SLY++GL++LIC MV+  I   KF F +SEC FELQTLLM WI I+PEAKDLF
Sbjct: 992  DGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLF 1051

Query: 1005 FKIKTRLAMEEEDSADTMQHEGRKNS--DIEKKL-----------NAKPASELNLKLLNL 1051
            F++K  +A   E  +D M  E   N+  D  KKL           N    SE N KL++L
Sbjct: 1052 FELKALVA---EVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNEAVDSEYNRKLISL 1108

Query: 1052 FPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYI 1111
                   K++++ +  LR+FI  YSFDT V   GR+VV+   +ILPLP+++ P+ L +Y+
Sbjct: 1109 LSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPLPESETPMSLLDYL 1168

Query: 1112 T 1112
             
Sbjct: 1169 V 1169

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  906 bits (2342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1116 (46%), Positives = 699/1116 (62%), Gaps = 103/1116 (9%)

Query: 33   PLQELLKDKNYVP--SVENLEKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRL 90
            PL ELL + N  P   VE L + L  E +  + +   +L+ E LII LFTT +G S L L
Sbjct: 11   PLHELLVEANLQPLKGVEGLAEALREEKVLKNDQWRPSLICETLIIALFTTRAGISLLPL 70

Query: 91   IQTSSLKERKSWAQSFENNSSSYASIVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLP 150
               S+ ++R                 VL W +++            N+++ ++   +   
Sbjct: 71   FSESAKRKR-------------VGPRVLEWHNDEELMLRFFSYILENRSSRIEPRLFEKA 117

Query: 151  EYKLPLSFLIVSKITIPSILLNETYNLLKDYLYSITGRIESLIS---CSSTFDKPALVVR 207
             +KLPL FLI SK    S++L++ YNLL DY+++IT  I+  +       TF K  +V  
Sbjct: 118  RWKLPLFFLIESKFLAASMVLDQNYNLLLDYVHTITPMIKRWVHRAFTQGTFFKDTVVC- 176

Query: 208  KILKDYNRMIECRNFYFWYSF-----NAENRVNLTFSDNISLLMENDEGNAGSGLDDSRF 262
                 YNR+ E ++   WYSF     N E R    F      L EN E    +  +  R 
Sbjct: 177  -----YNRVYELKDSSEWYSFGTKKSNEERRAIQQF------LRENSEQVLDTYHEMVRP 225

Query: 263  DHQKQPRE-AIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLT 321
             +++   + A     I+  E +YSF++NQDG+LEIPN+M H+ +RH++L  ++ L    +
Sbjct: 226  SNERAINDTASYHHRISQHENVYSFDINQDGSLEIPNIMSHASVRHDILQNLMRLPLCDS 285

Query: 322  PLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFY 381
            PLL+ QF  + GLVDPL QP PNDKHIIS+D L+Q+ LGLM  +I  +   +D  DWKF+
Sbjct: 286  PLLQWQFKLMAGLVDPLTQPPPNDKHIISLDLLYQMLLGLMEPAISNTL-GSDGCDWKFH 344

Query: 382  MCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMID 441
            +CFNMQKII A++ RLN  DFD LNS+NN+D  V W+  LH WLPHGLNTQ+LEL+YMID
Sbjct: 345  LCFNMQKIIQASLKRLNLQDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMID 404

Query: 442  ILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRA 501
            ILAVYTIYKLYE +P+QLNPFL  +ISLWKNL+CVILL LEIDR EEE+ T+ETP++VRA
Sbjct: 405  ILAVYTIYKLYEDLPVQLNPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRA 464

Query: 502  TIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLL 561
            TIRGAAALR+V+AT+LNG V    HDF HE LNTFMSP+GRKLC GALYADLRSH A+LL
Sbjct: 465  TIRGAAALRAVVATILNGHVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALL 524

Query: 562  ALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESVVNPTEKI 621
            ALG  +EDVT+L ADLQ+GDRFDED+RYMF+YEC++Y+E  SES+  G          K+
Sbjct: 525  ALGTELEDVTNLLADLQAGDRFDEDVRYMFEYECDNYNEGDSESEKDG----------KL 574

Query: 622  ASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSD 681
            A     +  +RRCNCI        +D         + EN E     +     NA T+ S 
Sbjct: 575  AVEQPKI-LQRRCNCI-------FDDDEMAEDEDFDGENDEAFFSKHLILQQNAQTSLS- 625

Query: 682  HVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGA 741
             + +S  P +VRS   FEFDYSG+DWRD+PR  N YYSP + FI  P L  + +LT + +
Sbjct: 626  -MSSSGKPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYSPDFEFIESPSLSSLLALTKKAS 684

Query: 742  TEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDL 801
            +EKL ++ES+ L+RSVASCV+NEQD++ L +L       I+   + + + +    D    
Sbjct: 685  SEKLVEKESLTLLRSVASCVKNEQDEITLGNL-------IDPHQDSQADEESRNAD---- 733

Query: 802  RRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLI 861
             +  PDDIYE+W E S FE+++  NH +AW+LMDEML+C GYRR+LIWF+TH+EL HSLI
Sbjct: 734  -KIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLI 792

Query: 862  YYVFELIMGLRGKPFSGEASDQDKKD-DMIYEILKKKQKNEDASGLPFSRQGPIVLSDIE 920
            +Y+FEL+MGLRG       SD++ +D D+    L+   K +    + FSRQG + LS IE
Sbjct: 793  HYIFELVMGLRGN------SDENDRDVDLAGPPLQDVDKVKGELSVGFSRQGALQLSTIE 846

Query: 921  TKMLLQEFFMNAAIFLSSKXXXXX--------------XXDGEKISLYSLGLVRLICYMV 966
            TKMLLQEFF NAAIF+S K                     + E +SLY++GL++LIC+MV
Sbjct: 847  TKMLLQEFFTNAAIFISKKSEESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMV 906

Query: 967  QTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLA-------MEEEDSA 1019
            +T I  +KF F++SEC FELQ LLM WIGI+PEAK LFF++K+ +A       ++E+ +A
Sbjct: 907  RTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSVQEQKNA 966

Query: 1020 ----DTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADY 1075
                DT +   ++ S +  +++     E N KL+ L P    NK++++ + TLRSFI   
Sbjct: 967  EVKNDTQEDVPKEQSPV--RVSNTAGFEFNRKLMTLLPPLVKNKEENAAMQTLRSFIKTS 1024

Query: 1076 SFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYI 1111
            SF   V   GR++V+ D KILPLPK+D P+ LHEYI
Sbjct: 1025 SFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1165 (44%), Positives = 709/1165 (60%), Gaps = 138/1165 (11%)

Query: 31   FIPLQELLKDKNYVPSVENLEKILYNETMFNDQKICS--NLLLEALIITLFTTISGK--- 85
            + PL+EL  ++NY PS+  L  +L ++ + N+       +LL+E +II   +T SGK   
Sbjct: 31   YTPLRELFAERNYQPSLSQLLNLLSDDALLNNLTPIQEHSLLVECVIIGFLSTRSGKLLQ 90

Query: 86   SAL---RLIQTSSLKER-KSWAQSFENNSSSYASIVLSWKDNDIXXXXXXXXXXANKTAP 141
            SAL   +  Q + L+ + K W  S + + +++  +   W  N +           N    
Sbjct: 91   SALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNKLYFLKFTKFLLVNADGN 150

Query: 142  LQINRYNLPEYKLPLSFLIVSKITI-PSILLNETYNLLKDYLYSITGRIESLISCSSTFD 200
            + +++Y  P YKLPL+FL      + P+ +L+  YNLL+DY+Y+       L+ C     
Sbjct: 151  INVDKYTEPIYKLPLNFLFDDNTNLMPTFILDNKYNLLQDYIYACG----PLLKCVMKDT 206

Query: 201  KPALVVRKILKDYNRMIECRNFYFWYSF---NAENRVNLTF----SDNISLLMENDEGNA 253
                +   +   Y   I+ +  Y WY       E  +N T     S+NI L M       
Sbjct: 207  LENGICLDLPGIYKLDIDLQFPYPWYDLLPPMHEGHLNATKQNNNSNNIPLTM------- 259

Query: 254  GSGLDDSRFDHQKQPR-EAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFK 312
                         QP  +       N+ + +YSF+LN D T E+ NV+ H+  RH +L +
Sbjct: 260  -------------QPSIKTNNNGANNNNQTVYSFDLNTDKTFELDNVVSHTAKRHRVLNQ 306

Query: 313  ILNLTTV-LTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQE 371
            ++N   +  TPLL LQF+ + GLVDPL QP PN+K +IS+  L+ +F+GLM  ++K    
Sbjct: 307  LINNNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHLLYSMFIGLMYPNLKECFN 366

Query: 372  HNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDIL------------NSVNNTDNAVHWKT 419
             ND ++WKF++CFNM K+I+ +M+ L C +F+ L             + N+ D+A  WK 
Sbjct: 367  ANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNNDNDEGTENDDDDA--WKL 424

Query: 420  QLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILL 479
            +L+ W+PHG+NTQDLEL+YMI+I+AVYTIY+LY  +PIQ+NPFL  LI+LWKNLS +ILL
Sbjct: 425  KLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFLSCLITLWKNLSAIILL 484

Query: 480  ALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSP 539
             L+IDR EE   T+ TPL+VRATIRGAA+LR+V+AT+LN  V  N+HDFKHE LNTFMSP
Sbjct: 485  GLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDVNEHDFKHEPLNTFMSP 544

Query: 540  YGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYD 599
            +GRKLC GALYAD+RSH A++LALGA +EDVTDL  DLQ+GDRFDEDIRYMFDYE +DY+
Sbjct: 545  HGRKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRFDEDIRYMFDYEYDDYN 604

Query: 600  ESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNS- 658
            +           + V    E    GS    F RRCNCIF DD ++ +D  N      +  
Sbjct: 605  D---------FKDDVEEQEEMEIMGS----FPRRCNCIFEDDNIINDDTDNINENDEDDD 651

Query: 659  -------ENVEGAM----HNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDW 707
                   + +EG      HNN N  H+A    + H      P S RS+S+FEFDY G+DW
Sbjct: 652  DEQEEYVDAIEGVTKDTPHNNLNP-HDAIRTRNSH------PNSKRSKSSFEFDYGGKDW 704

Query: 708  RDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQ 767
            RD+PR FN+YYSPSY FI  P ++ I +LT +   EKL  E+S LL+ +VASC++ EQD+
Sbjct: 705  RDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQDK 764

Query: 768  MILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNH 827
            MI  +L  + +       E E        D+ D +  TPDDIY++WSEES FERML +N 
Sbjct: 765  MISKELLKHNTVKHPHAAENE--------DDADFKIATPDDIYDMWSEESKFERMLYLNQ 816

Query: 828  DVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKD 887
            DVAWRLMDEMLMC GYRR+LIWF+TH+EL HSLI Y+FEL+MGLRG PFSGE  + D K+
Sbjct: 817  DVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKN 876

Query: 888  DMIYEILKKKQKNEDA----SGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXX 943
            D+++EI+  + KN++     + LPFSRQGP++LS+IE KMLLQEFF NAAI+ SSK    
Sbjct: 877  DLLHEIMYGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKSNNE 936

Query: 944  XXX---DGEKI-------SLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTW 993
                  +GE I       S+YS GLV+LIC+MVQ+L+ N+KF F KSECTFELQTLLM W
Sbjct: 937  GTTNNDNGEGIDEEAVNFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNW 996

Query: 994  IGILPEAKDLFFKIK-------TRLAMEEEDSADT------------MQHEGRKNSDIEK 1034
            IGI+PEA+DLFF +K       T+   E +D  +T              H G    D + 
Sbjct: 997  IGIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDD 1056

Query: 1035 KLNAKPASE--LNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVFYD 1092
                 P +E   N +L++L P +  +KD+++ ++TLR FI  YSFD +    GR+VV+ D
Sbjct: 1057 ----SPPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSD 1112

Query: 1093 GKILPLPKADKPIPLHEYITLAELD 1117
              +LPLP AD+PI  HEY+T  ELD
Sbjct: 1113 EIVLPLPAADQPISFHEYLT--ELD 1135

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  874 bits (2258), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1069 (46%), Positives = 678/1069 (63%), Gaps = 82/1069 (7%)

Query: 69   LLLEALIITLFTTISGKSALRLIQT----SSLKER-KSWAQSFENN-SSSYASIVLSWKD 122
            +LLE L+I+LFTT SG S L ++      S L +R  SW +S   + +  Y    L   +
Sbjct: 52   VLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWLESSSGDLNYKYLKHELWQSN 111

Query: 123  NDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLN-ETYNLLKDY 181
             +            N+  P  +N Y+L +YKL L  LI S+  I S++LN + YNLL D+
Sbjct: 112  RNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSESNIISLILNSDNYNLLLDF 171

Query: 182  LYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENRVNLT---F 238
            +      +  LIS     +K      +I+  YNR+ E   F+ WY+    +  ++     
Sbjct: 172  IMFFQPYMNDLISYIVEGNK----FFEIIAKYNRIYELNGFHTWYTLTIASNTSIAVRYL 227

Query: 239  SDNISL-LMENDEGNAGSGLDDSRFDHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIP 297
            +D +S+  M  D+    S   D  F   ++       +T  D + I+SF+LN+ G  ++P
Sbjct: 228  NDVLSIDPMITDQ--FTSNYRDKAFQESEETLLMSQQQTAKD-DIIFSFDLNETG--DLP 282

Query: 298  NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQL 357
            N+++HS +RH++++ ILNL  + +P L+ QF  +CGLVDPL QP PN++HIISID ++QL
Sbjct: 283  NLIKHSEMRHQIIYDILNLNQIDSPFLKKQFLLICGLVDPLTQPQPNNEHIISIDLIYQL 342

Query: 358  FLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHW 417
            F+GLM +         D     F +CFNMQKII  +++ LNC D+D L+++ N D    +
Sbjct: 343  FMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDYDTLSTILN-DFPNDY 401

Query: 418  KTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVI 477
            KT L++WLPHG+NTQDLEL+YMI+I+A+YTIYKLY  +PIQLNPFL +L+SLWK LS ++
Sbjct: 402  KTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNPFLQTLVSLWKTLSHLV 461

Query: 478  LLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFM 537
            L+ LEIDRIEE N TY+TP++VRATIRGAAALR+VIAT+LN  V   +HDFKHES NTFM
Sbjct: 462  LIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVSTKEHDFKHESFNTFM 521

Query: 538  SPYGRKLCHGALYADLRSHTASLLALG-ASIEDVTDLFADLQSGDRFDEDIRYMFDYECE 596
            SP+GRKLC GAL ADLRSH A++LALG   + DVT+L ADLQ+GDRFDED++Y+F+YE +
Sbjct: 522  SPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGDRFDEDVKYIFEYEYQ 581

Query: 597  DYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGST 656
            DY+E        G ++   N  E++   S     +RRCNCIF DDK++ +    E    +
Sbjct: 582  DYNEL-------GEEDEQTNELEELEKRSVK---KRRCNCIFEDDKMLEDYEYYEVGNES 631

Query: 657  NSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNM 716
              E++      +R                  NP SVR  S FEFDYSG+DWRDVPR FN+
Sbjct: 632  RREDMNLESDKSRT-----------------NPYSVRVNSIFEFDYSGKDWRDVPRGFNL 674

Query: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESN 776
            YYSPSY FI  PKL  +   TL+  TEKL+ E+S+LL++SVASCV+ EQ++MIL     N
Sbjct: 675  YYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVASCVKLEQEKMIL----EN 730

Query: 777  FSASINGDVEGEGNTKMSKIDNEDL-RRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMD 835
            +S + N   E            EDL R  TPDD+YEIW EESAFERM+ +N +VAWRLMD
Sbjct: 731  YSNTKNCSTE------------EDLDREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMD 778

Query: 836  EMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILK 895
            EMLMC GYRR+L+WF+TH+E+ HSL++Y+FEL+MGLRG+         D+   ++ + + 
Sbjct: 779  EMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMM 838

Query: 896  KKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK-XXXXXXXDGEKISLY 954
              +K   +  +PFSRQG I+LS+IETKMLLQEFF NAAIF S+         D E +SLY
Sbjct: 839  TDKKG--SEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSNDSENVSLY 896

Query: 955  SLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAME 1014
            ++GLV+LIC+MV+TL+ NDKF F+KSECTFELQTLLM WIGI+PEA++LFF +K  +   
Sbjct: 897  AIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIPEAQELFFTLKANVG-- 954

Query: 1015 EEDSADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSP-INTLRSFIA 1073
             E S      EG+ +SD     N    S  N KLL L PS P N    +P I TLRSF+ 
Sbjct: 955  -EPSM-----EGKSDSDGTDS-NEGELSWYNSKLLALLPS-PTNSGLENPAIETLRSFLK 1006

Query: 1074 DYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYI--TLAELDVGD 1120
             YSF  +V   GR+V++ D KILP+PK  +PI L E I     E D GD
Sbjct: 1007 KYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLRELIDENFEEDDDGD 1055

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  812 bits (2097), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/1181 (40%), Positives = 671/1181 (56%), Gaps = 123/1181 (10%)

Query: 1    MTKKKAATNYAERQNLASEDSSGDSVHFKDFIPLQELLKDKNYVPSVENLEKILYNETMF 60
            MTKKK A +            S D  H    + L  L KD  Y P   NL       T+ 
Sbjct: 1    MTKKKKAVSV----------DSHDETH--KGMALSRLCKD--YYPDQRNL-------TIP 39

Query: 61   NDQKICSNLLLEALIITLFTTISGKSALRLIQTSS-----LKERKSWAQSFENNSSSYAS 115
            + ++    ++ E LI++LF T+ G S L L    S     L   K W  S   ++  Y  
Sbjct: 40   HVEEFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKK 99

Query: 116  IVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETY 175
            +V  W  + +           NK  PL+  ++N  EYKL L FL+  +     ++L+  Y
Sbjct: 100  LVKRWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLLDKQNEF--LILDPDY 157

Query: 176  NLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAE---- 231
            NLL DYL      IES++  +     P L+ + ++  YN++ E    + WY+F       
Sbjct: 158  NLLLDYLLHAKPMIESILLGNI----PGLL-KALVYQYNKLPEFNGCHTWYTFRTHYHGT 212

Query: 232  ----NRVNLTFSDNISLLME-------------------------NDEGNAGSGLDDSRF 262
                ++  +  +D  +   E                          D+  + + +DD   
Sbjct: 213  QEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAIDDFNE 272

Query: 263  DHQKQPREAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTP 322
            D+  Q +        N QEQ+YSFELN+DGTLEIPNV  H+  RH+ L+K+L L    TP
Sbjct: 273  DYWTQQK-------TNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKVLGLNDDPTP 325

Query: 323  LLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYD-WKFY 381
            LL+  F T C L DP+ QP PNDKHI+S+D L  +FLGLM   I        + D W  +
Sbjct: 326  LLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLH 385

Query: 382  MCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMID 441
            +CFN+QKII+AT+ RLNC DF  LN +NN+D++V W+  L++WLP GLNTQDLEL+YM+D
Sbjct: 386  ICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVD 445

Query: 442  ILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRA 501
            ILA YTIYKLY   PIQ+NPFL  +ISLWKNL+CV+LL LEIDR+EEE  T+ TP+MVRA
Sbjct: 446  ILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRA 505

Query: 502  TIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLL 561
            TIRGA+ALRSV+AT++NG  +   HDFKHE +N FMSP+GRKLC+GALYADLRSH A++L
Sbjct: 506  TIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATML 565

Query: 562  ALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSE--SDHGGLDESVVNPTE 619
            ALG  +E +TDL +DLQ GDRFDED++YMFDYE +DY+E  +E  +D    D   +   E
Sbjct: 566  ALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELED---IESRE 622

Query: 620  KIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTAT 679
            +I        + +RC+C+F+DD LV E+           +  +    ++ + +       
Sbjct: 623  RIKEVRG---YYKRCHCVFDDDSLVPENEDGGGEEGDQEDTKKHLQDSHEDQLPPQQNVV 679

Query: 680  SDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLR 739
               + T+  PL+VRSR T EFD++G DWRD+PR  N YY+ +Y F+ +   DV+  L   
Sbjct: 680  ---MSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKE 736

Query: 740  GATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNE 799
               +KL +  +  ++RS+A+CV+ EQ++ I+        A  N D +   N    K +NE
Sbjct: 737  ATRKKLERNHASFILRSIATCVKLEQEEAIVR------RALGNQDGDKSSNATTIKTENE 790

Query: 800  DLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHS 859
                 T D IYE W E+S FE+M+  N D+ WR+MDEMLMC+GYRR+LIWF+THLE+ HS
Sbjct: 791  ----LTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHS 846

Query: 860  LIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDI 919
            +I+Y+FEL+MGLRG     +  ++ K  D +  + +    +E    LPFSRQGPI+LS I
Sbjct: 847  VIHYIFELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSE--LTLPFSRQGPIILSSI 904

Query: 920  ETKMLLQEFFMNAAIFLSSKXXXXXXXDGEK------------ISLYSLGLVRLICYMVQ 967
            E  MLLQEFF NAAIF SSK       + E+            +  + +GL++L+C+MV 
Sbjct: 905  EVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVD 964

Query: 968  TLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSADTMQHEGR 1027
            TL+   KF FT SE  FELQTLLM WIGI+PEA+DLFFK+K+++    +D+    Q +G 
Sbjct: 965  TLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDT----QEQGT 1020

Query: 1028 KNSDIEKKLNAKP--------ASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDT 1079
               + EK     P         SE N KL+ L P  P   ++ + +  LR FI  YS   
Sbjct: 1021 PVKESEKDDIDAPDTLEMNDTMSEHNKKLMMLIP--PGTTNERNALTALRGFIGKYSLTN 1078

Query: 1080 QVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGD 1120
            +    GR++++ D +I+ +   DK +   E++    +D  D
Sbjct: 1079 KTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFGIDYND 1119

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  760 bits (1963), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1131 (39%), Positives = 666/1131 (58%), Gaps = 102/1131 (9%)

Query: 42   NYVPSVENLEKILYNET----MFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLK 97
            NY PS+  LE++L +E     +  D ++  + + E  +I LFTT  G S L  +  +   
Sbjct: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGI 79

Query: 98   ERKSWAQSFENNS--SSYASIVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLP 155
            +  +  + F  NS       + L W  +++           N+   +     N    KL 
Sbjct: 80   DEDN--KDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQ 137

Query: 156  LSFLIVSKIT--IPSILLNETYNLLKDYLYSITGRIESLISCSSTFD------KPALVVR 207
            L FLI ++ +  I   LL    +++++YL +I  +++++I  S   +      + +  VR
Sbjct: 138  LDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVR 197

Query: 208  KILKDYNRMIECRNFYFWYSFNAENR-----------VNLTFSDNISLLMENDEGNAGSG 256
             IL  Y R+ E    + +Y +++               +LT   N S  +    G   + 
Sbjct: 198  TILS-YKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNT 256

Query: 257  LDDSRFDHQK--------QPREAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHE 308
            +D+  ++  K         P +   G    +QE   +  + Q   L+ P++M  +  RH 
Sbjct: 257  IDNQSYNPSKFGFIPLSVDPDD---GEVEENQE---TDNILQPSLLDFPDLMNETAKRHL 310

Query: 309  LLFKI-----LNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMS 363
             L K+     L      +PLL++Q+ TL  L+DPL QP PND H+ISID L  +FLGLM 
Sbjct: 311  ALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMK 370

Query: 364  QSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHR 423
              I     ++D  DW+F++CFNMQ+II A++  LNC DF+ L +V   D +  W++QLH 
Sbjct: 371  PYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHL 427

Query: 424  WLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEI 483
            WLP GLNTQ+LEL+YM  ILAVYTIYKLY   P+  NPFL SLISLWK+L+CV+L  L+I
Sbjct: 428  WLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQI 487

Query: 484  DRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRK 543
            DR+EE N +++TP++VRATIRGAAALRS++ATVLN  ++   HDF HESLNTFMSP+GRK
Sbjct: 488  DRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRK 547

Query: 544  LCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFS 603
            LC GALYADL+++TAS+LALGA  ++VTDL + LQ+GD+FDED++YMF+YE EDY+E + 
Sbjct: 548  LCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYEDYNEIYE 607

Query: 604  ESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFN-DDKLVAEDGANEAFGSTNSENVE 662
            +S +   +   +          +  F +RRCNCIF+ D+ +  E+   E      + +++
Sbjct: 608  DSSNENEENEEI----------DYAFNKRRCNCIFSDDNLIEEEEDDEEESDVEKTSDID 657

Query: 663  GAMHNNRNAVHNATTATSDHVVTS--PNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSP 720
            G +   ++  H   T  SD  +++    P +VRS+S FEFDYSG+DWRD+PR++N+YYSP
Sbjct: 658  GEIA-TKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSP 716

Query: 721  SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSAS 780
             Y+FI  P L+ +F LTL+  +EKL KEE+ LL+ SVAS V+NEQD+MI  +L       
Sbjct: 717  FYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNL------- 769

Query: 781  INGDVEGEGNTKMSKIDNEDLRR-TTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLM 839
                   E +   +  ++ED ++  TPDDIYEIW EESAFER+L+ N D+AW+LMDEMLM
Sbjct: 770  ------LEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLM 823

Query: 840  CTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQK 899
            C+GYRR+LIWF+TH+EL HSLI Y+F+L+MG RG       +  D   ++    + +   
Sbjct: 824  CSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG------INKTDTSKNVKSTFITENIS 877

Query: 900  NEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXXX------------- 946
            + +++ L FSR G + LS++ET+M+LQE F NAAI+ S K                    
Sbjct: 878  DSNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTEEEEF 937

Query: 947  ---DGEKISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDL 1003
               +    S+YS+GL++LIC MV  LI N KF   +S+C FELQTLLM WI ILPEAK+L
Sbjct: 938  DEENEGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKEL 997

Query: 1004 FFKIKTRLA-MEEEDSADTMQHEGRKNSDIEKKLNAKPAS-ELNLKLLNLFPSKPANKDD 1061
             FKI + L+     ++++    EG      ++ ++    S + N  LL L P     K++
Sbjct: 998  SFKINSSLSEFSHVENSELASIEGASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEE 1057

Query: 1062 SSPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYIT 1112
            +   NT R +I DYSFD++V+   R+++    +ILPL  ++KP   H+Y+T
Sbjct: 1058 NIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1103 (38%), Positives = 641/1103 (58%), Gaps = 144/1103 (13%)

Query: 70   LLEALIITLFTTISGKSALRLIQTSSL--------------KERKSWAQSFENNSSSYAS 115
            LLE  ++TLFTT  G+   ++++   L              + R +W    E   S Y  
Sbjct: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSKTPSRIVQQVRTAWT---EEALSKYIH 67

Query: 116  IVLS--WKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNE 173
            +     W+D              ++ A +Q   YN P +KL +S L  S+ +   ++LN 
Sbjct: 68   LFFQHVWRD------------AGDRFAIMQ---YNEPAFKLQVSDLFPSEFSKARLVLNT 112

Query: 174  TYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAENR 233
             Y++L D++ ++  +++ LI  +        +V  I++ Y R+ E  +++ W++ + +  
Sbjct: 113  DYDVLLDFVNTVRPQLKGLIRQAVQ----GSLVDPIVRKYGRVYEFHDYFHWFNLSKKK- 167

Query: 234  VNLTFSDNISLLMENDEGNAGSGLDDS---RFDHQKQPREAIMG-----------RTIND 279
                F++   L++     +      +S   +  +   P    +G           + +  
Sbjct: 168  ----FANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQLGT 223

Query: 280  QEQIYSFELNQD-----GTLEIP-NVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCG 333
             E +Y F+L+++     G   +  ++M+ S  RHE+L ++LNL  + +P L  QF  +  
Sbjct: 224  NEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRMLNLKEIDSPHLYEQFKCMIS 283

Query: 334  LVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDAT 393
            LVDPL QP P+D +++S+D L++LFL  + ++  T  E ND     F +CFNMQKII  T
Sbjct: 284  LVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDT--EQND----TFLLCFNMQKIITRT 337

Query: 394  MLRLNCFDFDILNSVNNT----DNAVH-WKTQLHRWLPHGLNTQDLELLYMIDILAVYTI 448
            + RL C+D+  L S++      DN+ + ++  L  W+P+GLNTQDLELLYM+DI+AVYTI
Sbjct: 338  LWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMAVYTI 397

Query: 449  YKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAA 508
            Y  Y  +PIQLNPFL  LISLWKNLS V+LL+LE+DR EE N T++TPL+VRATIRGA+A
Sbjct: 398  YNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIRGASA 457

Query: 509  LRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIE 568
            LR+V+A VLNG V+ N+HDFKHE LNTFMSP+GRKLC G+LYADLRSH A++L+LG  +E
Sbjct: 458  LRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLGVDLE 517

Query: 569  DVTDLFADLQSGDRFDEDIRYMFDYECEDY--------DESFSESDHGGLDESVVNPTEK 620
            DVT+L +DLQ GDRFDEDIRYMF+YE EDY        DE  + +       +       
Sbjct: 518  DVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATASAAAITAAN 577

Query: 621  IASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATS 680
              +G++    +RRCNCIF DDK++  D +  + G             NR           
Sbjct: 578  EGTGASQ---KRRCNCIFTDDKIIQSDESKVSLGGG----------KNR----------- 613

Query: 681  DHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRG 740
                    P SVR++S+FEFDYSG DWRDVPR  N+Y+ PSY F+  P L    +++ + 
Sbjct: 614  --------PYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVSSKA 665

Query: 741  ATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNED 800
            A  KLN  ES  L++ VAS ++ EQ+ +I+         ++    EG        I   D
Sbjct: 666  AGGKLNPMESQQLLKLVASAIKIEQECIIM--------GTVYPQTEG--------IAVGD 709

Query: 801  LRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSL 860
                TPD+IY+ W ++  F+R+L +N ++AW+LMDE+LMC GYRR+L+WF+TH+EL HS+
Sbjct: 710  DGLLTPDNIYDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSV 769

Query: 861  IYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIE 920
            I+Y+FEL+MGLRG+  S + + ++++   ++ +++    N     L FSRQG + LS+IE
Sbjct: 770  IHYIFELVMGLRGQELSADVTLEEQRKQALHNLMEIDTPN--GGTLMFSRQGNLALSEIE 827

Query: 921  TKMLLQEFFMNAAIFLSSKXXXXXXXDGEKISLYSLGLVRLICYMVQTLIANDKFFFTKS 980
             KMLLQEFF NAAIFLS+        +   +SLYS+GLV+LIC+MV+TLI N KF F+KS
Sbjct: 828  VKMLLQEFFTNAAIFLSASESEEPESETSDVSLYSIGLVKLICFMVKTLIVNHKFEFSKS 887

Query: 981  ECTFELQTLLMTWIGILPEAKDLFFKIKTRLA-----MEEEDSADTMQHEGR-----KNS 1030
            ECTFELQTLLM W+GI+P+A++LFF +K  ++          +   +   G       ++
Sbjct: 888  ECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFPTLTDA 947

Query: 1031 DIEKKLNAKPASELNLKLLNLFP--SKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRV 1088
            D +    A+  SE N KL+ L P  ++   K  S  I+ LR+F+  +S  +++   GRR+
Sbjct: 948  DDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPVLGRRI 1007

Query: 1089 VFYDGKILPLPKADKPIPLHEYI 1111
            V    +ILP    ++ + L EY+
Sbjct: 1008 VRRGSQILPQATPERTVTLREYL 1030

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  740 bits (1910), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1122 (39%), Positives = 632/1122 (56%), Gaps = 145/1122 (12%)

Query: 72   EALIITLFTTISGKSALRLIQTSS-----LKERKSWAQSFENNSS--SYASIVLSWKDND 124
            E L++ LFTT  G S LRL    S     L   K W QS     S  +Y  +V  W  + 
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQRVSDAAYKRMVKRWTSST 110

Query: 125  IXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184
                        N    L    +  P +KL ++FL+  +  +  +++++ YNLL D+   
Sbjct: 111  EHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPETEV--LVIDDEYNLLLDFALQ 168

Query: 185  ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAEN---------RVN 235
                +E L++     D P+L+  K    + R+ +    Y WY+F+AE          +  
Sbjct: 169  CRALVEQLLN---QIDLPSLLA-KCAYGHGRLFQLCGRYVWYTFSAEQFDEAQDICYKYL 224

Query: 236  LTFSDNIS-----------------------------LLMENDEGNAGSGLDDSRFDHQK 266
               +D ++                             L  EN E ++ S   DS  DH  
Sbjct: 225  SVLTDKLTAQQDLIPQIQPLFEIISSSKASHWVYGDGLFTENPESDSNS---DS--DHWP 279

Query: 267  QPREAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLT-PLLE 325
            Q R       ++ QE++YSF+L  DGTLE  NV   +  RH+ L+++LNL    T PLL 
Sbjct: 280  QKR-------LSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVLNLQKQNTAPLLS 332

Query: 326  LQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFN 385
             QF TLC LVDP+ QPTPND HI+SID L  +FLGL+   I        H DW+F++CFN
Sbjct: 333  SQFFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEINEL-----HIDWRFHVCFN 387

Query: 386  MQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAV 445
            +QKI+ AT+ RLNC DF  LNSVNN+D+++ W+  LH+WLP GLNTQDLEL+YMIDILA+
Sbjct: 388  LQKIVQATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELIYMIDILAI 447

Query: 446  YTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRG 505
            Y I+KLY  +P Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG
Sbjct: 448  YIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRG 507

Query: 506  AAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGA 565
            ++ALRSV+AT+LNG V+   HDF+HE +N FMSP+GRKLCHGALY D+RSH A++LALG 
Sbjct: 508  SSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGI 567

Query: 566  SIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESVVNPTEKIASGS 625
             +EDVT+L +DLQ GDRFDED++YMFDYE ++Y+E  +E       E V +  E+I    
Sbjct: 568  ELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDELEDVES-RERIKEMR 626

Query: 626  NNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVT 685
                + +RC+C F+DD+L+ ED  +    ++       A  +N   + N +         
Sbjct: 627  A---YYKRCHCQFDDDELLPEDEEDGRPDASPYRVTRDAPPDNNVKLSNTS--------- 674

Query: 686  SPNPLSVRS-RSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEK 744
               P+++RS + + EFD++G DWR +PR  N Y++ +Y F          SL    A +K
Sbjct: 675  --KPMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKK 732

Query: 745  LNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDV-EGEGNTKMSKIDNEDLRR 803
            L  EE   L+R +A+CV  EQ+  +L       SA + G+  E E ++ +  + + DL  
Sbjct: 733  LPLEEGTQLLRVIATCVAKEQELTVLR------SALLLGETPESENHSTL--VADGDL-- 782

Query: 804  TTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYY 863
             T D +YE W E S FE++L  N  + WR+MDEMLMC+GYRR+LIWF+THLE+ +S+I Y
Sbjct: 783  -TTDFVYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEY 841

Query: 864  VFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIETKM 923
            ++ L++G RG                     +K   + D + +PFSRQG IVLSDIE KM
Sbjct: 842  IYTLVLGNRG---------------------EKAASDGDYAKVPFSRQGAIVLSDIEIKM 880

Query: 924  LLQEFFMNAAIFLSSKXXXX-----------XXXDGEKISLYSLGLVRLICYMVQTLIAN 972
            LLQEFF NAAIF S +                   G  IS + +GL++L+CYMV++L+  
Sbjct: 881  LLQEFFTNAAIFFSKQLRESLGDGEDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLMQK 940

Query: 973  DKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKT-------RLAMEEEDSADTMQHE 1025
            + F F   +  FELQTLLM+WI ILPEA+DLFF +++        + +E E  A   + +
Sbjct: 941  EMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACEPD 1000

Query: 1026 GRKNSDIEKKLNAKPASE-------LNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFD 1078
             +    + +  +A+   E        N KL++L P  PA   ++S I  LRSFI+ +S  
Sbjct: 1001 SQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLP--PAAGTENSAITALRSFISKHSLT 1058

Query: 1079 TQVNPPGRRVVFYDGKILPLPKADKPIPLHEYITLAELDVGD 1120
            T+    GRRV+  D  I+P+  +D+ +   +++    +D  D
Sbjct: 1059 TKTALFGRRVISQDDTIMPMYMSDREMDNRQFLAEFGIDYND 1100

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1278 (38%), Positives = 692/1278 (54%), Gaps = 233/1278 (18%)

Query: 42   NYVPSVENLEKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRLIQT----SSLK 97
            +Y P+++ LE ++  +    D +   +LL E+LI+ LFTT  G S L +I T    ++ K
Sbjct: 17   DYKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74

Query: 98   ERK-------------SWAQSFEN-------NSSSYASIVLS----------------WK 121
            ++K             S     EN       N+++  +I+                  W+
Sbjct: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134

Query: 122  DNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVS----------------KIT 165
            ++ I           N   PL  N +  P  KLPL FL+++                 I 
Sbjct: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194

Query: 166  IPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRN--FY 223
              ++L+++ YNLL DYL+  T  + SL+      +   L+   I+  YN+  E  N    
Sbjct: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLHT----NLDPLLFNNIISSYNKSFELTNDNKC 250

Query: 224  FWYSF-NAENRVNL-TFSDNISL---------LMENDEGNAG--------SGLDDSRFDH 264
             WY F ++++  N  T ++ I +         + +N   NA         S    ++ + 
Sbjct: 251  LWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNISSSSTTKSNM 310

Query: 265  QKQPREAIMGRTINDQ---EQIYSFELNQD----GTLEIPNVMEHSLLRHELLFKILNLT 317
              +   A +   +++    E   SF L ++    G L  P++M H   RH++L KILN+ 
Sbjct: 311  HNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVG 369

Query: 318  T----VLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHN 373
                   +PLL LQF  LC LVDPL QPTPN K+IISID LFQLFLG +   +       
Sbjct: 370  DNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAE 429

Query: 374  DHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQD 433
            D  +WKF +CFNM+KII++ M +LNC DF+ LNS+NN+D +VHW+TQLH+WLP G NTQD
Sbjct: 430  DGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQD 489

Query: 434  LELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTY 493
            LELLYM++ILA YTIYKL E +PIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T+
Sbjct: 490  LELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETF 549

Query: 494  ETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADL 553
            +TPL+VRAT+R + ALRS+IAT+LN  V    HDFKHESLNTFMSPYGRKLC+GALY D 
Sbjct: 550  DTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDF 609

Query: 554  RSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDES 613
            RSH +++LAL   +E VT L +DLQ GDRFDED++YMF++E    D +   +  GG D+ 
Sbjct: 610  RSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFE----DYNTLPNVLGGEDDE 665

Query: 614  VVNPT----EKIASGSNNVFF------------------------RRRCNCIFNDDK--- 642
                T    E +    N  F                          RRCNCIF+DD+   
Sbjct: 666  TSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSDDEIKD 725

Query: 643  -----------------------LVAEDGANEAFGSTNSENVEGAMHNN-RNAVHNATTA 678
                                   L+  + + +    TNSE+ E  +  N  N   +  ++
Sbjct: 726  TSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSS 785

Query: 679  T-----------SDHVVTSP----NPLSVRSRST---FEFDYSGEDWRDVPRDFNMYYSP 720
            T             H V +     NP SV +++    F+FDY+G+DWRD PR  N+YY+ 
Sbjct: 786  TEMESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMNLYYNL 845

Query: 721  SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILAD--LESNFS 778
            +Y FI +P LD++F LTL+    KL+K++S LL+R VAS V+NEQD++I +D  +     
Sbjct: 846  NYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVK 905

Query: 779  ASINGDVEGEGNTKM----SKIDN----EDLRRTTPDDIYEIWSEESAFERMLNVNHDVA 830
              +  + +G  N K+    ++I+N    E +   TPDDIYEIW EESAFERM+ +N++V 
Sbjct: 906  EIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVT 965

Query: 831  WRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDM- 889
            +RLMDEMLMC GYRR+LIWF+THLEL HS+I+Y+FEL+MG RG      A+ +DK  +  
Sbjct: 966  FRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT-EDKHTNTK 1024

Query: 890  --------------IYEILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIF 935
                          +  +L    K  D   LPFSRQG I LS+IE KML+QEF  NAAI 
Sbjct: 1025 GNVNELENKNENELVNMLLNDYSKIFDLQ-LPFSRQGNIELSEIERKMLIQEFLTNAAIH 1083

Query: 936  LSSKXXXX-----------------XXXDGEKISLYSLGLVRLICYMVQTLIANDKFFFT 978
             + +                        D ++ISLYS+GL+RLIC+M+Q  + N+K    
Sbjct: 1084 FNERNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKLKIE 1143

Query: 979  KSECTFELQTLLMTWIGILPEAKDLFFKIKTRLA---------------MEEEDSADTMQ 1023
              +  FELQTLLM WI I+PEAK LFF+IK  ++                 ++D+     
Sbjct: 1144 VDDSIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNTIEN 1203

Query: 1024 HEGRKNSD-IEKKLNAKPASELNLKLLNLFPS-KPANKDDSSPINTLRSFIADYSFDTQV 1081
               + N+D +++       S  N KL+ LFP     NK++++ I+TL++++  + F  +V
Sbjct: 1204 QTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEV 1263

Query: 1082 NPPGRRVVFYDGKILPLP 1099
               GR+V++ DGKIL +P
Sbjct: 1264 PIIGRKVIYEDGKILKIP 1281

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1168 (37%), Positives = 635/1168 (54%), Gaps = 157/1168 (13%)

Query: 69   LLLEALIITLFTTISGKSALRLIQTSSLKERK--SWAQSFE--NNSSSYASIVLSWKDND 124
            +++E +++TLF T  G S L L+   S    K   + QS +  +N   + +    W    
Sbjct: 47   MIVEKVVVTLFMTRGGNSILHLLYDLSCGRIKLSEYRQSLKVRSNVHQWKTCYKEWGSRR 106

Query: 125  IXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184
                        N+   L    Y     KLPL FL+ + +   + +L+E YNLL DY+ +
Sbjct: 107  DTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGLH--AYVLDEGYNLLLDYIIN 164

Query: 185  ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAEN------------ 232
                 E L+           ++ ++++DYNR+ E   +Y WY                  
Sbjct: 165  SRLMWEELL-----IQGIPRLLPELIEDYNRVFEFNGYYTWYGGAPSGAGAANSTRELHT 219

Query: 233  ------------------RVNLTFSDNISLLMENDEG-NAGSGLDDSRFDHQKQ-PREAI 272
                              R+N T   +    M +  G N  S  ++  +D   +   ++ 
Sbjct: 220  KVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINEFSNEEEDLYDFDSELEGDSW 279

Query: 273  MGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLC 332
                 + +EQ+Y+FELN+DG+LE PNV  H+  RHE L++IL L     PLL  QF TLC
Sbjct: 280  PQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYRILGLPNRECPLLRAQFMTLC 339

Query: 333  GLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDA 392
             LVDP+ QP P +KHIISID ++Q+FLG +S  +++S    D   W+F++C N+QKII A
Sbjct: 340  ALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRGQD---WRFHVCHNLQKIILA 396

Query: 393  TMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLY 452
            TM RLNC D ++LNS+NN+D  VHW   + +W P GLNTQDLELLYM+D+L +YTIY+LY
Sbjct: 397  TMKRLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLY 456

Query: 453  EKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSV 512
              +P+Q+NPFL     LWKNL+ V+LL LEIDR EE+  T+ TP++VRATIRG+AALRSV
Sbjct: 457  SDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSV 516

Query: 513  IATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTD 572
            +AT++N      +HDFKHE +N FMSP+GRKLC GALYAD+RSH A++LALG  + DVTD
Sbjct: 517  VATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTD 576

Query: 573  LFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESV-----VNPTEKIASGSNN 627
            L +DLQ GDRFD+D++YMFDYE +DY+    E  +   +E +     +   E+I      
Sbjct: 577  LLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRG- 635

Query: 628  VFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTSP 687
              + +RC+C+F+DD+L++++   +    T++   E       N V   +T       + P
Sbjct: 636  --YYKRCHCVFDDDELLSDEEGTDTGEHTDNHITETVQSAPLNLVTGVST-------SGP 686

Query: 688  NPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNK 747
              ++VRSR   EFD++G+DWRD+PR  N YY   Y F+++   DV+  L     ++KL  
Sbjct: 687  QKVAVRSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLES 746

Query: 748  EESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPD 807
             +S  ++RSVA+C++ EQ++ ++ D             + +  + +S   +E     T D
Sbjct: 747  NQSSFILRSVATCIKLEQEKTMVHD----------AIFKSKDKSPLSASGSEGSNGLTSD 796

Query: 808  DIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFEL 867
             IYE W E++ FE+M+  N+D+ WR+MDEMLMC+GYRR+LIWF+THLEL HS+I+Y+FEL
Sbjct: 797  FIYEKWCEDALFEKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFEL 856

Query: 868  IMGLRGKPFSGEASDQDKKDDMI----YEILKKKQKNEDA--SGLPFSRQGPIVLSDIET 921
            +MG+RG       + +D +++ I     ++L           + +PFSRQGPIVLS IE 
Sbjct: 857  VMGMRGN-----VAYKDLEEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEV 911

Query: 922  KMLLQEFFMNAAIFLSSKXXXXXXXDGEKI-------------------------SLYSL 956
             MLLQEFF+NAAI+ S+        +   +                         S + L
Sbjct: 912  NMLLQEFFINAAIYFSNYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVL 971

Query: 957  GLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEE 1016
            GL++L+C+MV  LI   K  FT SE  FELQTLLM WIG++PEA+ LFFK+K+ L     
Sbjct: 972  GLMKLLCFMVDMLIEKKKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSA 1031

Query: 1017 DSADTMQH-------------------------------EGRKNSDIEKKLNAKPASE-- 1043
             +   + H                               +G    DI    N +P S   
Sbjct: 1032 LNGSALSHLEGELASNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAAN 1091

Query: 1044 -------------LNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRRVVF 1090
                          N  L+ L P  P + D+++ +  LRSFIA +   T+    GRRV++
Sbjct: 1092 SAPNGMSESNISYCNQMLIKLLP--PHSADENAAVTALRSFIAKHPLTTKTAIFGRRVIY 1149

Query: 1091 YDGKILPLPKADKPIPLHEYITLAELDV 1118
             D  I+ L  ADK +   E+  LAE  +
Sbjct: 1150 QDNAIMGLYMADKELQQREF--LAEFGI 1175

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1113 (39%), Positives = 640/1113 (57%), Gaps = 130/1113 (11%)

Query: 72   EALIITLFTTISGKSALRLIQTSS-----LKERKSWAQS-FEN-NSSSYASIVLSWKDND 124
            E L+I LFTT  G S L+L    S     L   K W QS F++   + Y  +V  W  + 
Sbjct: 48   EKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTGSS 107

Query: 125  IXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184
                        N +  L    +   EYKL ++FL+     +  +++++ YNLL D+L  
Sbjct: 108  DYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTEL--LIIDDEYNLLLDFLLQ 165

Query: 185  ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYSFNAEN------------ 232
                +E L+S +   D P+L+ +  L  ++R+ +    Y WY+F+ E             
Sbjct: 166  TRASVEELLSQA---DLPSLIAKSALS-HHRLFQLSGRYVWYTFSDERFAEAQDICYKYL 221

Query: 233  ---------------RVNLTF-SDNISLLMENDEGNA--GSGLD-DSRFDHQKQPREAIM 273
                           ++   F S N S L    +G++    G++ DS  D    P+    
Sbjct: 222  SVLTDKLTAQQDLIPQIQPLFDSVNSSRLAHLSQGDSLYSEGVESDSNSDSDHWPQ---- 277

Query: 274  GRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTV-LTPLLELQFSTLC 332
             + ++  E+IYSF+L  DGTLE PNV   +  RH+ L+++L L     +P L+ QF TLC
Sbjct: 278  -KKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVLRLQQQNSSPCLKAQFFTLC 336

Query: 333  GLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDA 392
             LVDP+ QPTPND HIISID L  +F+GL+   IK        ++W+F++CFN+QKI+ +
Sbjct: 337  ALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEIKQLP-----FNWRFHICFNLQKILQS 391

Query: 393  TMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLY 452
            T+ RLNC DF  LNSVNN+D+++ W+  LH+WLP GLNTQDLEL+YMIDILA+Y I+KLY
Sbjct: 392  TLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLELVYMIDILAIYIIHKLY 451

Query: 453  EKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSV 512
               P+Q+NPFL S+ISLWKNL+ V+LL LEIDR EEE  T+ TP++VRA IRG++ALRSV
Sbjct: 452  RDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFSTPVLVRAAIRGSSALRSV 511

Query: 513  IATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTD 572
            +ATVLNG V+   HDF+HE +N FMSP+GRKLCHGALY D+RSH A++LALG  +EDVT+
Sbjct: 512  VATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRSHAAAMLALGIELEDVTN 571

Query: 573  LFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRR 632
            L +DLQ GDRFDED++YMFDYE ++Y+E     D    +   V   E+I        + +
Sbjct: 572  LLSDLQPGDRFDEDVKYMFDYEYDNYNE-VGTEDMDEEELEDVESRERIKEMRA---YYK 627

Query: 633  RCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSV 692
            RC+C F+DD+L+ E+        +++  +   +  + N V  + TA          P+++
Sbjct: 628  RCHCQFDDDELLPEEEEESGIPISHTR-ISKELPPDTN-VKLSNTA---------KPVAL 676

Query: 693  RSRS-TFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESI 751
            R++  T EFD++G DWRD+PR  N Y++ +Y F    K     +L    A  +L+KEE++
Sbjct: 677  RNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAV 736

Query: 752  LLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYE 811
             L+R V++CV  EQ+  +   L S F+A    D     + + + + + DL   T D IYE
Sbjct: 737  HLLRLVSTCVAKEQEHTV---LRSAFAA----DDSQALSCQSTLVADGDL---TTDYIYE 786

Query: 812  IWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGL 871
             W ++S F++ML  N  + WR+MDEMLMC+GYRR+LIWF+THLE+  S+I Y++ L+MG 
Sbjct: 787  NWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLVMGN 846

Query: 872  RGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMN 931
            RG+  + E +   K                    LPFSRQG IVLS+IE KMLLQEFF N
Sbjct: 847  RGEKLANEETPFGK--------------------LPFSRQGDIVLSEIEIKMLLQEFFTN 886

Query: 932  AAIFLSSKXXXXXXXDGEK------ISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFE 985
            AAIF S +       + E+      IS Y +GL+RL+C+MV++LI  + F F   +  FE
Sbjct: 887  AAIFFSKQLRESLGDEEEEETENLGISPYIVGLMRLVCFMVKSLIQEEMFDFKDPDYIFE 946

Query: 986  LQTLLMTWIGILPEAKDLFFKIKTRLAMEEEDSA----DTMQ--------------HEGR 1027
            L+TLLM+WI ILPEA+DLFF +++R+  +    A    D M                E  
Sbjct: 947  LETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLSPDFRTTDEND 1006

Query: 1028 KNSDIEKKLNAKPASELNLKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNPPGRR 1087
             +SD E+       S  N KL++L P  P    +++ +  LRSFI+ +S        GRR
Sbjct: 1007 GSSDSEE---TNSVSIYNKKLISLLP--PVVGTENTAVTALRSFISKHSLTMGTAVFGRR 1061

Query: 1088 VVFYDGKILPLPKADKPIPLHEYITLAELDVGD 1120
            V+ +D +I+ +  +DK I    ++    +D  D
Sbjct: 1062 VINHDDRIMSMYMSDKDIDNRNFLAEFGIDYND 1094

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/933 (40%), Positives = 561/933 (60%), Gaps = 115/933 (12%)

Query: 275  RTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGL 334
            + ++ +EQ+++F+LN+DGTLE PNV  H+  RHE+L+++L L     PLL+ QF TL  L
Sbjct: 283  QKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAEGPLLKAQFMTLAAL 342

Query: 335  VDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATM 394
            VDP+ QP P + HIISID +FQ+FLG  S  I+         DW+F++C+NMQKI+ ATM
Sbjct: 343  VDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISRGR-DWRFHVCYNMQKIVLATM 401

Query: 395  LRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEK 454
             RLNC D D+LN+VNN+D +VHW   L +W P GLNTQDLELLYM+D+L++Y +Y+LY  
Sbjct: 402  KRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELLYMVDMLSIYAMYRLYSY 461

Query: 455  IPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIA 514
            +P+Q+NPFL   + LWKNL+ V+L  LEIDR EE+  T+ TP++VRA IRG AALRSV+A
Sbjct: 462  LPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPIIVRAAIRGTAALRSVVA 521

Query: 515  TVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLF 574
            T++N    + +HDFKHE +N FMSP+GRKLCHGALYAD+RSH A++L+LG  + DVTDL 
Sbjct: 522  TMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHAAAMLSLGIDLNDVTDLL 581

Query: 575  ADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDESV-----VNPTEKIASGSNNVF 629
            +DLQ GDRFD+D++YMFDYE +DY+    E  +   +E +     +   E+I        
Sbjct: 582  SDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRG--- 638

Query: 630  FRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTS--- 686
            + +RC+C+F+DD+L+++    E  G T S N++   ++     HN+    S  + T+   
Sbjct: 639  YYKRCHCVFDDDELLSD----EEEGETASSNIDRPKYS-----HNSLNLPSSMLSTTFNG 689

Query: 687  PN--PLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEK 744
            PN    ++RSR   +FD++G+DWRD+PR  N YY+  Y F+++   DV++ L     T+K
Sbjct: 690  PNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKK 749

Query: 745  LNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNEDLRRT 804
            +    +  ++RS+A+C++ EQ++ ++ D+       +NG  + +G++  S  D   +   
Sbjct: 750  MEPNHASFILRSIATCIKLEQEKSMVYDV-------MNGRTD-KGSSSNSNSDR--VNEL 799

Query: 805  TPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYV 864
            T D IYE W EES F +M+  N+D+ WR+MDEMLMC+GYRR+LIWF+THLE+ HSLI+Y+
Sbjct: 800  TSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYI 859

Query: 865  FELIMGLRGK-PFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLSDIETKM 923
            FEL+MG+RG   +  EA D  K  ++          +     +PFSRQGPI+LS IE  M
Sbjct: 860  FELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINM 919

Query: 924  LLQEFFMNAAIFLSSKXXXXXX----------------------XDGEK----ISLYSLG 957
            LL EFF+NA I+ S                               DG+K    +S + +G
Sbjct: 920  LLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIG 979

Query: 958  LVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEED 1017
            L++L+C+MV  L+   KF FT SE  FELQTLLM WIGI+PEA++LFFK+K+ + +E   
Sbjct: 980  LMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLKSSI-LEASS 1038

Query: 1018 SADTMQHEGRKNSDIEKKLNAKPASE---LNLKLLNL--------------FPSKPAN-- 1058
              D+ + + +   +I KK +    +E   +  K++N+              FP  P +  
Sbjct: 1039 QNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADFPPTPIDIN 1098

Query: 1059 ---------------------------------KDDSSPINTLRSFIADYSFDTQVNPPG 1085
                                              ++++ +  LRSFI  +S   +    G
Sbjct: 1099 NLKLENVGSPEIDNNNNLSKYNKMLIELLPLHVDNENTAVTALRSFITKHSLTNKTAVFG 1158

Query: 1086 RRVVFYDGKILPLPKADKPIPLHEYITLAELDV 1118
            RRV++ D  I+ L  ADK +   E+  LAE  +
Sbjct: 1159 RRVIYQDHAIMGLYMADKEMRQREF--LAEFGI 1189

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 66/163 (40%), Gaps = 11/163 (6%)

Query: 69  LLLEALIITLFTTISGKSALRLIQTSSLKERK--SWAQSFE--NNSSSYASIVLSWKDND 124
           L+ E +++TLF T SG S L ++        K   + QS +  +N S + S    W    
Sbjct: 47  LITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSRR 106

Query: 125 IXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVSKITIPSILLNETYNLLKDYLYS 184
                       N+   L    Y     KLPL FL+   +     L+++ YNLL DY+  
Sbjct: 107 DILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLR--PYLIDDEYNLLLDYMIQ 164

Query: 185 ITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFWYS 227
                E L++       P LV      +YNR  E   +Y WY 
Sbjct: 165 SRPMWEMLLTQGIPKFLPELV-----DEYNRSYEFNGYYVWYG 202

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/901 (43%), Positives = 566/901 (62%), Gaps = 110/901 (12%)

Query: 280  QEQIYSFELNQDGTLEIP-NVMEHSLLRHELLFKILNLTTV-LTPLLELQFSTLCGLVDP 337
            +E++YSF+LN DG++ +P N+M ++  RH++L K+LN  +   +PLLELQF  + GLVDP
Sbjct: 394  EEKVYSFDLNNDGSITMPENLMLNTKKRHQILNKLLNSNSFDSSPLLELQFKLMLGLVDP 453

Query: 338  LMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRL 397
            L QP PNDKHIIS+D L+QLF+ ++  + +  Q +N  ++WK ++CF M KII+  M +L
Sbjct: 454  LSQPPPNDKHIISLDLLYQLFIAILYPNFEIFQ-NNLGFNWKTHVCFQMVKIINNCMEKL 512

Query: 398  NC------FDFDILNSVNN-----------------TDNAV--HWKTQLHRWLPHGLNTQ 432
            NC      +D       NN                 TD  V  +W++ L +WLPHGLNTQ
Sbjct: 513  NCNDLQKLYDLTGFQGENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQ 572

Query: 433  DLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 492
            DLELLYM+ ILA YT+ KL  +IPIQLNPFL +LI+LWK L+ +++L L+IDR EE + T
Sbjct: 573  DLELLYMVMILASYTLQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHET 632

Query: 493  YETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYAD 552
            Y+TPL+V+ATIRGA+ALRSV+AT+LN  ++ NDHDFKHE+LNTFMSP+GRKLC+GALY D
Sbjct: 633  YKTPLLVKATIRGASALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCD 692

Query: 553  LRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDE 612
            ++   ASL ALG  + ++ +L + L+ GDRFDEDI YMF+YE +DY+ +  E +H  L +
Sbjct: 693  IKLFAASLYALGMDLIEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKE-NHEDLGK 751

Query: 613  SVVNPTEKIASGSNNVF---------FRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEG 663
            ++     K    +++++         ++RRCNCIF DDK++ +D                
Sbjct: 752  TL-----KSNDDNSDIYVLNEVKLDRYQRRCNCIFEDDKILQDDDDGNG----------- 795

Query: 664  AMHNNRNAVHNATTATSDHVVTSPNPL-------SVRSRSTFEFDYSGEDWRDVPRDFNM 716
               + +         T  +V +  +PL       +VRS++TFEFDYSG+DWRD+PR FN+
Sbjct: 796  ---DEQQGEQEEQEGTPKNVASFQDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNI 852

Query: 717  YYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADL--- 773
            YYS SYSFI +  LD + +LT + +T+KLN ++SI L++ +AS ++ EQ+ MI+ DL   
Sbjct: 853  YYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKG 912

Query: 774  -ESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 832
             +   S  IN  V  +   + S +        TPDDI++ W ++  F  ML+ N +++WR
Sbjct: 913  KDQLHSNIINPLVNSKEEKERSTV------VATPDDIFDYWFDKDVFVEMLHFNEELSWR 966

Query: 833  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYE 892
            LMDEMLMC GYRR+LIW++TH++L HSLI Y+FEL+MGLRG PF   A++ + K+++++E
Sbjct: 967  LMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFELLMGLRGSPF---ANNNECKNELLHE 1023

Query: 893  ILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIF----------------- 935
            ++  K K  D    PFSRQGP++LSDIETKMLLQEFF NAAI+                 
Sbjct: 1024 LMLGK-KIVDNHTYPFSRQGPLILSDIETKMLLQEFFSNAAIYFDNDLATNEGDGQLEHT 1082

Query: 936  ---LSSKXXXXXXXDGEKISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMT 992
               +S         +   +S+YS+GL++LIC MV +LI N KF FTKS+C FELQTLLM 
Sbjct: 1083 TEDISINSDEIENNENHGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMN 1142

Query: 993  WIGILPEAKDLFFKIKTRLAMEEE-----DSADTMQHEGRKNSDIEKKLNAKPASELN-- 1045
            WIGIL EAK+LFFK+K+ +    E     D  D    + RK+S+   K       ++N  
Sbjct: 1143 WIGILKEAKELFFKLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKWEGSRIGKMNDF 1202

Query: 1046 ----LKLLNLFPSKPANKDDSSPINTLRSFIADYSFDTQVNP-PGRRVVFYDGKILPLPK 1100
                L+LL    S   + +  +     R  + +YSF ++     GR+VV+ D +ILPLPK
Sbjct: 1203 NKRLLRLLAPIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLPK 1262

Query: 1101 A 1101
             
Sbjct: 1263 V 1263

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 101/211 (47%), Gaps = 28/211 (13%)

Query: 33  PLQELL-------KDKNYVPSVENLEKILYNETMFNDQKICS-----NLLLEALIITLFT 80
           P+ EL+       K K Y P++ENL+  L +E  F + +        +++LE L+I  FT
Sbjct: 68  PMSELIPTIFTNHKFKIYKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFT 127

Query: 81  TISGKSALRLIQTSSLKERKSWAQSFENNSSSYASIVLSWKDNDIXXXXXXXXXXANKTA 140
           T SG+S L     + L + K    + +N       +  +W+ N+            NK  
Sbjct: 128 TKSGQSIL-----NYLFDTKRKPPTVQN-----KILRKTWEVNEFLYFCFIDFLIRNKNN 177

Query: 141 PLQINRYNLPEYKLPLSFLI----VSKITIPSILLNETYNLLKDYLYSITGRIESLISCS 196
            + I+++N PE KL + FL+    +S I  PSI+L+  YN+L DYL + +  +  LI   
Sbjct: 178 EINIDKFNEPENKLSIKFLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKM- 236

Query: 197 STFDKPALVVRKILKDYNRMIECRNFYFWYS 227
           +  +        I++ YNR+ +    + WY+
Sbjct: 237 TILNVGPFFYNTIIR-YNRIPQFNGHFQWYT 266

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  693 bits (1788), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1127 (37%), Positives = 618/1127 (54%), Gaps = 107/1127 (9%)

Query: 44   VPSVENLEKILYNE----TMFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLKER 99
            V   E LEKI  +E    T ++  +   N   E L I LFTT  G   L   + + L   
Sbjct: 86   VIPFEYLEKIYRDEDLSTTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFFKNTGLDSA 145

Query: 100  KSWAQSFEN--NSSSYASIVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLS 157
                 S +   +S +Y  + + WK  D            N+   + +  Y    YK PL+
Sbjct: 146  IEHNDSDDTLFHSPAYEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLT 205

Query: 158  FLIVSKITIPS------ILLNETYNLLKDYLYSITGRIESLISCS--STFDKPALVVRKI 209
            FL+    T P+       LL+E +N+L++YLY+    I+S I+ +  ST  K        
Sbjct: 206  FLL----TCPNNNIKHRFLLSEEFNILEEYLYAAQSNIKSKIAIAIQSTIGKHMNFFTMT 261

Query: 210  LKDYNRMIECRNFYFWYSFNAENRVNLTFSDNI-SLLME--------------------N 248
            L  Y+R+ E    Y  Y    +      F +++  +L+E                    N
Sbjct: 262  LHLYDRVTEYNQSYLRYEITDDENALCQFDESLLDVLLEFERYVTTDDIEAILLQSGRIN 321

Query: 249  DEGNAGSGLDDSRFDHQKQPREAIM---GRTINDQEQIYSFELNQDGTLEIPNVMEHSLL 305
               +  S ++   +  ++    ++     +  N++E I SF++N++G  E+PN+M+ S+L
Sbjct: 322  KVKDISSAIERGDYKWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSML 381

Query: 306  RHELLFKILNLT--TVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMS 363
            RH +LF+ L L+    L P LE+QF TL GLVDPL QPTPND HIISID L  L+ GL+ 
Sbjct: 382  RHSILFEFLGLSQRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVH 441

Query: 364  QS-IKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLH 422
             + IK+ +  N  YDWK+   FN+ KI+  ++ +L+C  +D LN++ N +    W+  L 
Sbjct: 442  PALIKSGKARN--YDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLE 499

Query: 423  RWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALE 482
             W+P  LNTQDLELLYMIDIL+VY IYKLYE  PIQ NPFLF L S+WK ++ +I L L+
Sbjct: 500  YWIPKNLNTQDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQ 559

Query: 483  IDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGR 542
            +DRIEE+N + ETPLM+RAT+RGA+A R+ + T+LN  ++NN+HDFKHE +NTFMSP+GR
Sbjct: 560  VDRIEEQNDSEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGR 619

Query: 543  KLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESF 602
            KLC G+LYAD+R  T   +  G  ++D+T+L  DLQ GDRFDED+ YMFDYE EDY+   
Sbjct: 620  KLCSGSLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLV- 678

Query: 603  SESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVE 662
              SD   +DE   N ++ +      +F  RRCNC+F DDK++ E        + + +++ 
Sbjct: 679  --SDSEDMDEKADNESDGVRPAP--IF--RRCNCVFEDDKIMDE-------STIDHQSLI 725

Query: 663  GAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPSY 722
              M    NA+          +++ P P +VR RS F+F+Y G+DWRD+PR  N+YY+  +
Sbjct: 726  TDMELENNAISTKDENDKIKIISQPEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEF 785

Query: 723  SFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASIN 782
             F+ E       S   +     L+  ES  L++ VASC+R EQD+M++    S    + N
Sbjct: 786  VFVQECSSSEFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLA-N 844

Query: 783  GDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTG 842
            GDV              +  + T D+IY+  S  + F +ML  + ++A  LMDE+LM  G
Sbjct: 845  GDV--------------NKSKLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVG 890

Query: 843  YRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNED 902
            YRR+LIWFLTH+ +   LI+Y+FEL+MG R     G+A+  +              K   
Sbjct: 891  YRRVLIWFLTHINITFPLIHYIFELVMGYRVGFSDGDANGDN-------------NKKSS 937

Query: 903  ASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXX-----------XXXDGEKI 951
                 FSR G + LS IE +MLLQEFF+NA + LS+K                  D E I
Sbjct: 938  TGKCGFSRLGTVALSSIEKQMLLQEFFLNATVSLSAKSFESNGTEIDNYDDNADEDNEYI 997

Query: 952  SLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFKIKTRL 1011
            S Y++G+V LIC MV+TL+   +   +KSE T ELQTLL+ WI ++PEAK+LFF +K   
Sbjct: 998  SSYAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQE- 1056

Query: 1012 AMEEEDSADTMQHEGRKNSDIEKKLNAKPASELNLKLLNLF-PSKPANKDDSSPINTLRS 1070
               E D  D+++            +N +PA+  ++ L +    S  ++  +S+  + L +
Sbjct: 1057 -AHEFDIQDSLEPINESELQTSGNIN-EPAATDSIPLDDTINTSLTSSTKNSNATDALST 1114

Query: 1071 FIADYSFDTQVNPP--GRRVVFYDGKILPLPKADKPIPLHEYITLAE 1115
            F+     +T V PP  GR+V++   KILPLP+ ++PIP H     AE
Sbjct: 1115 FLETVE-ETSVQPPQIGRKVIYKGTKILPLPEQERPIPFHLLFERAE 1160

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1157 (36%), Positives = 609/1157 (52%), Gaps = 146/1157 (12%)

Query: 26   VHFKDFIPLQELLKDKNYVPSVENLEKILYNETMFNDQKICSN----LLLEALIITLFTT 81
            V  KD +P         Y PSV NL+ +L N  +  D     N    L  E +++TL  +
Sbjct: 3    VTLKDILP--------KYRPSVYNLKNLLRNNELVLDMLADVNERNVLASEVVMMTLLCS 54

Query: 82   ISGKSALRLIQTS--SLKERKSWAQSFENNSSSYASIVLSWKDNDIXXXXXXXXXXANKT 139
             SG S L    ++  ++ + K+   S    +++ A   L W++ND+          +N+ 
Sbjct: 55   KSGSSMLEYYMSNIDTIDDYKTSENSIYKKNTALA---LRWENNDVLLIKFLTILLSNRK 111

Query: 140  APLQIN-------RYNLPEYKLPLSFLI-----VSKITIPSILLNETYNLLKDYLYSITG 187
              ++           N+  +   L FL       +     +I+ +E ++ L+ Y   I  
Sbjct: 112  TLIKFTTGKDDTLSKNMA-FAQDLRFLFNKHYDETSYLPAAIVKSEQFDYLEAYCSIIWP 170

Query: 188  RIESLISCSSTFDKPALVV-----RKILKDYNRMIECRNFYFWYSFNAE--NRVN-LTFS 239
            +I++++  S   DK    V      KI+K Y R          Y  +AE    +N LT S
Sbjct: 171  KIKNILLESLNIDKQFQDVTNSFFHKIIKLYKRE---------YLVSAEFLTLINVLTNS 221

Query: 240  DNISLLMENDEGNAGSGLDDSRFD----HQKQPREAIMGRTINDQEQIYSFELNQDGTLE 295
               S ++   EG   S  D   +     +  + RE +M      Q    S  L  D    
Sbjct: 222  VLFSYIVMLSEGYISSNYDGLLYKSPPTYNVKQRENMMNSFGEFQS---SAMLTNDENNS 278

Query: 296  IPNVMEHSLLRHELLFKILNLTTV--LTP----LLELQFSTLCGLVDPLMQPTPNDKHII 349
            I ++M+ +  R  +L+K+L  + +  + P    L+ L F+ +C LVDPL QP PND+H+I
Sbjct: 279  I-DLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVI 337

Query: 350  SIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVN 409
            S+D L+++FL +M   ++   E    YDW++ +  N+QKI+    L LNC+D + LN V+
Sbjct: 338  SLDLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKVD 397

Query: 410  NTDNAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISL 469
             T    HWK QLH WLPHGLN Q+LELLYMI I  VY I+KLYE  P+  NPFL +L+S 
Sbjct: 398  ETK---HWKEQLHLWLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLST 454

Query: 470  WKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFK 529
            WK L+ V+L  L++DR EEEN ++ TP+MVRATIRGA+ALRSV+A++LN  +    HDF+
Sbjct: 455  WKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQ 514

Query: 530  HESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRY 589
            HE LNTFMSP+GRKLC GALYADL+S+TAS+LA G   +D+T+L + LQ GD FDED++Y
Sbjct: 515  HEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKY 574

Query: 590  MFDYECEDYDESFSESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGA 649
            MF+YE +DY+E   +      + +  N  E I    N    RRRC C+F+DD ++     
Sbjct: 575  MFEYEYDDYNEPEEDESDEDGERN--NSEENIKFNFN----RRRCRCVFSDDDVLEHGDF 628

Query: 650  NEAFGSTNSENVEGAMHNNRNAVHNATTATSDHVVTSPNPLSVRSRSTFEFDYSGEDWRD 709
            N+A    NSE        N N V N            PN    + ++  EFD+ G+DWR 
Sbjct: 629  NDA----NSEYSNS--EENSNDVDNFVL---------PNDGIDKPKNGVEFDFDGKDWRA 673

Query: 710  VPRDFNMYYSPSYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMI 769
            VPR  NM+YS  Y FI  P   +I SL    +   L+K++S LL+R++AS ++  QD  I
Sbjct: 674  VPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRI 733

Query: 770  LADLESNFSASINGDVEGEGNTKMSKIDNEDLRRTTPDDIYEIWSEESAFERMLNVNHDV 829
            L            G       T  SK  N      +  D+ ++ +    FE +L  N ++
Sbjct: 734  L------------GSKRSPNGTDSSKSQN----GLSTGDLIKLITAGDTFENILKFNREL 777

Query: 830  AWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDM 889
               LMDE+LM  GYRR+L+WFLTHL L H++IYY+FEL+M  R     G+ SD +++   
Sbjct: 778  GCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELLMHHR-----GQVSDTERE--- 829

Query: 890  IYEILKKKQKNEDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKXXXXXX---- 945
                       +      FSRQG + LSD+E +MLLQEFF NA +F SSK          
Sbjct: 830  -----------QSELSYTFSRQGELRLSDLEREMLLQEFFTNATMFFSSKSVLFASDTGD 878

Query: 946  -------XDGEK--ISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGI 996
                    DGE+   SLY++GL+R+ C M+ +L  N  F  + SE  FELQTLLM WI I
Sbjct: 879  NNEINTDVDGEEGLYSLYAVGLMRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINI 938

Query: 997  LPEAKDLFFKIKTRL-AMEEEDSADTMQHEGRKNSDIEKKLNAKPAS-ELNLKLLNLFPS 1054
            +PEAK LFFK+K  + +    D+ +    E    +  +  ++        N KLL  FP 
Sbjct: 939  IPEAKLLFFKLKESVKSFNGIDNPELKSIEESSTTTKKTTIDENSEQYRFNKKLLKTFPK 998

Query: 1055 KPANKDDSSPINTLRSFIADYSFDTQVNPP--GRRVVFYDGKILPLPKADKPIPLHEYIT 1112
              +  D    + T + F+ +YSFD++  PP  GR+V++   +IL L   +KPI LH++++
Sbjct: 999  SFSGDDGDILLKTFKDFLRNYSFDSE--PPYIGRKVIYESDEILQLTDIEKPISLHKFLS 1056

Query: 1113 LAEL-------DVGDSE 1122
              +L       D GD E
Sbjct: 1057 GEQLYDVDIQFDYGDKE 1073

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  389 bits (1000), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 308/1040 (29%), Positives = 506/1040 (48%), Gaps = 91/1040 (8%)

Query: 51   EKILYNETMFNDQKICSNLLLEALIITLFTTISGKSAL-RLIQTSSLKERKSWAQSF-EN 108
            EK         D  +  ++LLE L+I LFTT+ G++ + +LI  +         +     
Sbjct: 4    EKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLINDAKRTNDVDGVECLIRM 63

Query: 109  NSSSYASIVLSWKDNDIXXXXXXXXXXANKTAPLQINRYNLPEYKLPLSFLIVS---KIT 165
            N   + ++  +W  +             N+T  + + RY+   +K+ + FL+ +   K T
Sbjct: 64   NDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTNQDPKFT 123

Query: 166  IPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIECRNFYFW 225
             P   L +T N+L DYL++    IES++      D    +  + L  YNR+ E    Y W
Sbjct: 124  AP---LWDTSNILLDYLHNAKPLIESVLK---KLDGSQFL--QCLMKYNRLYEFNGSYQW 175

Query: 226  YS-----FNAENRVNLTFSDNISLLMENDEGN----AGSGL--DDSRFDHQKQPREAIMG 274
            ++      +AE+   +   ++  L    + GN    A S L   D R +  +   +    
Sbjct: 176  FTPPQSTSHAESPTTILERNSTFLSTLGNFGNDMVRALSQLKTGDIRLNSLESYGKNSGH 235

Query: 275  RTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHELLFKILNLTTVLTPLLELQFSTLCGL 334
                  +Q     LN +G  +          R  L FK L L     PLL  QF++LC  
Sbjct: 236  NNPPLSKQDDHNPLNLNGKSD----------RFNLFFK-LGLHKEPHPLLAEQFNSLCLF 284

Query: 335  VDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHNDHYDWKFYMCFNMQKIIDATM 394
             DP+ QP PND HIIS+D L  L+LG ++  I      N    WK ++  N++ I  A +
Sbjct: 285  ADPMTQPPPNDSHIISLDLLHDLYLGSLTAYI-VKLIPNYQKVWKIHLSANLETITLAIL 343

Query: 395  LRLNCFDFDILNSVNNTD--NAVHWKTQLHRWLPHGLNTQDLELLYMIDILAVYTIYKLY 452
              L  +D+  L+++ +    +   +   +  W+P+ L+  ++E+LYMI  L+ Y+++K++
Sbjct: 344  QMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMH 403

Query: 453  EKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSV 512
               P +LNPFL  ++  W+ LS  ++L L+IDR EE    Y TP++V A IRGA+ALRS+
Sbjct: 404  SDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSI 463

Query: 513  IATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTD 572
            IAT+LNG V    HDFKH+    FMSP+GRKLC+GALY     + A+LL  G   +++ +
Sbjct: 464  IATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVE 523

Query: 573  LFADLQSGDRFDEDIRYMFDYECEDYDESFSE--SDHGGLDESVVNPTEKIASGSNNVFF 630
            L  D+Q GDR DED+RYMFDYE  DY+++ +   +D   +  S  N  E+          
Sbjct: 524  LLTDIQKGDRIDEDVRYMFDYEYFDYNDADTSKLTDGKLMFTSTKNELEQKNRFRMLRGL 583

Query: 631  RRRCNCIFNDDKLVAEDGANEAFGSTNSE-NVEGAMHNNR--NAVHNATTATSDHVVTSP 687
             +RC C F+D+    +D  ++     N E +V G   N +   A    T + S + V   
Sbjct: 584  YKRCLCKFSDEDDNDDDDDDDDDDDYNGEKSVVGLDENGQINEAETPQTFSESSNAVAFT 643

Query: 688  NPLSVR-------SRSTFEFDYSGEDWRDVPRDFNMYYSPSYSFIHEPKLDVIFSLTLRG 740
            + ++ R       S  T  +D +G+DWRD+PR  N+YY   Y F+ +     +F L  R 
Sbjct: 644  SLMTHRDSQNDFVSHLTTGYDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRL 703

Query: 741  ATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASINGDVEGEGNTKMSKIDNED 800
                +   ++  ++RS+A+CV+ EQ+Q++L  + +                  +++D + 
Sbjct: 704  PDRNVTFSQACTVLRSIATCVKLEQEQILLKLITAT----------------SAEVDLKV 747

Query: 801  LRRTTPDDIYEIWSEESAFERML---NVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELK 857
            L  +T + I  I++++    +       N  + W++ DE++M  G+RR+LI+ LTH    
Sbjct: 748  LPFSTDEVITAIFNDDGGIIKPFPFSGCNDSLGWKIFDELMMSHGHRRLLIYHLTHRSYT 807

Query: 858  HSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKNEDASGLPFSRQGPIVLS 917
             S I+YV+EL+ GLRG P      +  K   +         + E  + + FSRQG I LS
Sbjct: 808  FSSIHYVYELLFGLRGNPARSYDLESTKNKQLGILSWTPTGEFERVAAIEFSRQGVIELS 867

Query: 918  DIETKMLLQEFFM----------NAAIF--LSSKXXXXXXXDGEKISLYSL--------G 957
             IE KMLLQEFF+          N A F   S K       D      +S         G
Sbjct: 868  AIEKKMLLQEFFVGVSSGLLGEYNDAGFEAFSIKNPSKVYVDDYGEEFFSATSRKAEMSG 927

Query: 958  LVRLICYMVQTLIANDKFFFTKSE-CTFELQTLLMTWIGILPEAKDLFFKIKTRLAMEEE 1016
             V+++C++++ ++ + +F F   E   +EL+  LM W     EA  ++  +K++ A+ + 
Sbjct: 928  KVKMVCFILEEVLNDKEFEFVPHEDYVYELKRFLMQWSTFSAEACSMYALLKSK-ALGKV 986

Query: 1017 DSADTMQHEGRKNSDIEKKL 1036
                T   + R N+D + +L
Sbjct: 987  LDLGTEGLDDRPNTDPDDQL 1006

>Suva_8.50 Chr8 complement(96994..98229) [1236 bp, 411 aa] {ON}
           YHL003C (REAL)
          Length = 411

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 12/115 (10%)

Query: 382 MCFNMQKIIDATMLRLNCFD-----FDILNSVNNTDNAVHWKTQLHRWLPHGLNTQ-DLE 435
           +CF    +I  T LR    D     F +   V++         Q++    +G++    L 
Sbjct: 133 LCFVFFYMIFFTFLREFLMDVVIRPFTVFLKVDSEHRQKRMMEQMYAIFYYGISGPFGLY 192

Query: 436 LLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISL-----WKNLSCVILLALEIDR 485
           ++Y  D+    T+  +Y   P   NPFLF +  L     W   +CV++L LE  R
Sbjct: 193 IMYHSDLWLFKTL-PMYRTYPDITNPFLFKIFYLGQAAFWAQQACVLVLQLEKPR 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,916,908
Number of extensions: 5984956
Number of successful extensions: 19894
Number of sequences better than 10.0: 45
Number of HSP's gapped: 20320
Number of HSP's successfully gapped: 60
Length of query: 1122
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1002
Effective length of database: 39,721,479
Effective search space: 39800921958
Effective search space used: 39800921958
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)