Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR133W (PEX4)3.495ON1831839721e-136
Smik_6.2293.495ON1651657551e-103
Suva_7.4213.495ON1651657111e-96
Skud_7.4443.495ON1621616999e-95
CAGL0I10450g3.495ON1621644281e-53
Kwal_55.212463.495ON1601594221e-52
TPHA0D042603.495ON1581584123e-51
SAKL0F02706g3.495ON1611604115e-51
NDAI0G009103.495ON1631584108e-51
NCAS0E007803.495ON1711624101e-50
KLTH0F14894g3.495ON1661594056e-50
TDEL0D056303.495ON1501563993e-49
ZYRO0D09878g3.495ON1531563983e-49
Kpol_480.133.495ON1571573863e-47
TBLA0C045003.495ON1651593361e-39
AFR314W3.495ON1551613308e-39
Ecym_12343.495ON1611583177e-37
KNAG0B007803.495ON1531563169e-37
KAFR0C019903.495ON1511552784e-31
KLLA0E04027g3.495ON1581602682e-29
TBLA0H031308.375ON2141362112e-20
KNAG0A048108.375ON2141612094e-20
NDAI0A011608.375ON2161362077e-20
ZYRO0C03784g8.375ON2181362078e-20
CAGL0E00671g8.375ON2131362061e-19
Kwal_23.64858.375ON2151362042e-19
Kpol_1030.108.375ON2151612033e-19
KLTH0A07546g8.375ON2151362024e-19
Skud_4.4418.375ON2151622024e-19
Suva_2.3438.375ON2151612025e-19
Smik_4.4258.375ON2151612025e-19
YDR177W (UBC1)8.375ON2151612025e-19
SAKL0A00396g8.375ON2151362016e-19
YOR339C (UBC11)7.54ON1561351977e-19
TPHA0J017506.109ON169991979e-19
TPHA0L008508.375ON2161612009e-19
YGL058W (RAD6)6.109ON172991971e-18
NDAI0E038707.54ON1641321961e-18
KNAG0F025706.109ON151991951e-18
ZYRO0C04950g6.109ON168991961e-18
Smik_7.2226.109ON171991961e-18
AAR156C6.109ON170991961e-18
Suva_7.2136.109ON173991961e-18
CAGL0I00352g6.109ON167991961e-18
TDEL0G036106.109ON169991961e-18
SAKL0A07260g6.109ON169991961e-18
Ecym_30776.109ON170991961e-18
KLLA0C05632g6.109ON164991952e-18
KAFR0A047006.109ON153991942e-18
Kpol_461.86.109ON167991942e-18
Smik_4.2973.308ON1481511932e-18
NCAS0B031508.375ON2141621972e-18
Kwal_14.18286.109ON152991933e-18
TBLA0F024406.109ON174991943e-18
Suva_4.3263.308ON1481231914e-18
Suva_2.2183.308ON1481511914e-18
Skud_4.3143.308ON1481511914e-18
YDR059C (UBC5)3.308ON1481511914e-18
TDEL0H039707.54ON1561191924e-18
Ecym_60388.375ON2111361954e-18
TPHA0I024602.569ON1671571925e-18
NCAS0D032206.109ON171991926e-18
KLTH0H06732g6.109ON160991916e-18
KAFR0B060608.375ON2131361946e-18
Smik_15.5177.54ON1561011907e-18
KLLA0E07745g2.569ON1651511917e-18
NDAI0I016506.109ON176991917e-18
KLTH0E14300g3.308ON1471531897e-18
SAKL0B06512g3.308ON1471531897e-18
Ecym_74313.308ON1471531897e-18
AER173C3.308ON1471531897e-18
ZYRO0E06358g2.569ON1651511909e-18
CAGL0E04752g3.308ON1471511881e-17
SAKL0D13552g2.569ON1651511901e-17
KNAG0M021502.569ON1701511901e-17
Skud_15.5047.54ON1561191891e-17
KNAG0J023403.308ON1611231891e-17
ADR169C8.375ON2111361911e-17
TDEL0F049908.375ON2171361912e-17
KAFR0C002703.308ON1471231872e-17
TDEL0B065702.569ON1651511882e-17
Suva_8.3897.54ON1561311872e-17
Skud_7.2226.109ON170991882e-17
KLLA0C18656g8.375ON2281351912e-17
Skud_2.2073.308ON1481231862e-17
Smik_2.2193.308ON1481231862e-17
YBR082C (UBC4)3.308ON1481231862e-17
ABR059W2.569ON1651511872e-17
TBLA0I021303.308ON1481551853e-17
Ecym_45782.569ON1651511863e-17
Kpol_1052.23.308ON1481551853e-17
NDAI0A054903.308ON1471231844e-17
CAGL0M03399g1.436ON2141291885e-17
NCAS0A108003.308ON1481231845e-17
Kpol_1065.127.54ON1591281846e-17
TPHA0A038503.308ON1481551837e-17
KLLA0E12563g3.308ON1481551829e-17
Kpol_1056.52.569ON1651511831e-16
NDAI0D011401.436ON2451111871e-16
TDEL0F021003.308ON1471531811e-16
Kwal_27.124013.308ON2361231861e-16
Kwal_26.82242.569ON1651511812e-16
ZYRO0D04466g7.54ON1591471812e-16
KNAG0H018701.436ON2101091842e-16
KLTH0D07986g2.569ON1651511812e-16
TBLA0H026102.569ON1651511812e-16
Suva_5.531.436ON2151171832e-16
ZYRO0G12870g3.308ON1471531793e-16
Kpol_1030.181.436ON2231191833e-16
KLLA0A11198g1.436ON2021281814e-16
Smik_5.981.436ON2151091806e-16
YEL012W (UBC8)1.436ON2181091807e-16
KAFR0A021602.569ON1651511778e-16
Suva_13.1892.569ON1651511769e-16
Smik_13.1862.569ON1651511769e-16
KLTH0D01760g7.54ON1611341761e-15
Skud_5.871.436ON2101091781e-15
YMR022W (UBC7)2.569ON1651511761e-15
Skud_13.1762.569ON1651511761e-15
KAFR0H029601.436ON1871191761e-15
SAKL0B10582g7.54ON1611011742e-15
NCAS0A127402.569ON1651511742e-15
NDAI0B015202.569ON1651511742e-15
TDEL0B056701.436ON2031191753e-15
TPHA0O009201.436ON2261091763e-15
SAKL0D10560g1.436ON207941753e-15
CAGL0M07568g2.569ON1651511724e-15
NCAS0G031301.436ON2311181738e-15
ZYRO0E03806g1.436ON2091191711e-14
Kwal_34.161741.436ON213941711e-14
AEL045W1.436ON211971711e-14
TBLA0A012901.436ON2191091692e-14
Kwal_26.70097.54ON1611341653e-14
KLTH0H13816g1.436ON2331291694e-14
Ecym_13481.436ON211981675e-14
KAFR0H012303.308ON1101051599e-14
NCAS0A059404.49ON1931081612e-13
AGR121C8.230ON1541371574e-13
Ecym_55638.230ON1641391575e-13
Kwal_56.234828.230ON1491171558e-13
SAKL0H17930g8.230ON1531361558e-13
KLLA0C17622g8.230ON1591361568e-13
TDEL0A013408.230ON1571351551e-12
ZYRO0B11682g8.230ON1511361541e-12
NDAI0J015408.230ON1541361542e-12
Kpol_1075.1b8.230ON1521351532e-12
NCAS0B040108.230ON1531361532e-12
CAGL0G08063g8.230ON1491361532e-12
KNAG0H029808.230ON1521361532e-12
KLTH0G14366g8.230ON1491361513e-12
CAGL0D00814g4.249ON1571391505e-12
TBLA0F037908.230ON1511361505e-12
Suva_2.2538.230ON1431171487e-12
SAKL0H03058g4.249ON1571391489e-12
YDR092W (UBC13)8.230ON1531361481e-11
Skud_4.3528.230ON1431171461e-11
KAFR0A024208.230ON1471171461e-11
Smik_4.3358.230ON1431171462e-11
CAGL0D06468g4.49ON1871201464e-11
KLLA0E05039g4.249ON1571391435e-11
TPHA0B007704.249ON1571371435e-11
YDL064W (UBC9)4.249ON1571391436e-11
Smik_4.1714.249ON1571361428e-11
Suva_4.1864.249ON1571391428e-11
Skud_4.1914.249ON1571391419e-11
TPHA0B034108.230ON1521351411e-10
Kpol_483.164.249ON122941382e-10
KLLA0E20395g7.392ON2511231432e-10
KLTH0D14344g4.249ON1571391402e-10
TDEL0E012204.249ON1571391382e-10
ZYRO0B12386g4.249ON1571391383e-10
Ecym_32704.249ON1571361365e-10
KNAG0D043904.249ON1571391366e-10
NCAS0A024904.249ON1571391358e-10
TBLA0I029604.249ON1571391341e-09
Kwal_23.42274.249ON122941311e-09
CAGL0I05478g7.392ON2461291362e-09
NDAI0D043804.249ON1571371313e-09
KAFR0L017507.392ON2511151343e-09
KAFR0F030404.49ON1691121314e-09
TBLA0E015704.49ON194921314e-09
AER056C4.249ON1571361296e-09
YER100W (UBC6)7.392ON2501241327e-09
Kpol_414.2singletonOFF1921191307e-09
Kpol_YGOB_414.24.49ON1931191307e-09
Smik_5.2467.392ON2501241318e-09
Skud_12.3894.49ON1871291299e-09
Kpol_1045.397.392ON2531291301e-08
Smik_12.3894.49ON1871301281e-08
NCAS0E026007.392ON2551191301e-08
NCAS0A143907.392ON2401231291e-08
Suva_5.2197.392ON2491241291e-08
TBLA0D006007.392ON2561231282e-08
Suva_10.4014.49ON1871111262e-08
KAFR0G032404.249ON1571391252e-08
Ecym_46837.392ON2431301282e-08
KLTH0C06688g7.392ON2461151272e-08
KNAG0I029404.49ON1971091262e-08
SAKL0F12474g7.392ON2511261264e-08
KNAG0B023607.392ON2511201264e-08
Skud_5.2257.392ON2501311264e-08
ZYRO0B03344g7.392ON2501271264e-08
YLR306W (UBC12)4.49ON1881241235e-08
TDEL0C015507.392ON2481241256e-08
TDEL0E055604.49ON1871501227e-08
NDAI0A016507.392ON2511191248e-08
AGR372W7.392ON2421301221e-07
KLTH0H09504g4.49ON184911202e-07
SAKL0H24112g4.49ON185841202e-07
KLLA0E19119g6.187ON139961172e-07
TPHA0K008207.392ON2571231184e-07
Kwal_27.108377.392ON2461151176e-07
NDAI0E041707.392ON2571181168e-07
ADL035C4.49ON200911159e-07
TPHA0F003904.49ON1931151141e-06
ZYRO0G19910g4.49ON179841112e-06
Suva_7.1826.187ON1371151092e-06
KLLA0C17248g4.49ON184811103e-06
Ecym_83714.49ON267921114e-06
NDAI0D029104.49ON1891121104e-06
KLTH0H04796g6.187ON1381111058e-06
Skud_7.1956.187ON100731021e-05
YGL087C (MMS2)6.187ON1371151032e-05
AFL064W6.187ON138961022e-05
Kpol_1065.453.301ON3231621053e-05
Smik_7.1966.187ON10073985e-05
TDEL0G015806.187ON1381041005e-05
CAGL0H03157g6.187ON1391151005e-05
Ecym_22306.187ON138101996e-05
Kwal_27.111826.187ON10157942e-04
NCAS0A107703.301ON273114992e-04
TBLA0G032703.301ON330112992e-04
NCAS0I014303.301ON258114982e-04
KNAG0H010403.301ON29695982e-04
TPHA0J022506.187ON137130952e-04
SAKL0A05192g6.187ON14061953e-04
NDAI0A075703.301ON23995973e-04
KAFR0H012703.301ON28797973e-04
NDAI0A055303.301ON27397973e-04
ZYRO0G08228g6.187ON13899944e-04
TPHA0M012803.301ON435160974e-04
Skud_4.3063.301ON29797964e-04
Smik_4.2903.301ON297114964e-04
CAGL0E04598g3.301ON295101964e-04
Suva_2.2113.301ON29797964e-04
YDR054C (CDC34)3.301ON29597965e-04
Kwal_27.104443.301ON27897956e-04
ZYRO0G12650g3.301ON28597956e-04
SAKL0D02530g3.301ON27297946e-04
AGL203C3.301ON270114947e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR133W
         (183 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   379   e-136
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   295   e-103
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   278   1e-96
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   273   9e-95
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   169   1e-53
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   167   1e-52
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   163   3e-51
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   162   5e-51
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   162   8e-51
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   162   1e-50
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   160   6e-50
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   158   3e-49
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   157   3e-49
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   153   3e-47
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   134   1e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   131   8e-39
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   126   7e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   126   9e-37
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   111   4e-31
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   107   2e-29
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    86   2e-20
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    85   4e-20
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      84   7e-20
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    84   8e-20
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    84   1e-19
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    83   2e-19
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    83   3e-19
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    82   4e-19
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    82   4e-19
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    82   5e-19
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    82   5e-19
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    82   5e-19
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    82   6e-19
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    80   7e-19
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    80   9e-19
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    82   9e-19
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    80   1e-18
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    80   1e-18
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    80   1e-18
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    80   1e-18
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    80   1e-18
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    80   1e-18
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    80   1e-18
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    80   1e-18
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    80   1e-18
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    80   1e-18
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    80   1e-18
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    80   2e-18
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    79   2e-18
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    79   2e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    79   2e-18
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      80   2e-18
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    79   3e-18
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    79   3e-18
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    78   4e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    78   4e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    78   4e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    78   4e-18
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    79   4e-18
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    80   4e-18
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    79   5e-18
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      79   6e-18
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    78   6e-18
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    79   6e-18
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    78   7e-18
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    78   7e-18
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      78   7e-18
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    77   7e-18
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    77   7e-18
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    77   7e-18
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    77   7e-18
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    78   9e-18
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    77   1e-17
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    78   1e-17
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    78   1e-17
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    77   1e-17
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    77   1e-17
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    78   1e-17
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    78   2e-17
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    77   2e-17
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    77   2e-17
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    77   2e-17
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    77   2e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    78   2e-17
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    76   2e-17
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    76   2e-17
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    76   2e-17
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    77   2e-17
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    76   3e-17
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    76   3e-17
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    76   3e-17
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    75   4e-17
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    77   5e-17
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    75   5e-17
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    75   6e-17
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    75   7e-17
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    75   9e-17
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    75   1e-16
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    77   1e-16
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    74   1e-16
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    76   1e-16
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    74   2e-16
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    74   2e-16
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    75   2e-16
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    74   2e-16
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    74   2e-16
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    75   2e-16
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    74   3e-16
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    75   3e-16
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    74   4e-16
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    74   6e-16
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    74   7e-16
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    73   8e-16
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    72   9e-16
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    72   9e-16
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    72   1e-15
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    73   1e-15
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    72   1e-15
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    72   1e-15
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    72   1e-15
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    72   2e-15
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    72   2e-15
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    72   2e-15
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    72   3e-15
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    72   3e-15
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    72   3e-15
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    71   4e-15
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                71   8e-15
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    70   1e-14
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    70   1e-14
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    70   1e-14
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    70   2e-14
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    68   3e-14
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    70   4e-14
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    69   5e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    66   9e-14
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     67   2e-13
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    65   4e-13
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    65   5e-13
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    64   8e-13
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    64   8e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    65   8e-13
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    64   1e-12
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    64   1e-12
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    64   2e-12
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    64   2e-12
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    64   2e-12
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    64   2e-12
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    64   2e-12
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    63   3e-12
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    62   5e-12
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    62   5e-12
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    62   7e-12
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    62   9e-12
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    62   1e-11
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    61   1e-11
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    61   1e-11
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    61   2e-11
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    61   4e-11
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    60   5e-11
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    60   5e-11
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    60   6e-11
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    59   8e-11
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    59   8e-11
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    59   9e-11
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    59   1e-10
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    58   2e-10
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    60   2e-10
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    59   2e-10
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    58   2e-10
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    58   3e-10
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    57   5e-10
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    57   6e-10
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    57   8e-10
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    56   1e-09
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    55   1e-09
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    57   2e-09
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    55   3e-09
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    56   3e-09
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    55   4e-09
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    55   4e-09
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    54   6e-09
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    55   7e-09
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    55   7e-09
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    55   7e-09
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    55   8e-09
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    54   9e-09
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    55   1e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    54   1e-08
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    55   1e-08
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    54   1e-08
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    54   1e-08
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    54   2e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    53   2e-08
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    53   2e-08
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    54   2e-08
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    54   2e-08
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    53   2e-08
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    53   4e-08
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    53   4e-08
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    53   4e-08
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    53   4e-08
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    52   5e-08
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    53   6e-08
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    52   7e-08
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    52   8e-08
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    52   1e-07
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    51   2e-07
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    51   2e-07
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    50   2e-07
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    50   4e-07
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    50   6e-07
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    49   8e-07
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    49   9e-07
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    49   1e-06
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    47   2e-06
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    47   2e-06
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    47   3e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    47   4e-06
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       47   4e-06
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    45   8e-06
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    44   1e-05
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    44   2e-05
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    44   2e-05
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    45   3e-05
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    42   5e-05
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    43   5e-05
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    43   5e-05
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    43   6e-05
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    41   2e-04
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    43   2e-04
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    43   2e-04
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                42   2e-04
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                42   2e-04
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    41   2e-04
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    41   3e-04
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    42   3e-04
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                42   3e-04
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    42   3e-04
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    41   4e-04
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    42   4e-04
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    42   4e-04
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    42   4e-04
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    42   4e-04
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    42   4e-04
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    42   5e-04
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    41   6e-04
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    41   6e-04
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    41   6e-04
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    41   7e-04
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    41   8e-04
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    41   8e-04
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    41   8e-04
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    40   9e-04
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    41   9e-04
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    39   0.002
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    39   0.004
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    38   0.005
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    37   0.007
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    37   0.010
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    35   0.033
KNAG0L00730 Chr12 complement(117496..117812,117892..117913) [339...    33   0.16 
Suva_16.188 Chr16 complement(328775..330316) [1542 bp, 513 aa] {...    33   0.28 
Kwal_26.7007 s26 (161304..162179) [876 bp, 291 aa] {ON} YAL034W-...    32   0.68 
YGR098C Chr7 complement(682566..687458) [4893 bp, 1630 aa] {ON} ...    32   0.81 
YPL122C Chr16 complement(319226..320767) [1542 bp, 513 aa] {ON} ...    32   0.97 
Smik_6.321 Chr6 (503471..505012) [1542 bp, 513 aa] {ON} YPL122C ...    32   0.99 
Skud_16.158 Chr16 complement(290820..292367) [1548 bp, 515 aa] {...    32   1.1  
TPHA0M01140 Chr13 complement(228715..229656) [942 bp, 313 aa] {O...    31   1.7  
NDAI0C00670 Chr3 (130848..132401) [1554 bp, 517 aa] {ON}               30   2.8  
ZYRO0D09328g Chr4 (799742..799760,799837..800153) [336 bp, 111 a...    28   8.9  

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  379 bits (972), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/183 (100%), Positives = 183/183 (100%)

Query: 1   MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSK 60
           MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSK
Sbjct: 1   MPNFWILENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSK 60

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK
Sbjct: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERI 180
           PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERI
Sbjct: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERI 180

Query: 181 NNH 183
           NNH
Sbjct: 181 NNH 183

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  295 bits (755), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 141/165 (85%), Positives = 151/165 (91%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSRI KEY+VILKTLASDDPI NPYRGII SLNPIDETDLS+WEA I GPS TPYEN+QF
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQF 60

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            ILI+VPSSYPM PP+I+F QN+ILHCNVKSATGEICL+ILKPE+WTPVWDLLHCVHAVW
Sbjct: 61  HILIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVW 120

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH 183
           RLLREPVCDSPLDVD+GNIIRC D SAYQGIVKYFLAERER   H
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERERSRYH 165

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  278 bits (711), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 132/165 (80%), Positives = 145/165 (87%), Gaps = 1/165 (0%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSRI KEY++I KTLASDDP  NPYRGIIESLNP DETDLSKWEA I GP  TPYE +QF
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQF 60

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
           R+LI+VP SYPM PPKI F ++ ILHCN+ S+TGEICL+ILK ++WTPVWDLLHCVHAVW
Sbjct: 61  RMLIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVW 120

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINNH 183
           RLLREPVCDSPLDVD+GNIIRCGD  AYQGIVKYFLAERER NNH
Sbjct: 121 RLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERER-NNH 164

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  273 bits (699), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 146/161 (90%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSRI KEY  I KTLAS+DPI NPY+G+IESLNPIDETDLSKWEAII GP+ TPYE+++F
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRF 60

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
           RILI+VPSSYPM PP I F +NNILHCN+KS TGEICL+ILKPE+WTPVWDLLHCVHA+W
Sbjct: 61  RILIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIW 120

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179
           RLL+EPV DSPLDVD+GNIIRCGD  AYQGI++YFLAER+R
Sbjct: 121 RLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAERDR 161

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  169 bits (428), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (67%), Gaps = 12/164 (7%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           M+RI KE   I K L   D         +  L P+D++DLS+W A+I GP++TPY  ++F
Sbjct: 1   MARISKELLKIRKALEHGD------SEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEF 54

Query: 79  RILIEVPSSYPMNPPKISFMQNNIL------HCNVKSATGEICLNILKPEEWTPVWDLLH 132
           ++ IEVP+SYPM PP I F+ +         HCNV   TGEICL+ILKPE W+P+WD+LH
Sbjct: 55  KLAIEVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILH 114

Query: 133 CVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176
            V A+  LL+EPV DSPLDVD+ NI++  DMSAY GI++YFL E
Sbjct: 115 VVQAIHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  167 bits (422), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 103/159 (64%), Gaps = 5/159 (3%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK +LKTL  D     P    I  L P+ + +L  WEA I+GPSDTPY+ H+F +
Sbjct: 4   RLAKEYKTLLKTLKED-----PAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSL 58

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
           LI +PS+YP+ PPK+ F    + HCNV   +G IC+N+L+   W+P WDLLH VHA+W L
Sbjct: 59  LITIPSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLL 118

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179
           L  P  DSPLDVD+  + R GD SA+ G+V Y+L    R
Sbjct: 119 LANPEPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGSR 157

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  163 bits (412), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 111/158 (70%), Gaps = 7/158 (4%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + R++KE ++I K L+        Y   IE L P+   +  KW A++ GP +TPY  H F
Sbjct: 3   LKRLLKEKRLIEKELSG-------YSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSF 55

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
           ++LIE+PS YP+ PP I+F   ++ HCNV+ +TG+ICLNIL+ E W+PVW+L++ + A++
Sbjct: 56  KLLIELPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALY 115

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176
           +LL+EPV DSPL++D+ NI+R GD SAY G++ Y+L E
Sbjct: 116 QLLQEPVVDSPLNIDLANILRAGDTSAYHGLINYYLQE 153

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  162 bits (411), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 77/160 (48%), Positives = 108/160 (67%), Gaps = 8/160 (5%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE+K + KTLA D     P    I  L P D  ++  W A ISGP +TPY +  F
Sbjct: 3   LQRITKEFKSVRKTLAED-----PSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVF 57

Query: 79  RILIEVPSSYPMNPPKISFM---QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVH 135
            + +E+P  YP+ PP++ F+   +NNI HCNV   TGEICL+IL  E W+PVWDL+H +H
Sbjct: 58  ALDVELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIH 117

Query: 136 AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175
           A+W LL EPV +SPL+VDI N+++ GD+ AY+G++KY++ 
Sbjct: 118 AIWILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  162 bits (410), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 2/158 (1%)

Query: 19  MSRIVKEYKVILKTLASD-DPIANPYRGIIESLNPID-ETDLSKWEAIISGPSDTPYENH 76
           MSRI+KEYK I K L ++ +   + +  II SL PID + DL+KWEA+I GP  TPY   
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGF 60

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I +P  YP  PP   F   ++ HCNV   TGEICL+ILK + WTPVW+L+  + A
Sbjct: 61  NFILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKA 120

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +W LL++PV +SPL+VD+ N++R GD+SAY G++ Y+L
Sbjct: 121 IWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  162 bits (410), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 77/162 (47%), Positives = 108/162 (66%), Gaps = 5/162 (3%)

Query: 19  MSRIVKEYKVILKTLASDDPIAN-----PYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73
           MSR++KEYK I  TL+ +    N      +  II  L+PI  +DL+ W+A I GP  TPY
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPY 60

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHC 133
            NH+F++ IE P +YP+ PP I F   ++ HCNV   TG ICL+IL+ + WTP W+L+  
Sbjct: 61  ANHEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTT 120

Query: 134 VHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175
           + A+W LL++PV DSPL+VDI NI+R  D SAY G++ Y+L+
Sbjct: 121 MKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  160 bits (405), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 74/159 (46%), Positives = 99/159 (62%), Gaps = 5/159 (3%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEY+ + KTL  D     P    I SL P+ E +L KWE++I+GP DTPY  H+F +
Sbjct: 4   RLAKEYRALSKTLGRD-----PEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTL 58

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IE   +YP+ PPK+ F    + HCNV   +G ICL++L    WTP WDLLH VHA+W L
Sbjct: 59  QIEASEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLL 118

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERER 179
           L  P  DSPLDVD+  ++R GD SA+  ++ Y+L    R
Sbjct: 119 LASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGSR 157

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  158 bits (399), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 101/156 (64%), Gaps = 8/156 (5%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           M+RI +EYK I  TL S+         ++ SL PID  DLS+W   I GP+ TPYE H F
Sbjct: 1   MARIAREYKHIQATLGSES-------SLVVSLEPID-GDLSRWAGEIRGPTGTPYEGHTF 52

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + + +   YP  PP+++F + ++ HCNV   TG ICLNIL PE W+P WDLLH + A+ 
Sbjct: 53  SLRLVLGDRYPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAII 112

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +LL +P  DSPLD+D+ NI+R  D SAY G+V Y+L
Sbjct: 113 QLLSDPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  157 bits (398), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 101/156 (64%), Gaps = 5/156 (3%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSR  KEYK I K L   D +   Y  +I  + P  + DL++WEA+I GPS TPYE   F
Sbjct: 1   MSRAAKEYKTITKVLKEGDEV---YSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNF 55

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
           R+ + +P  YPM+PP + F    + H NV   TGEICL+IL  + W+P WDLLH V A+ 
Sbjct: 56  RLHLSLPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIG 115

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +LL EPV  SPL+VDI NI++  DM+AY G+V Y++
Sbjct: 116 QLLDEPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  153 bits (386), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 104/157 (66%), Gaps = 7/157 (4%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KEY+V+ K L +       ++ II SL PID  DL+ W A I GP +TPY  H F +
Sbjct: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I +   YP+ PP+++F    + HCN++  TG+ICLNIL    W+PVW+LL  V A+++L
Sbjct: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177
           L +PV DSPL++D+ NI++  D SAY G+++Y+L  +
Sbjct: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  134 bits (336), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 98/159 (61%), Gaps = 11/159 (6%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDE--TDLSKWEAIISGPSDTPYENH 76
           MSRI+KEY  I K  A  D +         +L+P+    +DLS W +II GP D+PY N 
Sbjct: 1   MSRIIKEYNHIRKLNALPDNMT--------TLHPVSNATSDLSNWHSIILGPKDSPYHNK 52

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNIL-HCNVKSATGEICLNILKPEEWTPVWDLLHCVH 135
            F + I +P+ YP  PP I F +N+I  HCNV   TGEICLNILK E W+PVW+LL+ V 
Sbjct: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112

Query: 136 AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           A+ +LL  P   SPL++D+  ++   D  AY  ++KY+L
Sbjct: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  131 bits (330), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 96/161 (59%), Gaps = 11/161 (6%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDE--TDLSKWEAIISGPSDTPYENH 76
           M RI++EYK + K LA            + SL P+ E   DL +WEA   GP +TPY   
Sbjct: 1   MRRILREYKQLQKQLA--------LHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGF 52

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I VP +YP  PPK SF  ++I H N+K +TGE+CL++LK E W+PV++LL  V A
Sbjct: 53  TFTLRINVPETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEA 112

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177
           +  LL EP  DSPLDVD+  +    D +AY G+V Y L  R
Sbjct: 113 ISTLLAEPGVDSPLDVDLSRLY-TTDRAAYDGVVNYRLRTR 152

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  126 bits (317), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 92/158 (58%), Gaps = 8/158 (5%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
           SR++ EYK I + L S       +  I+      D   LSKWEA   GP +TPY +  F 
Sbjct: 10  SRMLAEYKQIREQLQS-------HESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFT 62

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + IE+P  YP  PP   F  N+I H N+K +TGE+CL++LK E W+P+++LL  V A+  
Sbjct: 63  LSIEIPEMYPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRT 122

Query: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177
           LL EP  DSPLDVD+  +    D  AYQG+V Y L  R
Sbjct: 123 LLAEPGVDSPLDVDLAKLYSV-DKQAYQGLVTYRLCSR 159

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  126 bits (316), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 91/156 (58%), Gaps = 10/156 (6%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            R+++EY+ ++    + +           +L+P D  DL+ WEA + GP  TPYE H F 
Sbjct: 3   QRVLREYRRLVAAGGAANE---------SNLHPTDPADLTHWEATLEGPQGTPYEGHSFP 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + VP  YP  PP + F +  + H NVK  TGE+CL+ L    WTPV DL + V AV R
Sbjct: 54  LRVTVPDKYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTLA-GGWTPVMDLQYAVMAVRR 112

Query: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175
           LL EP  +SPL++++  + R GD  AY GI+KY LA
Sbjct: 113 LLAEPNPESPLNLELAALSRLGDHKAYDGIIKYRLA 148

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  111 bits (278), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 91/155 (58%), Gaps = 11/155 (7%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
           SRI+KEYK   ++L S           I +L+PI   DL+ WE  I GP  +P+ NH F+
Sbjct: 3   SRILKEYKDS-RSLQSQ---------YILALDPISTDDLTHWECTIKGPLHSPFANHTFK 52

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + I++P +YP+  P   F    + H NV   TGEICL+IL    W+PV+++ + V A+  
Sbjct: 53  LRIDIPQTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVW 111

Query: 140 LLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           LL EP   SPL++D+ N++R  D+ AY  ++ Y L
Sbjct: 112 LLNEPNFKSPLNLDLANLLRFDDLKAYHDLISYHL 146

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  107 bits (268), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 67/160 (41%), Positives = 92/160 (57%), Gaps = 10/160 (6%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSRIVKEY  + K L +      P    I  L P+D+ DLS+W     GPS++P+E  + 
Sbjct: 1   MSRIVKEYMGLQKRLQT------PEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFEL 54

Query: 79  RILIEVP-SSYPMNP-PKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            + I +    YP++  P++ F    + H NVK  TGEICL++LK + WTP++ LL  V A
Sbjct: 55  GLNITIDLEKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLK-DAWTPIYTLLDVVGA 113

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176
           +  LL +P  DSPLD+DI  I    D  AY  IV+Y L E
Sbjct: 114 IRDLLADPGLDSPLDLDIAQIYDA-DYEAYVQIVRYRLEE 152

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 85.9 bits (211), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 73/136 (53%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP AN       +L+ ++E+D+   +    GP  TPYE  +F I
Sbjct: 6   RIMKEMQAV-----KDDPAANI------TLDFVNESDIHHLKGSFLGPPGTPYEGGRFMI 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 85.1 bits (209), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 81/161 (50%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A+       +L  ++E+D+   +    GP +TPY+  QF +
Sbjct: 6   RIMKEMQAV-----KDDPEAHI------TLEFVNESDIHHLKGTFQGPPETPYDRGQFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H NV S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLKDRESFN 138

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 84.3 bits (207), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A         L  ++E+D+   +    GP  TPYE  QF I
Sbjct: 6   RIMKELQAV-----KDDPTAKI------GLEFVNESDIHHLKGSFFGPPGTPYEGGQFII 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 84.3 bits (207), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (53%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KE + +      DDP AN       +L  I E+D+ + +    GP +TPY+  +F I
Sbjct: 6   RLMKELQAV-----RDDPAANI------TLEFISESDIHRLKGSFLGPPETPYQGGRFII 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 84.0 bits (206), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 72/136 (52%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP AN       SL  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKELQAV-----KDDPEANI------SLEFVSESDIHHLKGSFLGPPGTPYEGGKFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F  + + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DSKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 83.2 bits (204), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KE + I      DDP A         L  ++E D+   +    GP  TPYEN ++ +
Sbjct: 6   RVMKELQAI-----KDDPEARV------DLQLVNENDIHLLKGSFLGPPGTPYENGKYIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F Q  + H NV S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-QTKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 82.8 bits (203), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 80/161 (49%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP AN       +L  + E+D+   +    GP +TPY+  +F +
Sbjct: 6   RIMKEMQAV-----KDDPAANI------NLEFVSESDIHHLKGSFLGPPETPYQGGRFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFN 138

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 82.4 bits (202), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KE + I      DDP A         L  ++E D+   +    GP  TPYEN +F +
Sbjct: 6   RVMKELQAI-----KDDPEAK------VDLQLVNENDIHLLKGSFLGPPGTPYENGKFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H NV S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 82.4 bits (202), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 79/162 (48%), Gaps = 28/162 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A+       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINN 182
           L+ P  + P D ++                +++L +RE  N 
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFNK 139

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 82.4 bits (202), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A+       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFN 138

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 82.4 bits (202), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A+       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFN 138

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 82.4 bits (202), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 79/161 (49%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A+       +L  + E+D+   +    GP  TPYE  +F +
Sbjct: 6   RIMKEIQAV-----KDDPAAHI------TLEFVSESDIHHLKGTFLGPPGTPYEGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFN 138

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 82.0 bits (201), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE +      A DDP AN       +L+ + E+D+   +    GP  TPYE   F +
Sbjct: 6   RIIKEIQA-----AKDDPEANI------TLSFVSESDIHHLKGSFYGPPGTPYEGGNFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I+VP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 80.5 bits (197), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 80/135 (59%), Gaps = 7/135 (5%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+D+ DL+ W   I+GP DTPY   +F++ ++ P +YP +PP I F+ + + H NV 
Sbjct: 29  SAFPVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFL-SPMWHPNV- 86

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
             +G ICL+ILK E+W+ V+++   + ++  LL EP   SPL+  +   +   DM  Y+ 
Sbjct: 87  DKSGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDADMEEYR- 143

Query: 169 IVKYFLAERERINNH 183
             K  LA  E I+++
Sbjct: 144 --KKVLACYEEIDDY 156

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 80.5 bits (197), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GPSDTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFI-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 81.6 bits (200), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 78/161 (48%), Gaps = 28/161 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP AN        L  + E D+   +    GP +TPYE  +F +
Sbjct: 6   RIMKEMEAV-----RDDPEANI------DLEFVSEADIHHLKGSFLGPPETPYEGGKFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           L+ P  + P D ++                +++L +RE  N
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLRDRESFN 138

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 80.5 bits (197), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 77/132 (58%), Gaps = 7/132 (5%)

Query: 52  PIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSAT 111
           P DE DL+ W AII+GP DTPY+  +F++  +   SYP  PP + F+ + + H NV   +
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFI-SPMWHPNV-DMS 97

Query: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           G ICL+ILK ++W+ V+++   + ++  LL EP   SPL+  +   +   DM+ Y+   K
Sbjct: 98  GNICLDILK-DQWSAVYNVETILLSLQALLEEPNNSSPLNA-VAAELWDDDMNEYK---K 152

Query: 172 YFLAERERINNH 183
             LA  E I + 
Sbjct: 153 RLLARYEDIGDQ 164

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNVY-ANGEICLDILQ 78

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFQ 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 79.3 bits (194), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFL-SEMFHPNVY-ANGEICLDILQ 78

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 79.3 bits (194), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DTPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFV-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI KE    L  L  D P +        S  P+ + DL  W+A I GPSD+PY    F +
Sbjct: 6   RIAKE----LSDLGRDPPASC-------SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I  P+ YP  PPK++F    I H N+ S +G ICL+ILK ++W+P   L   + +V  L
Sbjct: 54  SIHFPTDYPFKPPKVNFT-TKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSVCSL 110

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           L +   D PL  +I  I +  D + Y+   K
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 80.5 bits (197), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 79/162 (48%), Gaps = 28/162 (17%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A      IE L  ++E+D+   +    GP  TPYE  QF +
Sbjct: 6   RIMKELQAV-----KDDPEAR-----IE-LEFVNESDIHHLKGSFLGPPGTPYEGGQFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PP + F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPMMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINN 182
           L+ P  + P D ++                +++L +RE  N 
Sbjct: 113 LQSPEPNDPQDAEVA---------------QHYLKDRESFNK 139

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 79.0 bits (193), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP++TPYE+  FR+L+E    YP  PP + F+ + I H NV  A GEICL+IL+
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEIFHPNV-YANGEICLDILQ 78

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 79  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 79.3 bits (194), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GPSDTPYE+  FR+++E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 131

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP+D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 79

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D S Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEA 137

Query: 169 IVK 171
             +
Sbjct: 138 TAR 140

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI KE    L  L  D P +        S  P+ + DL  W+A I GPSD+PY    F +
Sbjct: 6   RIAKE----LSDLGRDPPASC-------SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I  P+ YP  PPK++F    I H N+ S +G ICL+ILK ++W+P   L   + ++  L
Sbjct: 54  SIHFPTDYPFKPPKVNFT-TKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           L +   D PL  +I  I +  D + Y+   K
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI KE    L  L  D P +        S  P+ + DL  W+A I GPSD+PY    F +
Sbjct: 6   RIAKE----LSDLGRDPPASC-------SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I  P+ YP  PPK++F    I H N+ S +G ICL+ILK ++W+P   L   + ++  L
Sbjct: 54  SIHFPTDYPFKPPKVNFT-TKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           L +   D PL  +I  I +  D + Y+   K
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 78.2 bits (191), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI KE    L  L  D P +        S  P+ + DL  W+A I GPSD+PY    F +
Sbjct: 6   RIAKE----LSDLGRDPPASC-------SAGPVGD-DLYHWQASIMGPSDSPYAGGVFFL 53

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I  P+ YP  PPK++F    I H N+ S +G ICL+ILK ++W+P   L   + ++  L
Sbjct: 54  SIHFPTDYPFKPPKVNFT-TKIYHPNINS-SGNICLDILK-DQWSPALTLSKVLLSICSL 110

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           L +   D PL  +I  I +  D + Y+   K
Sbjct: 111 LTDANPDDPLVPEIAQIYKT-DKAKYEATAK 140

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 78.6 bits (192), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/119 (37%), Positives = 71/119 (59%), Gaps = 4/119 (3%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P  E DL++W  +I GP  TPYEN +FR+ ++    YP  PPK++F+ + + H NV 
Sbjct: 30  SAFPASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFV-SPMWHPNV- 87

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQ 167
             +G ICL+ILK ++W+ V+++   + ++  LL EP   SPL+  I   +   DM  Y+
Sbjct: 88  DMSGNICLDILK-DQWSAVYNVQTILLSLQALLEEPNNGSPLNA-IAAELWDTDMDEYK 144

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 79.7 bits (195), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 71/136 (52%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KE + +      DDP AN       SL+ + E+D+   +    GP  TPY   +F +
Sbjct: 6   RLMKEIQSV-----KDDPDANI------SLSFVSESDIHHLKGTFLGPPGTPYHGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I+VP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAK 128

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 78.6 bits (192), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 81/157 (51%), Gaps = 25/157 (15%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KEY+ +++             GI+    P DE ++ +W+ +ISGP +TPYE
Sbjct: 4   SKTAQKRLLKEYQQLIRESPP---------GIVAG--PSDENNMFEWDCLISGPPETPYE 52

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           N  F   +  P  YP++PPK++F   ++LH N+    GE+C++I            L  E
Sbjct: 53  NGVFNATLLFPKDYPLSPPKLTFTP-SLLHPNIY-PNGEVCISILHSPGDDPNMYELAEE 110

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
            W+PV  +   + +V  +L EP  +S  ++D   + R
Sbjct: 111 RWSPVQSVEKILLSVMSMLSEPNIESGANIDASILYR 147

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 78.6 bits (192), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP++TPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 78.2 bits (191), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP++TPYE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 89

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 90  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 127

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 79.3 bits (194), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 70/136 (51%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A        +L  + E+D+   +    GP  TPYEN  F +
Sbjct: 6   RIMKELQAV-----KDDPEAKI------TLEFVIESDIHHLKGSFIGPPGTPYENGAFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PP++ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPQMKF-DTKVYHPNISSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 77.8 bits (190), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 64/101 (63%), Gaps = 3/101 (2%)

Query: 52  PIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSAT 111
           P+D+ DL+ W   I+GP  TPY   +F+I +  P +YP +PPKI F+ + + H NV   +
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFV-SPMWHPNV-DKS 89

Query: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDV 152
           G ICL+ILK E+W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNA 129

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 78.2 bits (191), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+ S  PID+++L +W+ +I GP D+ YE
Sbjct: 2   SKTAQKRLLKE----LEKLTKDSP-----EGILAS--PIDDSNLFQWDCLIMGPPDSCYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKP------------E 122
              F   ++ P  YP+NPPK++F Q +ILH N+    GE+C++IL              E
Sbjct: 51  GGVFNARLDFPKDYPLNPPKLTF-QPSILHPNIY-PNGEVCISILHSPGSDPNMYEHECE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEMILLSVMSILSEPNIESGANID 139

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 78.2 bits (191), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 61/99 (61%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP++TPYE+  FR+L+E    YP+N P + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + DL  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + DL  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + DL  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 77.4 bits (189), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + DL  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   K
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAK 139

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 77.8 bits (190), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 77/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE + ++K  ++         GI+    P  E DL  W+ +I GP DTPYE
Sbjct: 2   SKTAQKRLLKELQQLMKDSST---------GIVA--GPRSENDLFVWDCLIQGPPDTPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNIYH-NGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  +VD
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANVD 139

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 77.0 bits (188), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 77/151 (50%), Gaps = 16/151 (10%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI KE    L  L  D P +        S  P+ + DL  W+A I GP D+PY    F +
Sbjct: 5   RIAKE----LSDLGRDPPTSC-------SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFL 52

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   L   + ++  L
Sbjct: 53  SIHFPTDYPFKPPKISFT-TKIYHPNI-NANGNICLDILK-DQWSPALTLSKVLLSICSL 109

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           L +   D PL  +I +I +  D + Y+   +
Sbjct: 110 LTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 79/151 (52%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ LA D P      GI+    P  E +L  W+ +I+GP D+PYE
Sbjct: 2   SKTAQKRLLKE----LQQLARDSP-----EGIVA--GPKSEDNLFLWDCLITGPPDSPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F  ++E P  YP++PP+++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGVFNAMLEFPKDYPLSPPRLTFTP-SILHPNIY-PNGEVCISILHSPGEDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVTSMLSEPNVESGANID 139

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 77.8 bits (190), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 79/151 (52%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE + +++         +P  GI+    P DE+DL  W+ ++ GP D+PYE
Sbjct: 2   SKTAQRRLLKELQQLMR---------DPPPGIV--AGPQDESDLFLWDCLVQGPPDSPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKP------------E 122
              F   +  P  YP++PPK++F+  ++LH NV    GE+C++IL              E
Sbjct: 51  GGVFEAQLRFPRDYPLSPPKLTFVP-SVLHPNV-YPNGEVCISILHAPGEDPNQYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVVSMLSEPNVESGANID 139

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 71/119 (59%), Gaps = 4/119 (3%)

Query: 52  PIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSAT 111
           P+D+ DL+ W   I GP  TPY + +F+I +  P +YP +PPK+ F+ + + H NV   +
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFV-SPMWHPNV-DKS 89

Query: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIV 170
           G ICL+ILK E+W+ V+++   + ++  LL EP   SPL+  +   +   DM  Y+  V
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGYKKKV 146

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 77.4 bits (189), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 36  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 92

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D S Y+ 
Sbjct: 93  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYEA 150

Query: 169 IVK 171
             +
Sbjct: 151 TAR 153

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 78.2 bits (191), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R++KE + +      DDP AN       SL  + E+D+   +    GP  TPY    F +
Sbjct: 6   RLMKEIQSV-----KDDPDANI------SLAFVSESDIHHLKGTFLGPPGTPYHGGTFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I+VP  YP  PPK+ F    + H N+ S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIQVPLEYPFKPPKMQF-DTKVYHPNISSVTGAICLDILK-NSWSPVLTLKTSLISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAK 128

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 78.2 bits (191), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 69/136 (50%), Gaps = 13/136 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      DDP A        +L  + E+D+   +    GP  TPY+   F +
Sbjct: 6   RIMKEMQAV-----KDDPAAKI------NLEFVTESDIHHLKGSFLGPPGTPYDGGLFIV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            IEVP  YP  PPK+ F    + H NV S TG ICL+ILK   W+PV  L   + ++  L
Sbjct: 55  DIEVPMEYPFKPPKMKF-DTKVYHPNVSSVTGAICLDILK-NAWSPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIGN 156
           L+ P  + P D ++  
Sbjct: 113 LQSPEPNDPQDAEVAQ 128

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 22  SAGPVGD-DLFHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNI- 78

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D S Y+ 
Sbjct: 79  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRSKYET 136

Query: 169 IVK 171
             +
Sbjct: 137 TAR 139

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 80/151 (52%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KEY+ +++         +P  GI+ +  P  E++L  W+ +I GP DTPYE
Sbjct: 2   SKTASRRLLKEYQQLIR---------DPPPGILAA--PKSESNLFLWDCLIQGPPDTPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   ++ P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGIFNARLDFPKDYPLSPPKLTFTP-SILHPNIYH-NGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  +VD
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANVD 139

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 76/131 (58%), Gaps = 7/131 (5%)

Query: 52  PIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSAT 111
           P D+ DL+ W   I+GP  TPY + +F+I +  P SYP +PPK+ F+ + + H NV   +
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFV-SPMWHPNV-DMS 89

Query: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           G ICL+ILK E+W+ V+++   + ++  LL EP   SPL+  +   +   DM  Y+   K
Sbjct: 90  GNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEEYK---K 144

Query: 172 YFLAERERINN 182
             LA  E I +
Sbjct: 145 KVLACYEEIED 155

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 77.0 bits (188), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 3/99 (3%)

Query: 61  WEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK 120
           W A+I GP+DT YE+  FR+L+E    YP  PP + F+ + + H NV  A GEICL+IL+
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFL-SEMFHPNV-YANGEICLDILQ 93

Query: 121 PEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              WTP +D+   + ++  L  +P   SP +V+   + +
Sbjct: 94  -NRWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 131

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 78.2 bits (191), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 71/135 (52%), Gaps = 13/135 (9%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +      +DP A      IE L  ++E+D+   +    GPS TPYE  +F +
Sbjct: 6   RILKEIQAV-----KEDPEAQ-----IE-LKFVNESDIHHMKGSFIGPSGTPYEGGKFVV 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            I +P  YP  PP++ F    + H NV S TG ICL+ILK   WTPV  L   + ++  L
Sbjct: 55  DINIPVEYPYKPPQMKF-DTKVYHPNVSSVTGAICLDILK-NAWTPVITLKSALISLQAL 112

Query: 141 LREPVCDSPLDVDIG 155
           L+ P  + P D  + 
Sbjct: 113 LQSPEPNDPQDAQVA 127

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP+D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 79

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 137

Query: 169 IVK 171
             +
Sbjct: 138 TAR 140

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP+D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 79

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 137

Query: 169 IVK 171
             +
Sbjct: 138 TAR 140

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP+D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPADSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 79

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 137

Query: 169 IVK 171
             +
Sbjct: 138 TAR 140

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 76.6 bits (187), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE + +L+    D P      GI+    P+ E +L  W+ +I GP+D+PYE
Sbjct: 2   SKTAQKRLMKELQQLLR----DSP-----DGIVA--GPVSEDNLFLWDCLIEGPADSPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL------------KPE 122
              F   ++ P  YP++PPK++F   +ILH NV    GE+C++IL              E
Sbjct: 51  GGVFNARLQFPRDYPLSPPKLTFTP-SILHPNVY-PNGEVCISILHAPGEDPNMYEEASE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 78/155 (50%), Gaps = 16/155 (10%)

Query: 17  TCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENH 76
           + + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY   
Sbjct: 2   SSLKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGG 49

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + +
Sbjct: 50  VFFLSIHFPTDYPFKPPKISFT-TKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLS 106

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           +  LL +   D PL  +I +I +  D   Y+   K
Sbjct: 107 ICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAK 140

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 76.3 bits (186), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 81/151 (53%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE + +LK    D P      GI+    P++E ++  W+ +I+GP D+PYE
Sbjct: 2   SKTAQKRLMKEMQQLLK----DCP-----EGIVA--GPVNEENMFLWDCLIAGPPDSPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL------------KPE 122
              F   ++ P+ YP++PPK++F   +ILH NV    GE+C++IL              E
Sbjct: 51  GGIFNARLQFPTDYPLSPPKLTFTP-SILHPNVY-PNGEVCISILHAPGEDPNMYEEASE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 75.9 bits (185), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 17  TCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENH 76
           + + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY   
Sbjct: 2   SSLKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGG 49

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + +
Sbjct: 50  VFFLSIHFPTDYPFKPPKISFT-TKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLS 106

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           +  LL +   D PL  +I ++ +  D + Y+   K
Sbjct: 107 ICSLLTDANPDDPLVPEIAHLYKT-DRAKYEATAK 140

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 75.5 bits (184), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 22  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNI- 78

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D   Y+ 
Sbjct: 79  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 136

Query: 169 IVK 171
             +
Sbjct: 137 TAR 139

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 77.0 bits (188), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 7/129 (5%)

Query: 55  ETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           E  + ++     GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+  A+G I
Sbjct: 27  EDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSI 85

Query: 115 CLNILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYF 173
           CL+++    W+P++DLL+ V   +  LL+EP    PL+ +  N ++  D   Y+  V+ +
Sbjct: 86  CLDVIN-STWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKDKKVYEEKVREY 143

Query: 174 L---AERER 179
           +   A +ER
Sbjct: 144 IDKYATKER 152

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 75.5 bits (184), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 67/123 (54%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 23  SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNI- 79

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   L   + ++  LL +   D PL  +I +I +  D   Y+ 
Sbjct: 80  NANGNICLDILK-DQWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEA 137

Query: 169 IVK 171
             +
Sbjct: 138 TAR 140

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 75.5 bits (184), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/128 (36%), Positives = 73/128 (57%), Gaps = 6/128 (4%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           I +P  G+  S  P  E +L+KW   I+GP D+PY   +F+I +  P  YP  PPK+ F+
Sbjct: 25  IMSPTPGL--SAFPDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFV 82

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
            + + H NV   +G ICL++LK E+W+ V+++   + ++  LL EP   SPL+  I   +
Sbjct: 83  -SPMWHPNV-DLSGNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNA-IAAEL 138

Query: 159 RCGDMSAY 166
             GD   Y
Sbjct: 139 WDGDKEEY 146

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 75.1 bits (183), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 78/155 (50%), Gaps = 16/155 (10%)

Query: 17  TCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENH 76
           + + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY   
Sbjct: 2   SSLKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGG 49

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + +
Sbjct: 50  VFFLSIHFPTDYPFKPPKISFT-TKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLS 106

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           +  LL +   D PL  +I ++ +  D   Y+   K
Sbjct: 107 ICSLLTDANPDDPLVPEIAHLYKT-DRPKYEATAK 140

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 74.7 bits (182), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 79/155 (50%), Gaps = 16/155 (10%)

Query: 17  TCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENH 76
           + + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY   
Sbjct: 2   SSLKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGG 49

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            F + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P   +   + +
Sbjct: 50  VFFLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLS 106

Query: 137 VWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           +  LL +   D PL  +I ++ +  D + Y+   +
Sbjct: 107 ICSLLTDANPDDPLVPEIAHLYKT-DRAKYEATAR 140

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 75.1 bits (183), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R+ KEY+ +++    D P      GI+    P +E DL  W+ +I GP DTPYE
Sbjct: 2   SKTAQKRLFKEYQQLIR----DSP-----PGIVAG--PANENDLFLWDCLIQGPPDTPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           +  F   +  P  YP++PP ++F    ILH N+    GE+C++I            L  E
Sbjct: 51  HGVFNAQLRFPRDYPLSPPTLTFTP-AILHPNIY-PNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 66/111 (59%), Gaps = 4/111 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 56  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVINS-TWSP 113

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAE 176
           ++DLL+ V   +  LL+EP    PL+ +    +   D   Y+  +K ++A+
Sbjct: 114 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEYIAK 163

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DIYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKI+F    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAF-TTKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEATAR 139

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 5/123 (4%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P+ + DL  W+A I GP D+PY    F + I  P+ YP  PPKISF    I H N+ 
Sbjct: 111 SAGPVGD-DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFT-TKIYHPNI- 167

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
           +A G ICL+ILK ++W+P   +   + ++  LL +   D PL  +I +I +  D + Y+ 
Sbjct: 168 NANGNICLDILK-DQWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK-TDRAKYEA 225

Query: 169 IVK 171
             K
Sbjct: 226 TAK 228

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R+ KE + +LK    D P      GI+    P  E +L  W+ +ISGP D+PY+
Sbjct: 2   SKTAQKRLFKELQQLLK----DSP-----EGIVA--GPKSEDNLFVWDCLISGPPDSPYQ 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   +E P  YP++PPK+ F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGVFNATLEFPKDYPLSPPKLLFTP-SILHPNIY-PNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 82/147 (55%), Gaps = 8/147 (5%)

Query: 23  VKEYKVILKTLASD--DPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           + E   ++K L S+    + +P  G+  S  P +E DL  W  +I GP  TPYE+ +F+I
Sbjct: 7   IPEGHSVVKRLQSELVQLMMSPTPGL--SAFPNNEDDLRDWSGMIVGPEGTPYESLKFKI 64

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            +  P SYP  PPK+ F+ + + H NV   +G ICL+ILK ++W+ V+++   + ++  L
Sbjct: 65  SLHFPDSYPYVPPKVKFI-SPMWHPNV-DMSGNICLDILK-DQWSAVYNVQTILLSLQSL 121

Query: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQ 167
             EP   SPL+  +   +   DM  Y+
Sbjct: 122 FEEPNNSSPLNA-VAAELWDKDMVEYK 147

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 75.5 bits (184), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 39  GPKDTPYENGVWRLHVELPDNYPFKSPSIGFV-NKIYHPNIDIASGSICLDVINS-TWSP 96

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DLL+ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 97  LYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKMYEEKIKEYI 144

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R+ KE + +LK    D P      GI+    P  E +L  W+ +ISGP D+PY+
Sbjct: 2   SKTAQKRLFKELQQLLK----DSP-----EGIVA--GPRSEDNLFLWDCLISGPPDSPYQ 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   +E P  YP++PPK+ F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGVFNATLEFPKDYPLSPPKLLFTP-SILHPNIY-PNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNVESGANID 139

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 74.3 bits (181), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 80/151 (52%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GII +  P  E+DL  W+ +++GP DTPY 
Sbjct: 2   SRTAQKRLLKE----LQQLTRDPP-----PGIIAA--PKTESDLFTWDCLVAGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILK-----------PEE 123
              F   ++ P+ YP++PP ++F   +ILH NV    GE+C++IL            PEE
Sbjct: 51  GGLFNCQLQFPTDYPLSPPTLTFTP-SILHPNVY-PNGEVCISILHAPGSDPNMYELPEE 108

Query: 124 -WTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVVSMLSEPNVESGANID 139

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 75.1 bits (183), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 69/117 (58%), Gaps = 7/117 (5%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVINS-TWSP 95

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL---AERER 179
           ++DL++ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++   A RE+
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDKYATREK 151

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 73.6 bits (179), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 78/153 (50%), Gaps = 16/153 (10%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           + RI KE    L  L  D P +        S  P+ + D+  W+A I GP D+PY    F
Sbjct: 3   LKRITKE----LNDLGRDPPTSC-------SAGPVGD-DVYHWQASIMGPPDSPYAGGVF 50

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVW 138
            + I  P+ YP  PPKI+F    I H N+ +A G ICL+ILK ++W+P   +   + ++ 
Sbjct: 51  FLSIHFPTDYPFKPPKIAFT-TKIYHPNI-NANGNICLDILK-DQWSPALTISKVLLSIC 107

Query: 139 RLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
            LL +   D PL  +I +I +  D + Y+   +
Sbjct: 108 SLLTDANPDDPLVPEIAHIYKT-DRAKYEAQAR 139

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 75.1 bits (183), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 70/119 (58%), Gaps = 7/119 (5%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 39  GPKDTPYENGCWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVINS-TWSP 96

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL---AERERIN 181
           ++DLL+ V   +  LL+EP    PL+ +    ++  D + Y+  +K ++   A  E+ N
Sbjct: 97  LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEYIDKYATSEKYN 154

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 74.3 bits (181), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 72/128 (56%), Gaps = 7/128 (5%)

Query: 55  ETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           E  + ++     GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G I
Sbjct: 27  EDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSI 85

Query: 115 CLNILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNI-IRCGDM---SAYQGI 169
           CL+++    W+P++DLL+ V   +  LL+EP    PL+ +   + ++  DM     ++ I
Sbjct: 86  CLDVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAATLQLKDKDMYEQKIHEYI 144

Query: 170 VKYFLAER 177
            KY   E+
Sbjct: 145 NKYATKEK 152

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 73.9 bits (180), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVIN-STWSP 95

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DL++ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 73.9 bits (180), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 38  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVIN-STWSP 95

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DL++ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYI 143

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 72.8 bits (177), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P  E ++ +W+ ++ GP D+PYE
Sbjct: 2   SKTAQKRLLKE----LQQLMKDSP-----PGIVAG--PKTEDNIFQWDCLVQGPPDSPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   ++ P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGVFNAQLDFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGEDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P  E ++  W+ +I GP DTPY 
Sbjct: 2   SKTAQKRLLKE----LQQLIKDSP-----PGIVAG--PKSENNIFVWDCLIQGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           +  F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  DGVFNTKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 72.4 bits (176), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P  E ++  W+ +I GP DTPY 
Sbjct: 2   SKTAQKRLLKE----LQQLIKDSP-----PGIVA--GPKSENNIFVWDCLIQGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           +  F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  DGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 78/134 (58%), Gaps = 7/134 (5%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P DE DL+KW  II+GP  TPYE  +F+I +E   +YP   PK+ F+ + + H NV 
Sbjct: 35  SAFPEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFV-SPMWHPNV- 92

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
             +G ICL+ILK ++W+ V+++   + ++  LL EP   SPL+  +   +   DM  Y+ 
Sbjct: 93  DMSGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA-VAAELWDKDMREYK- 149

Query: 169 IVKYFLAERERINN 182
             K  +A  E I++
Sbjct: 150 --KKLIARYEEIDD 161

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 65/109 (59%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYEN  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 37  GPKDTPYENGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVINS-TWSP 94

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DL++ +   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 95  LYDLINILEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 142

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P  E ++  W+ +I GP DTPY 
Sbjct: 2   SKTAQKRLLKE----LQQLIKDSP-----PGIVA--GPKSENNIFIWDCLIQGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           +  F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  DGVFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P  E ++  W+ +I GP DTPY 
Sbjct: 2   SKTAQKRLLKE----LQQLIKDSP-----PGIVA--GPKSENNIFVWDCLIQGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
           +  F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  DGIFNAKLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 72.4 bits (176), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 69/119 (57%), Gaps = 4/119 (3%)

Query: 57  DLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICL 116
           ++ ++     GP DTPYE+  +R+ +E+P +YP   P I F+ N I H N+  A+G ICL
Sbjct: 28  NMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDVASGSICL 86

Query: 117 NILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +++    W+P++DL++ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 87  DVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLYEQKIKEYI 143

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 66/101 (65%), Gaps = 3/101 (2%)

Query: 52  PIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSAT 111
           P +E DL+KW  II+GP  TPYE  +F+I ++ P SYP   P+++F+ + + H NV   +
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFV-SPMWHPNV-DMS 95

Query: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDV 152
           G ICL+ILK ++W+ V+++   + ++  LL EP   SPL+ 
Sbjct: 96  GNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA 135

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P +E +L  W+ ++ GP DT YE
Sbjct: 2   SKTAQRRLLKE----LQQLTKDSP-----PGIVAC--PKNENNLFIWDCLVQGPPDTAYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   +E P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGIFNARLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSIEKILLSVMSMLSEPNIESGANID 139

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 71.6 bits (174), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 76/151 (50%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R++KE    L+ L  D P      GI+    P +E +L  W+ ++ GP DT YE
Sbjct: 2   SKTAQRRLLKE----LQQLNKDSP-----PGIVAG--PANENNLFVWDCLVQGPPDTAYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI------------LKPE 122
              F   ++ P  YP++PPK++F   +ILH N+    GE+C++I            L  E
Sbjct: 51  GGIFNARLDFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYELAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 72.0 bits (175), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 68/119 (57%), Gaps = 4/119 (3%)

Query: 57  DLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICL 116
           ++ ++     GP DTPYE   +R+ +E+P +YP   P I F+ N ILH N+  A+G ICL
Sbjct: 16  NMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV-NKILHPNIDVASGSICL 74

Query: 117 NILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +++    W+P++DL + V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 75  DVIN-STWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 131

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 72.4 bits (176), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 64/109 (58%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 40  GPKDTPYEGGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVINS-TWSP 97

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DLL+ +   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 98  LYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 72.0 bits (175), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLN 117
           + ++     GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G ICL+
Sbjct: 17  MQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSICLD 75

Query: 118 ILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPL 150
           ++    W+P++DL++ V   +  LL+EP    PL
Sbjct: 76  VINS-TWSPLYDLINIVEWMIPGLLKEPNGSDPL 108

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 70.9 bits (172), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 74/151 (49%), Gaps = 25/151 (16%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S T   R+ KE    L+ L  D P      GI+    P  + +L  W+ +I GP DTPY 
Sbjct: 2   SKTAQKRLYKE----LQQLIKDSP-----PGIVA--GPKSDDNLFVWDCLIQGPPDTPYA 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL------------KPE 122
              F   +E P  YP++PPK++F   +ILH N+    GE+C++IL              E
Sbjct: 51  GGVFNAQLEFPKDYPLSPPKLTFTP-SILHPNI-YPNGEVCISILHSPGDDPNMYESAEE 108

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            W+PV  +   + +V  +L EP  +S  ++D
Sbjct: 109 RWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 71.2 bits (173), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 66/118 (55%), Gaps = 4/118 (3%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLN 117
           + ++     GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+
Sbjct: 52  MQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLD 110

Query: 118 ILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++    W+P++DLL+ V   +  LL+EP    PL+ +    +   D   Y+  ++ ++
Sbjct: 111 VINS-TWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYI 166

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 67/119 (56%), Gaps = 4/119 (3%)

Query: 57  DLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICL 116
           ++ ++     GP DTPYE   +R+ +E+P +YP   P I F+ N I H N+  A+G ICL
Sbjct: 30  NMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICL 88

Query: 117 NILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           +++    W+P++DL + V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 89  DVINS-TWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEYI 145

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 57/94 (60%), Gaps = 3/94 (3%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLN 117
           + ++     GP +TPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G ICL+
Sbjct: 17  MQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSICLD 75

Query: 118 ILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPL 150
           ++    W+P++DLL+ +   +  LL+EP    PL
Sbjct: 76  VIN-SAWSPLYDLLNILEWMIPGLLKEPNGSDPL 108

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 70.5 bits (171), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 58/97 (59%), Gaps = 3/97 (3%)

Query: 55  ETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           + ++ ++     GP  TPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G I
Sbjct: 26  DDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSI 84

Query: 115 CLNILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPL 150
           CL+++    W+P++DLL+ V   +  LL+EP    PL
Sbjct: 85  CLDVIN-STWSPLYDLLNIVEWMIPGLLKEPNGSDPL 120

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 69.7 bits (169), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 4/109 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP +TPYE   +R+ +E+P +YP   P I F+ N I H N+  A+G ICL+++    W+P
Sbjct: 38  GPDETPYEKGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDIASGSICLDVIN-STWSP 95

Query: 127 VWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174
           ++DL++ V   +  LL+EP    PL+ +    ++  D   Y+  +K ++
Sbjct: 96  LYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLYEEKIKEYI 143

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 68.2 bits (165), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 75/134 (55%), Gaps = 7/134 (5%)

Query: 49  SLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVK 108
           S  P  E DL+KW  II+GP  TPYE  +F+I +E   +YP   PK+ F+ + + H NV 
Sbjct: 35  SAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFV-SPMWHPNV- 92

Query: 109 SATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQG 168
             +G ICL+ILK ++W+ V+++   + ++  LL EP   SPL+  +   +   DM  Y+ 
Sbjct: 93  DMSGNICLDILK-DQWSAVYNVQTILLSLQSLLEEPNNSSPLNA-VAAELWDTDMQEYK- 149

Query: 169 IVKYFLAERERINN 182
             K   A  E I +
Sbjct: 150 --KKLYARYEEIED 161

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 69.7 bits (169), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 72/129 (55%), Gaps = 7/129 (5%)

Query: 55  ETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           + ++ ++     GP  TPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G I
Sbjct: 26  DDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSI 84

Query: 115 CLNILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYF 173
           CL+++    W+P++DL++ V   +  LL+EP    PL+ +    ++  +   Y+  ++ F
Sbjct: 85  CLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEQKIREF 142

Query: 174 L---AERER 179
           +   A  ER
Sbjct: 143 IDKYATEER 151

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 68.9 bits (167), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 59/98 (60%), Gaps = 3/98 (3%)

Query: 55  ETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           + ++ ++     GP  TPYE   +R+ +E+P +YP   P I F+ N I H N+ +A+G I
Sbjct: 26  DDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFV-NKIFHPNIDAASGSI 84

Query: 115 CLNILKPEEWTPVWDLLHCVH-AVWRLLREPVCDSPLD 151
           CL+++    W+P++DL++ V   +  LL+EP    PL+
Sbjct: 85  CLDVIN-STWSPLYDLINIVEWMIPGLLKEPNGSDPLN 121

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 65.9 bits (159), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 57/105 (54%), Gaps = 4/105 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
           GP D+PY    F + I  P+ YP  PPKISF    I H N+ +A G ICL+ILK ++W+P
Sbjct: 2   GPPDSPYAGGVFFLSIHFPTDYPFKPPKISF-TTKIYHPNI-NANGNICLDILK-DQWSP 58

Query: 127 VWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
              L   + ++  LL +   D PL  +I +I +  D   Y+   +
Sbjct: 59  ALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKT-DRPKYEATAR 102

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 4/108 (3%)

Query: 64  IISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEE 123
           +I  P +  Y+N  FR  +E   +YPM PPK+   +N I H N+    G++CLNIL+ E+
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKV-VCRNRIYHPNI-DVQGKVCLNILR-ED 129

Query: 124 WTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVK 171
           W+P  DL   +  +  L  EP    PL+ D   +    D +A+   V+
Sbjct: 130 WSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVF-SKDSNAFAKFVR 176

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 65.1 bits (157), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 70/137 (51%), Gaps = 15/137 (10%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI  S  P  E +L  ++  I GP  +PYE+  FR
Sbjct: 6   KRIIKETERL---------VSDPVPGI--SAEP-HEDNLRYFDVSIEGPQQSPYEHGVFR 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM PPK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELFLPDEYPMEPPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIGN 156
           LL  P  + PL  D+  
Sbjct: 111 LLATPNPNDPLANDVAK 127

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 65.1 bits (157), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 70/139 (50%), Gaps = 15/139 (10%)

Query: 17  TCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENH 76
           T   RI+KE + +         +++P  GI  S  P  E +L  ++  I GP  + YEN 
Sbjct: 3   TLPKRIIKETERL---------VSDPVPGI--SAEP-HEDNLRYFDVSIEGPQQSAYENG 50

Query: 77  QFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHA 136
            FR+ + +P  YPM PPK+ F+   I H N+    G ICL++LK   W+P   +   + +
Sbjct: 51  VFRLELFLPDEYPMEPPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLS 107

Query: 137 VWRLLREPVCDSPLDVDIG 155
           +  LL  P  + PL  D+ 
Sbjct: 108 IQALLATPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 61/117 (52%), Gaps = 6/117 (5%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           +++P  GI    +   E +L  ++  I GP  +PYEN  F++ + +P  YPM  PK+ F+
Sbjct: 16  VSDPVPGITAEPH---EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFL 72

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              I H N+    G ICL++LK   W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 73  -TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 64.3 bits (155), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI  S  P D+ +L  ++  I GP  +PYEN  F 
Sbjct: 6   KRIIKETERL---------VSDPVPGI--SAEPHDD-NLRYFQVTIEGPQQSPYENGVFE 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELFLPEDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-NNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 64.7 bits (156), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI    +   E +L  ++  I GP  +PYEN  F+
Sbjct: 6   KRIIKETERL---------VSDPVPGITAEPH---EDNLRYFQVTIEGPQQSPYENGVFQ 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  
Sbjct: 54  LELFLPDDYPMEAPKVRFL-TKIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSVQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 64.3 bits (155), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 67/135 (49%), Gaps = 15/135 (11%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +         +++P  GI    +   E +L  ++  I GP  +PYEN  F +
Sbjct: 7   RIIKETERL---------VSDPVPGITAEPH---EDNLRYFQVTIEGPQQSPYENGVFNL 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  L
Sbjct: 55  ELFLPDDYPMEAPKVRFL-TKIYHPNI-DKLGRICLDVLK-TNWSPALQIRTVLLSVQAL 111

Query: 141 LREPVCDSPLDVDIG 155
           L  P  + PL  D+ 
Sbjct: 112 LASPNPNDPLANDVA 126

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 63.9 bits (154), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE     + LASD     P  GI  S  P  E +L  +   I GP ++PYEN  F 
Sbjct: 6   KRIIKE----TERLASD-----PVPGI--SAEP-HEDNLRYFAVTIEGPEESPYENGVFE 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELYLPDDYPMEAPKVRFL-TRIYHPNIDR-LGRICLDVLK-NNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 70/136 (51%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         I++P  GI  +  P D+ +L  +   + GP+ +PYEN  F+
Sbjct: 6   KRIIKETERL---------ISDPVPGI--TAEPHDD-NLRYFNVTVEGPTQSPYENGIFK 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 69/135 (51%), Gaps = 15/135 (11%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +         +++P  GI  +  P D+ +L  +E  I GP  +PYEN  F +
Sbjct: 7   RIIKETERL---------VSDPVPGI--TAEPHDD-NLRYFEVTIEGPQQSPYENGVFDL 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  L
Sbjct: 55  ELFLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQAL 111

Query: 141 LREPVCDSPLDVDIG 155
           L  P  + PL  D+ 
Sbjct: 112 LASPNPNDPLANDVA 126

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         I++P  GI    +   E +L  +   + GP+ +PYEN  F+
Sbjct: 6   KRIIKETERL---------ISDPVPGITAEPH---EDNLRYFNVTVEGPAGSPYENGIFQ 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  
Sbjct: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSVQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI    +   E +L  ++  I GPS +PYE   F+
Sbjct: 6   KRIIKETERL---------VSDPVPGITAEPH---EDNLRYFDVTIEGPSQSPYEKGIFK 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELYLPEDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 63.5 bits (153), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 69/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         I +P  GI  +  P D+ +L  +E  + GP  +PYEN  F+
Sbjct: 6   KRIIKETERL---------ITDPVPGI--TAEPHDD-NLRYFEVTVEGPVGSPYENGIFQ 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 68/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI    +   E +L  ++  I GP  +PYE+  F+
Sbjct: 6   KRIIKETERL---------VSDPVPGITAQPH---EDNLRYFQVTIEGPQQSPYESGVFQ 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + +V  
Sbjct: 54  LELFLPDDYPMEAPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSVQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 66/139 (47%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +G   +LN      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPTKGPDGTLN------LQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +++  F I +E P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  IWQDGVFPITVEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVLGVQDLLDSPNPNSP 128

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 62.4 bits (150), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 66/136 (48%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         I++P  GI    +   E +L  +   I GP D+ YEN  F 
Sbjct: 6   KRIIKETERL---------ISDPVPGITAQPH---EDNLRYFSVTIEGPKDSAYENGVFE 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELFLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-NNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 61.6 bits (148), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 63/117 (53%), Gaps = 6/117 (5%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           +++P  GI  +  P D+ +L  ++  I GP  +PYE+  F++ + +P  YPM  PK+ F+
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFL 62

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              I H N+    G ICL++LK   W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 63  -TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 61.6 bits (148), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P R    S+N      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFWAKPTRKADGSMN------LQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            ++   + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  IWKEGVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  DSP
Sbjct: 110 KQIVLGVQDLLNSPNPDSP 128

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 69/136 (50%), Gaps = 15/136 (11%)

Query: 20  SRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFR 79
            RI+KE + +         +++P  GI  +  P D+ +L  ++  I GP  +PYE+  F 
Sbjct: 6   KRIIKETEKL---------VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFE 53

Query: 80  ILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWR 139
           + + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  
Sbjct: 54  LELYLPDDYPMEAPKVRFL-TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQA 110

Query: 140 LLREPVCDSPLDVDIG 155
           LL  P  + PL  D+ 
Sbjct: 111 LLASPNPNDPLANDVA 126

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           +++P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  PK+ F+
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFL 62

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              I H N+    G ICL++LK   W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 63  -TRIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 60.8 bits (146), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           I++P  GI  +  P D+ +L  ++  I GP  +PYE   F++ + +P  YPM  PK+ F+
Sbjct: 12  ISDPVPGI--TAEPHDD-NLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFL 68

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              I H N+    G ICL+ILK   W+P   +   + +V  LL  P  + PL  D+ 
Sbjct: 69  -TKIYHPNI-DRLGRICLDILK-TNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 60.8 bits (146), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 62/117 (52%), Gaps = 6/117 (5%)

Query: 39  IANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFM 98
           +++P  GI  +  P D+ +L  ++  I GP  +PYE+  F + + +P  YPM  PK+ F+
Sbjct: 6   VSDPVPGI--TAEPHDD-NLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFL 62

Query: 99  QNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              I H N+    G ICL++LK   W+P   +   + ++  LL  P  + PL  D+ 
Sbjct: 63  -TKIYHPNI-DRLGRICLDVLK-TNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 116

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 60.8 bits (146), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/120 (32%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 64  IISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEE 123
           II  P +  Y+  +FR       +YP++PPK+    N I H N+    G+ICLNIL+ E+
Sbjct: 67  IIIIPDEGFYKGGKFRFTATFLETYPIDPPKV-ICNNKIFHPNI-DPHGKICLNILR-ED 123

Query: 124 WTPVWDLLHCVHAVWRLLREPVCDSPLD-----------VDIGNIIRCGDMSAYQGIVKY 172
           W+P  DL   V  +  L +EP  + PL+           ++ GN++R     A  G   Y
Sbjct: 124 WSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLNKDKLEFGNLVRLAMSGAMVGSTYY 183

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 65/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDP---IANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+N      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPYGFFAKPTKKTDGSMN------LQKWEAGIPGRDGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            ++N  + + IE P  YP  PPK+ F      H NV   +G ICL+IL + ++W P   L
Sbjct: 52  LWKNGLYPLTIEYPDDYPSKPPKVKF-PAGFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              +  V  LL  P  +SP
Sbjct: 110 KQLLLGVQDLLDSPNPNSP 128

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 59.7 bits (143), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 64/137 (46%), Gaps = 12/137 (8%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDET-DLSKWEAIISGPSDTPY 73
           S  C+ R+ +E K   K         +P+    + L   D T DL  WEA I G + T +
Sbjct: 2   SSLCLQRLQEERKKWRKD--------HPFSFFAKPLKKADGTMDLQHWEAGIPGKAGTLW 53

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDLLH 132
            +  + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L  
Sbjct: 54  ADAVYPISIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQ 111

Query: 133 CVHAVWRLLREPVCDSP 149
            V  V  LL  P  +SP
Sbjct: 112 IVLGVQDLLDSPNPNSP 128

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 59.7 bits (143), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+      DL KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSM------DLQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + I +E P+ YP  PPK+ F      H NV   +G ICL+IL + ++W P   L
Sbjct: 52  NWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVLGVQDLLDSPNPNSP 128

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.3 bits (142), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 64/136 (47%), Gaps = 10/136 (7%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S  C+ R+ +E K   K    D P     + + +S   +D   L KWEA I G   T + 
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPVKKSDGSMD---LQKWEAGIPGKEGTNWA 54

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDLLHC 133
              + I +E P+ YP  PPK+ F      H NV   +G ICL+IL + ++W P   L   
Sbjct: 55  GGVYPISVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITLKQI 112

Query: 134 VHAVWRLLREPVCDSP 149
           V  V  LL  P  +SP
Sbjct: 113 VLGVQDLLDSPNPNSP 128

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.3 bits (142), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+      DL KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSM------DLQKWEAGIPGREGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + I +E P+ YP  PPK+ F      H NV   +G ICL+IL + ++W P   L
Sbjct: 52  NWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVLGVQDLLDSPNPNSP 128

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.9 bits (141), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+      DL KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPVKKADGSM------DLQKWEAGIPGKDAT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + I +E P+ YP  PPK+ F      H NV   +G ICL+IL + ++W P   L
Sbjct: 52  NWAGGVYPITVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVLGVQDLLDSPNPNSP 128

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 58.9 bits (141), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 68/135 (50%), Gaps = 15/135 (11%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           RI+KE + +         +++P  GI  +  P D+ +L  +   I GP  +PYE+  F +
Sbjct: 7   RIIKETERL---------VSDPVPGI--TAEPHDD-NLRYFSVTIEGPEGSPYEHGIFDL 54

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140
            + +P  YPM  PK+ F+   I H N+    G ICL++LK   W+P   +   + ++  L
Sbjct: 55  ELFLPDDYPMESPKVRFL-TKIYHPNIDR-LGRICLDVLK-TNWSPALQIRTVLLSIQAL 111

Query: 141 LREPVCDSPLDVDIG 155
           L  P  + PL  D+ 
Sbjct: 112 LASPNPNDPLANDVA 126

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 57  DLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICL 116
           DL +WEA I G + T +    + I IE P  YP  PPK+ F +    H NV   +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPK-GFYHPNV-YPSGTICL 59

Query: 117 NILKPEE-WTPVWDLLHCVHAVWRLLREPVCDSP 149
           +IL  E+ W P   L   V  V  LL  P  +SP
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSP 93

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 59.7 bits (143), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 60/123 (48%), Gaps = 18/123 (14%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK I         + NP   II + +   E ++ +W  +I+GP  TPYEN Q+  
Sbjct: 9   RLTKEYKNI---------VNNPPPFIIAAPH---EDNILEWHYVITGPPSTPYENGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAVW 138
            +  PS YP NPP I  +  N      K  T  +CL++    PE W P W ++  ++ + 
Sbjct: 57  TLTFPSDYPFNPPAIRMITPN---GRFKENT-RLCLSMSDYHPEAWNPAWSVVTILNGLL 112

Query: 139 RLL 141
             +
Sbjct: 113 SFM 115

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 58.5 bits (140), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+N      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTKKPDGSMN------LQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +++  F I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  IWKDGVFPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
                 V  LL  P  +SP
Sbjct: 110 KQIALGVQDLLDSPNPNSP 128

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 65/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P R    ++N      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTRNADGTMN------LQKWEAGIPGREGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +++  + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  LWDHGVYPISIEYPDEYPSKPPKVRF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVIGVQDLLDTPNPNSP 128

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 57.8 bits (138), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    S+N      L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFYAKPCKKADGSMN------LQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +++  + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  IWQDGVYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
                 V  LL  P  +SP
Sbjct: 110 KQIALGVQDLLDSPNPNSP 128

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 64/136 (47%), Gaps = 16/136 (11%)

Query: 18  CMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           C+ R+ +E K   K    D P    A P +    S+N      L KWEA I G   T ++
Sbjct: 5   CLQRLQEERKKWRK----DHPFGFWAKPTKKEDGSMN------LQKWEAGIPGREGTIWK 54

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDLLHC 133
           +  + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   +   
Sbjct: 55  DAVYPITIEYPDDYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQI 112

Query: 134 VHAVWRLLREPVCDSP 149
           +  V  LL  P  DSP
Sbjct: 113 LLGVQDLLTSPNPDSP 128

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P R       P    DL +WEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTR------KPDGTMDLQRWEAGIPGKQGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            + +  + + IE P  YP  PPK+  +  N  H NV   +G ICL+IL + ++W P   L
Sbjct: 52  LWADGLYPLTIEYPDEYPSKPPKVK-LPANFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
                 +  LL  P  +SP
Sbjct: 110 KQICLGIQDLLDSPNPNSP 128

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 64/139 (46%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P R      +P    +L KWEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTR------HPDGSMNLQKWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + I IE P+ YP  PPK+  +  N  H NV   +G ICL+IL + ++W P   L
Sbjct: 52  IWAEGVYPITIEYPNEYPSKPPKVK-LPANFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
                 +  LL  P  +SP
Sbjct: 110 KQICLGIQDLLDSPNPNSP 128

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 63/139 (45%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P + +  S+N      L  WEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTKKVDGSMN------LQLWEAGIPGKEST 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + I IE P  YP  PPK+ F      H N+   +G +CL+IL + ++W P   L
Sbjct: 52  IWHGALYPITIEYPDEYPSKPPKVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
              V  V  LL  P  +SP
Sbjct: 110 KQIVLGVQDLLDTPNPNSP 128

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 57  DLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICL 116
           +L KWEA I G   T ++   F I IE P  YP  PPK+ F      H N+   +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 59

Query: 117 NIL-KPEEWTPVWDLLHCVHAVWRLLREPVCDSP 149
           +IL + ++W P   L      V  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 57.0 bits (136), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 18/129 (13%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           +     R+ KEYK++         + NP   II   N   E ++ +W  +ISGP DTPY+
Sbjct: 3   TKQAQKRLTKEYKMM---------VENPPPFIIARPN---EENILEWHYVISGPPDTPYD 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLH 132
             Q+   +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +  
Sbjct: 51  GGQYHGTLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVAT 106

Query: 133 CVHAVWRLL 141
            ++ +   +
Sbjct: 107 ILNGLLSFM 115

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 61/137 (44%), Gaps = 12/137 (8%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDET-DLSKWEAIISGPSDTPY 73
           S  C+ R+ +E K   K         +P+    +     D T +L KWEA I G   T +
Sbjct: 2   SSLCLQRLQEERKKWRKD--------HPFGFFAKPTKKTDGTMNLQKWEAGIPGKEGTLW 53

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEE-WTPVWDLLH 132
               + I IE P+ YP  PPK+  +     H NV   +G ICL+IL  E+ W P   L  
Sbjct: 54  AEGVYPITIEYPNEYPSKPPKVK-LPAGFYHPNV-YPSGTICLSILNEEQDWRPAITLKQ 111

Query: 133 CVHAVWRLLREPVCDSP 149
               +  LL  P  +SP
Sbjct: 112 ICLGIQDLLDSPNPNSP 128

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 56.2 bits (134), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 56/115 (48%), Gaps = 18/115 (15%)

Query: 18  CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQ 77
            + R+ KEYK+I         + NP   I+   N   E ++ +W  +I+GPSDTPY + Q
Sbjct: 6   ALKRLTKEYKLI---------VENPPPYIVARPN---EDNILEWHYVITGPSDTPYSSGQ 53

Query: 78  FRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           +   +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +
Sbjct: 54  YHGTLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSV 104

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 3/112 (2%)

Query: 47  IESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCN 106
           + +L P ++T  S    I   P +  Y   +F+  +    SYP++PP +  +Q  I H N
Sbjct: 32  LTTLVPPEDTSRSPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQ-KIYHPN 90

Query: 107 VKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
           +    G+ICLNIL+ E+W+P  D+   +  +  L  EP    PL+ D  + +
Sbjct: 91  I-DLNGKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL 140

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 55.1 bits (131), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 51/92 (55%), Gaps = 3/92 (3%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P +  Y++  F   +    SYP+ PP + F++  I H N+    G+ICLNIL+ E+W+PV
Sbjct: 75  PDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKK-IYHPNI-DLNGKICLNILR-EDWSPV 131

Query: 128 WDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
            DL   +  +  L  EP    PL++  G +++
Sbjct: 132 LDLQSIIIGLMFLFLEPNPRDPLNLKAGELLK 163

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 54.3 bits (129), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 64/136 (47%), Gaps = 16/136 (11%)

Query: 18  CMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           C+ R+ +E K   K    D P    A P +    S+N      L KWEA I G   T ++
Sbjct: 5   CLQRLQEERKKWRK----DHPFGFWAKPTKKEDGSMN------LQKWEAGIPGREGTIWK 54

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDLLHC 133
           +  + I IE P  YP  PP++ F      H N+   +G +CL+IL + ++W P   +   
Sbjct: 55  DGVYPITIEYPDDYPSKPPRVKF-PAGFYHPNI-YPSGTVCLSILNEDQDWKPAITMKQI 112

Query: 134 VHAVWRLLREPVCDSP 149
           +  V  LL  P  +SP
Sbjct: 113 LLGVQDLLTSPNPNSP 128

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 55.5 bits (132), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++         + NP   I+   N   E ++ +W  II+GP+DTPY+  Q+  
Sbjct: 9   RLTKEYKLM---------VENPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAV 137
            +  PS YP  PP I  +  N     N +     +CL++    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 138 WRLL 141
              +
Sbjct: 112 LSFM 115

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 54.7 bits (130), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 63  AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPE 122
            ++  P +  Y++ +F+  ++   +YP+ PP I    N I H N+    G+ICLNIL+ E
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-E 127

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           +W+P  DL   +  +  L  E     PL+ +  NI+   D   ++  V+  +A ++  N
Sbjct: 128 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKKLFN 185

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 54.7 bits (130), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 63  AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPE 122
            ++  P +  Y++ +F+  ++   +YP+ PP I    N I H N+    G+ICLNIL+ E
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNI-DLDGKICLNILR-E 128

Query: 123 EWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
           +W+P  DL   +  +  L  E     PL+ +  NI+   D   ++  V+  +A ++  N
Sbjct: 129 DWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILH-SDEDMFRKYVRDSMAGKKLFN 186

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 55.1 bits (131), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++         + NP   I+   N   E ++ +W  II+GP+DTPY+  Q+  
Sbjct: 9   RLTKEYKLM---------VENPPPYILARPN---EDNILEWHYIITGPADTPYKGGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAV 137
            +  PS YP  PP I  +  N     N +     +CL++    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 138 WRLL 141
              +
Sbjct: 112 LSFM 115

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 54.3 bits (129), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 63/129 (48%), Gaps = 8/129 (6%)

Query: 50  LNPIDETDL---SKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCN 106
           + P D TD     K E  +S P +  Y +      ++    YP+ PPK++ ++  I H N
Sbjct: 49  ITPPDSTDRMQSPKLEVTVS-PDEGYYNHGSINFGLDFNEVYPIEPPKVACLKK-IFHPN 106

Query: 107 VKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAY 166
           +    G +CLNIL+ E+W+P  DL   +  +  L  EP  + PL+ D   +  C +   +
Sbjct: 107 I-DLKGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF-CQNEKKF 163

Query: 167 QGIVKYFLA 175
             IV+  ++
Sbjct: 164 AEIVRSTMS 172

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 18/129 (13%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           +     R+ KEYK++++         NP   II   N   E+++ +W  +I+GP D+PY 
Sbjct: 3   TKQAHKRLTKEYKMMME---------NPTPYIIARPN---ESNILEWHYVITGPPDSPYH 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLH 132
           + Q+   +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +  
Sbjct: 51  DGQYHGTLTFPSDYPYKPPAIRMVTPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVAT 106

Query: 133 CVHAVWRLL 141
            ++ +   +
Sbjct: 107 ILNGLLSFM 115

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 53.9 bits (128), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 63/130 (48%), Gaps = 5/130 (3%)

Query: 46  IIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHC 105
           +I S +  + T   K E I   P +  Y +      ++    YP+ PPK++ ++  I H 
Sbjct: 48  VITSPDSTNRTHSPKLE-ITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKR-IFHP 105

Query: 106 NVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSA 165
           N+    G +CLNIL+ E+W+P  DL   V  +  L  EP  + PL+ D   ++ C D   
Sbjct: 106 NI-DFKGNVCLNILR-EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL-CQDEKE 162

Query: 166 YQGIVKYFLA 175
           +   V+  ++
Sbjct: 163 FAEAVRSTMS 172

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (47%), Gaps = 18/119 (15%)

Query: 14  TSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73
            +   + R+ KEYK++         + NP   I+   N   E ++ +W  II+GP DTPY
Sbjct: 2   ATKQALKRLTKEYKLM---------VENPPPYILARPN---EDNILEWHYIITGPPDTPY 49

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           ++ Q+   +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +
Sbjct: 50  KDGQYHGTLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSV 104

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 57/123 (46%), Gaps = 18/123 (14%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK+I         I NP   I+   N   E ++ +W  II+GP DTPY   Q+  
Sbjct: 9   RLSKEYKLI---------IENPTPYILARPN---ENNILEWHYIITGPPDTPYVGGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAVW 138
            +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPFKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPGWSVATILNGLL 112

Query: 139 RLL 141
             +
Sbjct: 113 SFM 115

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 20/124 (16%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++         + NP   I+   N   E ++ +W  II+GP+DTPY+  Q+  
Sbjct: 9   RLTKEYKLM---------VENPPPYILARPN---EDNILEWHYIITGPADTPYKAGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAV 137
            +  PS YP  PP I  +  N     N +     +CL++    P+ W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMITPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSVSTILNGL 111

Query: 138 WRLL 141
              +
Sbjct: 112 LSFM 115

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 59/123 (47%), Gaps = 18/123 (14%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++++T         PY  I    N   E+++ +W  II GP DTPY+  Q+  
Sbjct: 9   RLTKEYKMMVETPP-------PY--ITARPN---ESNILEWHYIIIGPQDTPYDGGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAVW 138
            +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLL 112

Query: 139 RLL 141
             +
Sbjct: 113 SFM 115

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 60  KWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL 119
           K E ++S P +  Y +      ++    YP+ PPK++ ++  I H N+    G +CLNIL
Sbjct: 62  KLEVVVS-PDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKK-IFHPNI-DLNGNVCLNIL 118

Query: 120 KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIV 170
           + E+W+P  DL   +  +  L  EP  + PL+ D   +  C D   +   V
Sbjct: 119 R-EDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF-CQDQKKFAETV 167

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 62/139 (44%), Gaps = 16/139 (11%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPI---ANPYRGIIESLNPIDETDLSKWEAIISGPSDT 71
           S  C+ R+ +E K   K    D P    A P +    SLN      L +WEA I G   T
Sbjct: 2   SSLCLQRLQEERKKWRK----DHPFGFFAKPTKKQDGSLN------LQRWEAGIPGKEGT 51

Query: 72  PYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL-KPEEWTPVWDL 130
            +    + + IE P  YP  PPK+  +     H NV   +G ICL+IL + ++W P   L
Sbjct: 52  LWHEGVYPLTIEYPDEYPSKPPKVK-LPAGFYHPNV-YPSGTICLSILNEDQDWRPAITL 109

Query: 131 LHCVHAVWRLLREPVCDSP 149
                 +  LL  P  +SP
Sbjct: 110 KQICLGIQDLLDSPNPNSP 128

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 53.9 bits (128), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 57/130 (43%), Gaps = 18/130 (13%)

Query: 14  TSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73
            S     R+ KEYK+I++          PY   +    P DE  L +W  +I+GP DTPY
Sbjct: 2   ASRQAYKRLSKEYKMIMENTP-------PYIIAV----PNDENIL-EWHYVITGPPDTPY 49

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLL 131
           E  Q+   +  P  YP  PP I     N      K  T  +CL++    P+ W P W + 
Sbjct: 50  EGGQYHGTLHFPPEYPFKPPAIRISTPN---GRFKQHT-RLCLSMSDYHPDTWNPSWSVA 105

Query: 132 HCVHAVWRLL 141
             ++ +   +
Sbjct: 106 TILNGLLSFM 115

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 53.5 bits (127), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 53/115 (46%), Gaps = 18/115 (15%)

Query: 18  CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQ 77
              R+ KEYK +         + NP   II   N   E ++ +W  +I+GP DTPYE  Q
Sbjct: 6   AQKRLTKEYKSM---------VENPPPFIIAQPN---EDNILEWHYVITGPPDTPYEGGQ 53

Query: 78  FRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           +   +  PS YP  PP I  +  +      K  T  +CL++    P+ W P W +
Sbjct: 54  YHGTLVFPSDYPFKPPAIRMVTPS---GRFKEDT-RLCLSMSDYHPDTWNPSWSV 104

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 53.1 bits (126), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 73  YENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLH 132
           Y    FR    +  +YP+ PPK+  +   I H N+ + TGEICLNIL+ E+W+P  DL  
Sbjct: 86  YNLGHFRFQFTINENYPIEPPKVVCL-TKIYHPNI-NRTGEICLNILR-EDWSPALDLQS 142

Query: 133 CVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERIN 181
            +  +  L  EP    PL+    + +   D + ++ IV+  +A  E IN
Sbjct: 143 VIIGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQKSMA-GESIN 189

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 55/126 (43%), Gaps = 18/126 (14%)

Query: 18  CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQ 77
              R+ KEYK I         I NP + I    N   E ++ +W  II+GP DTPY + Q
Sbjct: 6   AHKRLTKEYKAI---------IENPPQFINAQPN---EDNILEWHYIITGPPDTPYTDGQ 53

Query: 78  FRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVH 135
           +   +  P+ YP  PP I  +  N      K  T  +C+ +    P+ W P W +   + 
Sbjct: 54  YHGTLVFPADYPFKPPAIRMITPN---GRFKENT-RLCMTMSDYHPDTWNPAWSVATILM 109

Query: 136 AVWRLL 141
            +   +
Sbjct: 110 GLLSFM 115

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 20/120 (16%)

Query: 14  TSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73
            +   + R+ KEYK+I         + NP   +    N   E ++ +W  +I+GP +TPY
Sbjct: 2   ATKQALKRLTKEYKLI---------VENPPPYVTARPN---EDNILEWHYVITGPPETPY 49

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           E  Q+   +  PS YP  PP I  +  N     N +     +CL++    P+ W P W +
Sbjct: 50  EGGQYHGTLTFPSDYPYKPPAIRMVTPNGRFKENTR-----LCLSMSDYHPDLWNPGWSV 104

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 20/131 (15%)

Query: 14  TSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPY 73
            +     R+ KEYK++         + NP   I+   N   E ++ +W  II+GP++TPY
Sbjct: 2   ATKQAHKRLTKEYKLM---------VENPPPYILARPN---EDNILEWHYIITGPAETPY 49

Query: 74  ENHQFRILIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           +  Q+   +  PS YP  PP I  +  N     N +     +CL++    P+ W P W +
Sbjct: 50  KGGQYHGTLTFPSDYPYKPPAIRMVTPNGRFKPNTR-----LCLSMSDYHPDTWNPGWSV 104

Query: 131 LHCVHAVWRLL 141
              ++ +   +
Sbjct: 105 STILNGLLSFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 53.1 bits (126), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 20/127 (15%)

Query: 18  CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQ 77
              R+ KE+K +     ++DP   PY  I+   N   E+++  W  II+GP  TPYEN Q
Sbjct: 6   AQKRLAKEFKAM-----TEDP--PPY--IMARPN---ESNILDWHYIITGPPGTPYENGQ 53

Query: 78  FRILIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCV 134
           +   +  PS YP  PP I  +  +     N +     +CL++    P  W P W +   +
Sbjct: 54  YHGTLTFPSDYPFQPPAIRMVTPSGRFQENTR-----LCLSMSDYHPTTWNPGWSVSTIL 108

Query: 135 HAVWRLL 141
           + +   +
Sbjct: 109 NGLLSFM 115

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 4/124 (3%)

Query: 46  IIESLNPIDETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHC 105
           +I S +  D +   K E I+  P +  Y        ++    YP+ PPK+  ++  I H 
Sbjct: 49  VITSPDSADRSQSPKLEVIVR-PDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKK-IFHP 106

Query: 106 NVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSA 165
           N+    G +CLNIL+ E+W+P  DL   +  +  L  EP  + PL+ D   ++  G+   
Sbjct: 107 NI-DLKGNVCLNILR-EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEF 164

Query: 166 YQGI 169
            + +
Sbjct: 165 AEAV 168

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 52.8 bits (125), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 20/124 (16%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++         + NP   I+   N   E ++ +W  II+GP+DTPY   Q+  
Sbjct: 9   RLTKEYKLM---------VENPPPYILARPN---ENNILEWHYIITGPADTPYFEGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAV 137
            +  PS YP  PP I  +  N     N +     +CL++    P  W P W +   ++ +
Sbjct: 57  TLTFPSDYPYKPPAIRMVTPNGRFRENTR-----LCLSMSDYHPNTWNPSWSVSTILNGL 111

Query: 138 WRLL 141
              +
Sbjct: 112 LSFM 115

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 51.6 bits (122), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 63/150 (42%), Gaps = 8/150 (5%)

Query: 9   NRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGP 68
           N++  TS  C S      +  L +L        P   +     P D++       +I  P
Sbjct: 16  NKKGSTSSPCTSAARTRLQRDLDSLE-----VPPTTQLQILRAPTDQSRDPPLLRLIVSP 70

Query: 69  SDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVW 128
            +  Y    F   +     YP+ PP++  M N I H N+    G+ICLNIL+ E+W+P  
Sbjct: 71  DEGFYRKGHFTFEMTFTEKYPIEPPQVRCM-NQIFHPNI-DLQGKICLNILR-EDWSPAL 127

Query: 129 DLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
           DL   +  +  L  E     PL+    +++
Sbjct: 128 DLQSVIIGILFLFLEVSGRDPLNKQAASLL 157

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 11/119 (9%)

Query: 30  LKTLASDDPIANPYRGIIESLNPI-----DETDLSKWEAIISGPSDTPYENHQFRILIEV 84
           + T  +   +   Y+ ++ES  P      +E ++ +W  II+GP DTPY+  Q+   +  
Sbjct: 1   MATRQAHKRLTKEYKLLVESSPPFILARPNEDNILEWHYIITGPPDTPYDGGQYHGTLTF 60

Query: 85  PSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAVWRLL 141
           P+ YP  PP I  +  N      K  T  +CL++    P+ W P W +   ++ +   +
Sbjct: 61  PNDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

>AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER100W (UBC6)
          Length = 242

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 59/130 (45%), Gaps = 20/130 (15%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           S     R+ KEYK++ +         NP   I+ +     E ++  W  +I+GP +TPYE
Sbjct: 3   SRQAYKRLSKEYKMMTE---------NPPPYIVAAPK---EDNILVWHYVITGPPETPYE 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQ-NNILHCNVKSATGEICLNI--LKPEEWTPVWDLL 131
           + Q+   +  P+ YP NPP I  +  N     N +     +CL++    P+ W P W + 
Sbjct: 51  DGQYHGTLVFPNDYPFNPPAIRMLTPNGRFRENTR-----LCLSMSDYHPDTWNPSWSVA 105

Query: 132 HCVHAVWRLL 141
             +  +   +
Sbjct: 106 TILTGLLSFM 115

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 48/91 (52%), Gaps = 3/91 (3%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P +  Y+   F+       +YP+ PPK++ + + I H N+    G +CLNIL+ E+W+PV
Sbjct: 68  PDEGYYKCGHFKFCATFKDTYPIEPPKVTLL-SKIFHPNI-DLQGNVCLNILR-EDWSPV 124

Query: 128 WDLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
            D+   +  +  L  EP    PL+    +++
Sbjct: 125 LDVQSILIGLLMLFLEPNATDPLNKVAADVL 155

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P +  Y+   FR  +    +YP+ PP +  + N I H N+ +  G +CLNIL+ E+W+PV
Sbjct: 68  PDEGYYKPGYFRFSLFFKDTYPIEPPAVKCV-NKIYHPNIDTQ-GNVCLNILR-EDWSPV 124

Query: 128 WDLLHCVHAVWRLLREPVCDSPLD 151
            DL   V  +  L  EP    PL+
Sbjct: 125 LDLQSVVIGLLFLFLEPNDKDPLN 148

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MS++ + ++ +L+ L   +    P       L+  D+  ++KW   I GP  + +EN  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGLGP-ESCSYGLSDSDDITMTKWNGTILGPPHSNHENRIY 58

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
            +LIE   SYP  PPK+ F+    L C V S TGE+
Sbjct: 59  SVLIECGPSYPDEPPKVKFVSKINLPC-VNSTTGEV 93

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 57/123 (46%), Gaps = 18/123 (14%)

Query: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80
           R+ KEYK++ +         NP   I+   N   E ++ +W  II+GP D+PY   Q+  
Sbjct: 9   RLTKEYKMMNE---------NPTPFIMARPN---EANILEWHYIINGPPDSPYFEGQYHG 56

Query: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDLLHCVHAVW 138
            +  PS YP  PP I  +  N      K  T  +CL++    P+ W P W +   ++ + 
Sbjct: 57  TLTFPSDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLL 112

Query: 139 RLL 141
             +
Sbjct: 113 SFM 115

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 52/115 (45%), Gaps = 18/115 (15%)

Query: 18  CMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQ 77
              R+ KEYK +         + NP   II   N   E ++ +W  +I+GP DTPY   Q
Sbjct: 6   AQKRLSKEYKSM---------VENPPPFIIAQPN---EDNVLEWHYVITGPPDTPYMGGQ 53

Query: 78  FRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
           +   +  PS YP  PP I  +  +      K  T  +CL++    P+ W P W +
Sbjct: 54  YHGTLVFPSDYPFKPPAIRMVTPS---GRFKEDT-RLCLSMSDYHPDTWNPSWSV 104

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 49.3 bits (116), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 54/118 (45%), Gaps = 18/118 (15%)

Query: 15  SDTCMSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYE 74
           +     R+ KEYK + +T         PY  I+   N   E ++ +W  II+GP D+PY 
Sbjct: 3   TKQAFKRLTKEYKTLTET-------PPPY--ILARPN---EDNILEWHYIITGPPDSPYS 50

Query: 75  NHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNI--LKPEEWTPVWDL 130
             Q+   +  P+ YP  PP I  +  N      K  T  +CL++    P+ W P W +
Sbjct: 51  EGQYHGTLTFPTDYPYKPPAIRMITPN---GRFKENT-RLCLSMSDYHPDLWNPSWSV 104

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 48.9 bits (115), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 46/91 (50%), Gaps = 3/91 (3%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P +  Y    FR  +    +YP+ PP +  + N I H N+   +G ICLN+L+ E+W+PV
Sbjct: 83  PEEGVYRGGHFRFSVVFRDTYPIEPPTVKCL-NTIYHPNI-DYSGNICLNVLR-EDWSPV 139

Query: 128 WDLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
            DL   V  +  L  EP    PL+    + +
Sbjct: 140 MDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 55/115 (47%), Gaps = 5/115 (4%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P + PY    F+  ++    YP+ PP  +   N I H N+    G+ICLNIL+ E+W+P 
Sbjct: 77  PREGPYLGGAFKFNLKFNEMYPIEPPS-AICLNKIFHPNI-DLNGKICLNILR-EDWSPA 133

Query: 128 WDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAERERINN 182
            DL   V  +  L  +     PL+     ++   D + +  +V+  +   E INN
Sbjct: 134 LDLTSIVIGLLYLFLDFTSTDPLNQQAAEVL-ANDRNRFCELVQRAMLGSE-INN 186

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 42/84 (50%), Gaps = 3/84 (3%)

Query: 68  PSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV 127
           P +  Y+   F   +     YPM PPK+  + N I H N+ +  G +CLNIL+ ++WTP 
Sbjct: 61  PDEGYYKGGNFTFELLFNEQYPMEPPKVKCL-NRIYHPNIDT-DGRVCLNILR-QDWTPA 117

Query: 128 WDLLHCVHAVWRLLREPVCDSPLD 151
            DL   +  +  L  E     PL+
Sbjct: 118 LDLQSVIIGLLFLFLEISGVDPLN 141

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYR---GIIESLNPIDETDLSKWEAIISGPSDTPYEN 75
           MS++ + ++ +L+ L   +    P     G+ +S    D+  ++KW   I GP  + +EN
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGFGPESCSYGLADS----DDITMTKWNGTILGPPHSNHEN 55

Query: 76  HQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDL 130
             + + IE   +YP +PPK++F+    L C V   TGEI  +     +W   + +
Sbjct: 56  RIYSLSIECGPNYPDSPPKVTFISKINLPC-VNQTTGEIQTDFHTLRDWKRAYTM 109

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 40/81 (49%), Gaps = 3/81 (3%)

Query: 73  YENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLH 132
           Y    +   + +  +YPM PP +  M   I H N+    G +CLN+L+ E+WTP  D+  
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVKCMHR-IYHPNI-DIDGNVCLNLLR-EDWTPALDIQS 128

Query: 133 CVHAVWRLLREPVCDSPLDVD 153
            +  +  L  EP    PL+ D
Sbjct: 129 IIIGILFLFHEPNGRDPLNKD 149

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 47.4 bits (111), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 46/92 (50%), Gaps = 3/92 (3%)

Query: 67  GPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTP 126
            P +  Y++  F   +    SYP++PP +  +   I H N+    G ICLN+L+ E+WTP
Sbjct: 149 SPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTT-IYHPNI-DYNGNICLNVLR-EDWTP 205

Query: 127 VWDLLHCVHAVWRLLREPVCDSPLDVDIGNII 158
           V DL   V  +  L  EP    PL+    + +
Sbjct: 206 VLDLQTIVIGLLFLFLEPNPKDPLNKHAAHTM 237

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 64  IISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEE 123
           I + P +  Y+   F   +E   +YP+ PP +    + + H N+    G++CLNIL+ E+
Sbjct: 69  ITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTV-ICTSKLYHPNI-DIDGKVCLNILR-ED 125

Query: 124 WTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLA 175
           W+P  D+   +  +  LL EP    PL+ D   ++   D + +  +V   +A
Sbjct: 126 WSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLST-DTARFASLVNRSMA 176

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 45.1 bits (105), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 53/111 (47%), Gaps = 8/111 (7%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSR+ + ++ +L+ L   +    P       L   D+  ++ W   I GP  + +EN  +
Sbjct: 1   MSRVPRSFR-LLEELEKGEKGMGP-ESCSYGLAHSDDITMTHWNGTILGPPHSNHENRIY 58

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWD 129
            + IE   +YP  PPKI F+    L C V   TGE+     K E+++ + D
Sbjct: 59  SVAIECGEAYPDQPPKIRFLSKVNLPC-VDQNTGEV-----KKEQFSTLRD 103

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLN 117
           ++KW   I GP  + +EN  + + IE   +YP +PP ++F+    L C V   TGE+  N
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLPC-VSQTTGEVQTN 59

Query: 118 ILKPEEWTPVWDL 130
                +W   + +
Sbjct: 60  FHTLRDWKRAYTM 72

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 44.3 bits (103), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYR---GIIESLNPIDETDLSKWEAIISGPSDTPYEN 75
           MS++ + ++ +L+ L   +    P     G+ +S    D+  ++KW   I GP  + +EN
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGFGPESCSYGLADS----DDITMTKWNGTILGPPHSNHEN 55

Query: 76  HQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDL 130
             + + I+   +YP +PPK++F+    L C V   TGE+  +     +W   + +
Sbjct: 56  RIYSLSIDCGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTDFHTLRDWKRAYTM 109

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL087C
           (MMS2); 1-intron
          Length = 138

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 48/96 (50%), Gaps = 3/96 (3%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MS++ + ++ +L+ L   +    P       L   D+  ++ W   I GP  + +EN  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGMGP-ESCSYGLADGDDISMTHWNGTILGPPHSSHENRIY 58

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
            ++IE  + YP  PPK+ F+    L C V  +TGE+
Sbjct: 59  SVVIECGAEYPDRPPKVRFISRINLPC-VDPSTGEV 93

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 71/162 (43%), Gaps = 29/162 (17%)

Query: 7   LENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIE-SLNPIDETDLSKWE-AI 64
           + NR+S    T  S ++++Y+           + NP + I    +N  D++++  W   +
Sbjct: 1   MSNRKS----TAASLLLRQYR----------ELTNPKKAIPSFHINLEDDSNIFVWNIGV 46

Query: 65  ISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL----- 119
           +    D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL     
Sbjct: 47  MVLNEDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGD 104

Query: 120 ------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
                   E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 105 PMTDELDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLN 117
           ++KW   I GP  + +EN  + + IE   +YP +PPK++F+    L C V   TGE+  +
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPC-VNPTTGEVQTD 59

Query: 118 ILKPEEWTPVWDL 130
                 W   + +
Sbjct: 60  FHTLRGWKRAYTM 72

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 52/104 (50%), Gaps = 9/104 (8%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYR---GIIESLNPIDETDLSKWEAIISGPSDTPYEN 75
           MS++ + ++ +L+ L   +    P     G+ +S    D+  ++ W   I GP  + +EN
Sbjct: 1   MSKVPRNFR-LLEELEKGEKGLGPESCSYGLADS----DDITMTNWNGTILGPPHSNHEN 55

Query: 76  HQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL 119
             + + IE   +YP  PPKI F+    + C V S TGE+  ++ 
Sbjct: 56  RIYSVSIECGPNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVF 98

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MS++ + ++ +L+ L   +    P       L   D+  +++W   I GP  + +EN  +
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGLGP-ESCSYGLADADDITMTRWNGTILGPPHSNHENRIY 58

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI---CLNILKPEEWTPVWDL 130
            + IE    YP  PP I+F+    L C V  +TGE+     N LK  +W  ++++
Sbjct: 59  SVSIECGPKYPDEPPTITFISKINLPC-VDQSTGEVNKEKFNTLK--DWKRLYNM 110

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 48/101 (47%), Gaps = 3/101 (2%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQF 78
           MSR+ + ++ +L+ L   +    P        N  D T ++ W   I GP  + +EN  +
Sbjct: 1   MSRVPRSFR-LLEELEKGEKGLGPESCSYGLANGEDIT-MTTWNGTILGPPHSNHENRIY 58

Query: 79  RILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL 119
            ++I+    YP  PP + F+    L C V  ATGE+  N+ 
Sbjct: 59  SVVIKCGDEYPDKPPTVKFISKINLPC-VDQATGEVETNMF 98

>Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {ON}
           YGL087C (MMS2) - Similar to ubiquitin conjugating
           protein family [contig 30] FULL
          Length = 101

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 58  LSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
           ++ W   I GP  + +EN  + + +E  ++YP  PPKI F+    L C V   TGE+
Sbjct: 1   MTYWNGTILGPPHSNHENRIYSVALECGNAYPDEPPKIKFISKINLPC-VNQTTGEV 56

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 14/114 (12%)

Query: 54  DETDLSKWE-AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112
           D+++L  W   ++    D+ Y    F+  +  P  +P +PP+  F    I H NV    G
Sbjct: 35  DDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DG 92

Query: 113 EICLNIL-----------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
            +C++IL             E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQGGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 14/112 (12%)

Query: 54  DETDLSKWE-AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112
           DE++L  W   ++    D+ Y    F+  +  P  +P +PP+  F    I H NV    G
Sbjct: 35  DESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DG 92

Query: 113 EICLNIL-----------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
            +C++IL             E W+PV  +   + ++  LL +P   SP +VD
Sbjct: 93  RLCISILHQSGDPTTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVD 144

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 14/114 (12%)

Query: 54  DETDLSKWE-AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112
           D++++  W   ++    D+ Y    F+  ++ P  +P +PP+  F+   I H NV    G
Sbjct: 42  DDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQFKFIPP-IYHPNVYR-DG 99

Query: 113 EICLNILKP-----------EEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
           ++C++IL             E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 100 KLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 43/95 (45%), Gaps = 13/95 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSLYHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
              E W+PV  +   + ++  LL +P   SP +VD
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVD 144

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 63/130 (48%), Gaps = 17/130 (13%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYR---GIIESLNPIDETDLSKWEAIISGPSDTPYEN 75
           MS++ + ++ +L+ L   +    P     G+ +S    D+  ++ W   I GP  + + N
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGMGPESCSYGLADS----DDISMTNWNGTILGPPHSNHSN 55

Query: 76  HQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPV--WDLLHC 133
             + + IE   SYP  PP + F+    L+C V SATG     ++KP ++ P+  W   + 
Sbjct: 56  RIYSLSIECGPSYPDEPPTLKFISKINLNC-VDSATG-----VVKP-DFNPIKNWKRSYT 108

Query: 134 VHAVWRLLRE 143
           +  +   LR+
Sbjct: 109 METILLELRK 118

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 54  DETDLSKWEAIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGE 113
           D+  ++ W   I GP  + +EN  + + IE  ++YP  PP I F+    L C V   TGE
Sbjct: 36  DDITMTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLPC-VDQTTGE 94

Query: 114 I 114
           +
Sbjct: 95  V 95

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 47/95 (49%), Gaps = 13/95 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKP-------- 121
           D+ Y    F+  ++ PS++P +PP   F+   I H NV    G++C++IL          
Sbjct: 53  DSIYNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSE 110

Query: 122 ---EEWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
              E W+PV  +   + ++  LL +P   SP +VD
Sbjct: 111 PDNETWSPVQSVESVLISIISLLEDPNISSPANVD 145

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGYFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQGGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 40.8 bits (94), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 9/99 (9%)

Query: 19  MSRIVKEYKVILKTLASDDPIANPYR---GIIESLNPIDETDLSKWEAIISGPSDTPYEN 75
           MS++ + ++ +L+ L   +    P     G+ +S    D+  ++ W   I GP  + +EN
Sbjct: 1   MSKVPRSFR-LLEELEKGEKGLGPESCSYGLADS----DDISMTTWNGTILGPPHSNHEN 55

Query: 76  HQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEI 114
             + + IE   +YP +PP I F+    L C V S TG++
Sbjct: 56  RIYSLSIECGPNYPDHPPTIKFISKINLPC-VDSKTGQV 93

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 71/160 (44%), Gaps = 29/160 (18%)

Query: 7   LENRRSYTSDTCMSRIVKEYKVILKTLASDDPIANPYRGIIE-SLNPIDETDLSKWE-AI 64
           + NR+S    T  S ++++Y+           + +P + I    +N  D++++  W   +
Sbjct: 1   MSNRKS----TAASLLLRQYR----------ELTDPKKSIPSFHINLEDDSNIFVWNIGV 46

Query: 65  ISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL----- 119
           +    ++ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL     
Sbjct: 47  MVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGD 104

Query: 120 ------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVD 153
                   E W+PV  +   + ++  LL +P   SP +VD
Sbjct: 105 PMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVD 144

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 14/114 (12%)

Query: 54  DETDLSKWE-AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112
           D++++  W   ++    D+ Y    F+  +  P  +P +PP+  F    I H NV    G
Sbjct: 35  DDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DG 92

Query: 113 EICLNIL-----------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
            +C++IL             E W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 93  RLCISILHQSGDPMTDEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 13/101 (12%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGYFKAQMRFPDDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIGNIIR 159
              E W+PV  +   + ++  LL +P   SP +VD     R
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDFR 150

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P  +SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 42/97 (43%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP   F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGYFKAQMRFPEDFPFSPPTFRFTPA-IYHPNVYR-DGRLCISILHTSGDPTSEE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 110 PDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 41.2 bits (95), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  +  P  +P +PP+  F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGFFKAQMRFPEDFPFSPPQFRFTPA-IYHPNVYR-DGRLCISILHQSGDPMTDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 110 PDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 40.8 bits (94), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 43/97 (44%), Gaps = 13/97 (13%)

Query: 70  DTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNIL---------- 119
           D+ Y    F+  ++ P  +P +PP   F    I H NV    G +C++IL          
Sbjct: 52  DSIYHGGYFKAQMKFPEDFPFSPPNFRFTPA-IYHPNVYR-DGRLCISILHQSGDPTSDE 109

Query: 120 -KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
              E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 110 PDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 14/114 (12%)

Query: 54  DETDLSKWE-AIISGPSDTPYENHQFRILIEVPSSYPMNPPKISFMQNNILHCNVKSATG 112
           D++++  W   ++    D+ Y    F+  +  P  +P +PP   F    I H NV    G
Sbjct: 35  DDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPA-IYHPNVYR-DG 92

Query: 113 EICLNIL-----------KPEEWTPVWDLLHCVHAVWRLLREPVCDSPLDVDIG 155
            +C++IL             E W+PV  +   + ++  LL +P   SP +VD  
Sbjct: 93  RLCISILHQSGDPTSDEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,750,635
Number of extensions: 950237
Number of successful extensions: 2548
Number of sequences better than 10.0: 281
Number of HSP's gapped: 2353
Number of HSP's successfully gapped: 281
Length of query: 183
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 80
Effective length of database: 41,670,801
Effective search space: 3333664080
Effective search space used: 3333664080
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 62 (28.5 bits)