Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR131W (FHN1)3.493ON1741748351e-115
Smik_6.2273.493ON1741746945e-94
Skud_7.4423.493ON1741746884e-93
Suva_7.4193.493ON1741746303e-84
Smik_16.4023.493ON1731745202e-67
Skud_16.4443.493ON1731745184e-67
YPR149W (NCE102)3.493ON1731745132e-66
NDAI0G009303.493ON1761775105e-66
CAGL0I10494g3.493ON1721755062e-65
NCAS0E008003.493ON1741744714e-60
NDAI0B058803.493ON1821824724e-60
CAGL0L08448g3.493ON1731744681e-59
Suva_16.4783.493ON1661744653e-59
TDEL0D056103.493ON1751754569e-58
KAFR0C019703.493ON1791794421e-55
KNAG0B008003.493ON1821824247e-53
Kpol_1017.63.493ON1871874056e-50
KLLA0D16280g3.493ON1691744012e-49
SAKL0F02750g3.493ON1701743923e-48
NCAS0F035603.493ON1831833917e-48
TBLA0C044903.493ON1861713873e-47
ZYRO0D09966g3.493ON1781783821e-46
TBLA0D029603.493ON1891893832e-46
KNAG0A079503.493ON1821823803e-46
TPHA0D032803.493ON1841843673e-44
Kwal_55.212383.493ON1701743491e-41
KLTH0F14850g3.493ON1711753395e-40
KAFR0G037003.493ON1861863343e-39
AFR312W3.493ON1681222612e-28
Ecym_12363.493ON1691742612e-28
KAFR0B038208.805ON19425681.4
YDL222C (FMP45)2.55ON309109644.6
Smik_4.182.55ON309109629.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR131W
         (174 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   326   e-115
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   271   5e-94
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   269   4e-93
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   247   3e-84
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   204   2e-67
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   204   4e-67
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   202   2e-66
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   201   5e-66
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   199   2e-65
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   186   4e-60
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   186   4e-60
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   184   1e-59
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   183   3e-59
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   180   9e-58
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   174   1e-55
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   167   7e-53
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   160   6e-50
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   159   2e-49
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   155   3e-48
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   155   7e-48
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   153   3e-47
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   151   1e-46
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   152   2e-46
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   150   3e-46
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   145   3e-44
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   139   1e-41
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   135   5e-40
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   133   3e-39
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   105   2e-28
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   105   2e-28
KAFR0B03820 Chr2 complement(791679..792263) [585 bp, 194 aa] {ON...    31   1.4  
YDL222C Chr4 complement(60872..61801) [930 bp, 309 aa] {ON}  FMP...    29   4.6  
Smik_4.18 Chr4 complement(38898..39827) [930 bp, 309 aa] {ON} YD...    28   9.7  

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  326 bits (835), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/174 (92%), Positives = 161/174 (92%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLSAADNLVRIINAVF             TQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS
Sbjct: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  271 bits (694), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 142/174 (81%), Positives = 148/174 (85%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLSAADNL+RIINAVF             TQ KHSSRVNFCMF A YGLVTDSLYGFLAN
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAKHSSRVNFCMFTAAYGLVTDSLYGFLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           FW+SLTYPAILL LD LNFIFTFVAATALAVGIRCHSCKNKTYLEQNKI Q SSSRCHQS
Sbjct: 61  FWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAFFYFSCFLFLIKVTV   G +QNGGFG N+GF RRRARRQ+G+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQLGVPTISQV 174

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  269 bits (688), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 150/174 (86%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLSAADNL+RI++AVF             TQT  SSRVNFCMFAA YGL+TDS YGFLAN
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNGSSRVNFCMFAAAYGLITDSFYGFLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           FW+SLTYPAILLVLDFLNF+FTF AATALAVGIRCHSCKNKTYLEQN I QGSSSRCHQS
Sbjct: 61  FWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAFFYFSCFLFLIKVTV+  GMMQNGGFG NTG+ RRRARRQMG+PTISQV
Sbjct: 121 QAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQMGVPTISQV 174

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  247 bits (630), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 125/174 (71%), Positives = 138/174 (79%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS ADN+VRIINA+F             +QTKHSSRVNFCMFAA YGL+TDS YG LAN
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTKHSSRVNFCMFAAAYGLLTDSFYGCLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
            W+SLTYP I+ VLDFLNF+FTF+A TALAVGIRCHSC NKTYL+ NKI QGS SRCHQ+
Sbjct: 61  LWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           +AAV FFYFSC LFLIKV V+   M+QNGGFG    F RRRARRQMGIPTISQV
Sbjct: 121 KAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQMGIPTISQV 174

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  204 bits (520), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 99/174 (56%), Positives = 121/174 (69%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ KHSSRVN+CMFA  YG+ TDSLYG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDKHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F   L +P +L  LDFLNF+FTF A T LAVGIR HSC N +Y++ NKI QGS +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSIFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  204 bits (518), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 123/174 (70%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ ++SSRVNFCMFAA YG+ TDSLYG  AN
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDRNSSRVNFCMFAAAYGIFTDSLYGVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F+  L +P +L  LDFLNF+FTF A T LAVGIR HSC N++Y++ N I QGS +RC Q+
Sbjct: 61  FFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 173

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  202 bits (513), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 121/174 (69%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+ ADN++RIIN +F             TQ +HSSRVN+CMFA  YG+ TDSLYG  AN
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHRHSSRVNYCMFACAYGIFTDSLYGVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F   L +P +L  LDFLNF+FTF A T LAVGIR HSC N +Y++ NKI QGS +RC Q+
Sbjct: 61  FIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 121 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 173

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  201 bits (510), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 129/177 (72%), Gaps = 4/177 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS ADNL+R++NA+F             TQ  H+SR+N+CMF  VY L+TDS +G LAN
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNSRINYCMFTCVYCLLTDSFFGILAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F+  L++P IL  LDFLNF FTFVA T LA GIR HSC N++YL++NKI QGS +RC +S
Sbjct: 61  FFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR---QMGIPTISQV 174
           QA VAFFYFS F+FLIK+ ++T+ M+QNG F SNT  SRRR R    ++G+P+ISQV
Sbjct: 121 QALVAFFYFSMFIFLIKLAMSTISMIQNGAF-SNTFTSRRRRRNGAAEVGVPSISQV 176

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  199 bits (506), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (70%), Gaps = 4/175 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS ADNL+RI+NAVF             T+ +HSSRVNFC+FAA YG+ TDSLYG  AN
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKRHSSRVNFCLFAAAYGIATDSLYGIFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLE-QNKIIQGSSSRCHQ 119
           F+  L +P +L VLDFLNF+FTF A T LAVGIR HSC NK YLE + KI+QGS +RC Q
Sbjct: 61  FFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCRQ 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           +QA VAFFYFS  +FL K+ ++ + ++ NG FG+     RR+   ++G+P+ISQV
Sbjct: 121 AQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKL---RRKHHTEVGVPSISQV 172

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  186 bits (471), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 117/174 (67%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML  ADNL+RI+NAVF             T+T ++SR+N+CMF   Y L TDS+YG  AN
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNSRINYCMFTCAYCLTTDSIYGIFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F+  L  PA+   LDFLNF FTFVA T LA GIR HSCK++ Y+  NKI QG  +RC +S
Sbjct: 61  FFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QA VAFFYFS  +FL K+ ++T+ M+QNG F  + G  RRR   ++G+P+ISQV
Sbjct: 121 QALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  186 bits (472), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 120/182 (65%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN++R+INA+F             TQ  +SSR+NFCMFAA +GL+TDS +G   N
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRNNSSRINFCMFAAAFGLLTDSFFGVAFN 60

Query: 61  FWTSL-TYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
            + +L ++P +L + DFLNF+FTF A T LAV IR HSCKN+ Y+  N I QGS +RC  
Sbjct: 61  MFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCRM 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR-------QMGIPTIS 172
           SQAAVAFFYFSCF+FL K+ ++ + M  NG FGS T    R  RR       ++G+PTIS
Sbjct: 121 SQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  184 bits (468), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 114/174 (65%), Gaps = 1/174 (0%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+  DNL+RI+N VF             T+ +HSSRVN+CMFAA YG+ TDSLYG  AN
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDRHSSRVNYCMFAAAYGIATDSLYGVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F+  L +P IL  LDFLNF F   A   LAVGIR HSC N  Y E NKIIQGS  RC +S
Sbjct: 61  FFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRES 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAFF+FS  +FL K+ ++ + +  NG FG+     RRR   ++G+P++SQV
Sbjct: 121 QAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTKF-IRRRRNNAEVGVPSVSQV 173

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  183 bits (465), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 91/174 (52%), Positives = 116/174 (66%), Gaps = 8/174 (4%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+  DN++RIIN +F             TQ+ +SSR+N+CMFA  Y +VTDSLYG  AN
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGNSSRINYCMFAVAYAIVTDSLYGVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F+  L +P IL  LDFLNF+FTF A       IR HSC+N+TYL  N I QGS +RC ++
Sbjct: 61  FFEPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCREA 113

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QAAVAF YFSC +FL K  ++   M+ NG FGS + FS+RR   Q+G+PTISQV
Sbjct: 114 QAAVAFLYFSCAIFLAKTLMSVFNMISNGAFGSGS-FSKRRRTGQVGVPTISQV 166

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  180 bits (456), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 120/175 (68%), Gaps = 1/175 (0%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+  DN +R++N  F             ++  HSSRVNFCMFAA +G+VTDS YG LAN
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGHSSRVNFCMFAAAFGIVTDSFYGILAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
            W    +P IL  LDFLNF FTF AATALAVGIR HSCKN+ YL+ N I QGS+ RC  +
Sbjct: 61  IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRLA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGF-SRRRARRQMGIPTISQV 174
           QA+VAFFYFS F+FL K+ ++ +G++ NG F S T   SRRR   Q+G+PTISQV
Sbjct: 121 QASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  174 bits (442), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 92/179 (51%), Positives = 119/179 (66%), Gaps = 5/179 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQT-KHSSRVNFCMFAAVYGLVTDSLYGFLA 59
           ML  ADN++R+INAVF             TQ   H+SRVN+CMFA  +GL  DS+YG  A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
           NF+  L +P +L  LDFLNF FTF AATALAVGIR HSC N++YL+ NKI++GS  RC +
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGF--GSNTGFSRRR--ARRQMGIPTISQV 174
           +QA VAF YFS  +F+ K+ ++ + + QNG F  GS+   SRR+  A    G+P ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  167 bits (424), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 87/182 (47%), Positives = 107/182 (58%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML  ADNL+R++N  F             TQ  H SRVN+CMFAA YG+ TD LYG LAN
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKFHISRVNYCMFAAAYGIATDGLYGLLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           FW  L +P IL  LDFLNF FT  A   LAVGIR HSCKN  Y E+N IIQGS +RC  S
Sbjct: 61  FWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCRIS 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTG--------FSRRRARRQMGIPTIS 172
           QAA AFF+FS  +F+ K+ ++ + +  NG F + +                   G+P+IS
Sbjct: 121 QAATAFFFFSMGIFIAKMVMSGINLASNGAFTTASSKFGRRRRHGGGVGVPETSGVPSIS 180

Query: 173 QV 174
           QV
Sbjct: 181 QV 182

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  160 bits (405), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 117/187 (62%), Gaps = 13/187 (6%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS ADN++R IN  F             T+  HSSRVN+CMF   + +VTDS YG LAN
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGHSSRVNYCMFVPPFAVVTDSFYGILAN 60

Query: 61  FWTS-LTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
            WT+   +P IL   DFLNF FTF A T L+VGIR HSCKN+ Y++ NKIIQGS+ RC +
Sbjct: 61  IWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFG-SNTGFSRRR-----------ARRQMG 167
           +QA++AFFYFS F+F +KV ++ + ++ NG  G S     RRR           +  Q+G
Sbjct: 121 AQASIAFFYFSFFIFFVKVVMSAINLLSNGAMGFSTPSIGRRRHHTANIGVPGASSPQVG 180

Query: 168 IPTISQV 174
           +P ISQV
Sbjct: 181 VPNISQV 187

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  159 bits (401), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 114/174 (65%), Gaps = 5/174 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R +N VF             TQ   SSRVNF +FAAV+G+V DSLY  +AN
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHSSSRVNFAIFAAVFGIVFDSLYALIAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F ++L +P IL+ LDFLN++FTF AATALAVGIR  SC N ++   NKI +GS  RC ++
Sbjct: 61  FISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QA+  F YFS  +FL+K  ++ +  + +G FG++   S R+   Q+G+PTISQV
Sbjct: 121 QASTVFLYFSFAIFLVKFILSIVNAITSGAFGTS---SNRKT--QVGVPTISQV 169

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  155 bits (392), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 83/174 (47%), Positives = 111/174 (63%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R++N  F             TQ +HS RVNF +F A + LVTDS Y   AN
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDEHSPRVNFAIFTAAFALVTDSFYAVFAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
            +++  +P +L+  DFLNF+FTF AATALAVGIR HSC N++YL  N I QGS+ RC ++
Sbjct: 61  LFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QA VAF YFS F+FL K+ ++ + +  +G     +G   RRA   +G+PTISQV
Sbjct: 121 QATVAFLYFSFFIFLTKLVLSVINVFSSG--AFGSGSGSRRA--NVGVPTISQV 170

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  155 bits (391), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 116/183 (63%), Gaps = 9/183 (4%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R  N +F             TQ   SSRVN+CMFAA +GL+TDS +G  AN
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHGSSRVNYCMFAAAFGLLTDSFFGMAAN 60

Query: 61  FWTSLT-YPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
               L+ +P IL V DFLNF+FTF A T LAVGIRCHSC N+ YLE NKIIQGS  RC  
Sbjct: 61  LIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCRV 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARR--------QMGIPTI 171
           SQAAVAFFYF+ F+FL K+ ++ + M  NG FGS +  SRR+ R           G+PTI
Sbjct: 121 SQAAVAFFYFAAFVFLAKMIMSAISMASNGAFGSGSFMSRRKRRSGAGVGGTTGGGVPTI 180

Query: 172 SQV 174
           S+V
Sbjct: 181 SEV 183

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  153 bits (387), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 80/171 (46%), Positives = 107/171 (62%), Gaps = 4/171 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59
           MLS   N++RIIN  F             ++ + HS RVN+CMFAA + LVTDS Y   A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 60  NFWTS-LTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCH 118
           NFW S   +P +L   DFLNF FTF A T L+VGIR HSC NK YL  NKI QGS+ RC 
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNT--GFSRRRARRQMG 167
            +QA++AF+YFS F++L+++  +++ M +NG F      G S R +RR++ 
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLA 171

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  151 bits (382), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 125/178 (70%), Gaps = 4/178 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59
           ML+  DN++R +N  F             ++   H+SRVNFCMFAA +G+V DS YG LA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
           N +    +P IL +LDFLNF+FTF AATALAVGIR HSC N+ YL+ NKI QGS+SRC +
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQ---MGIPTISQV 174
           +QA VAFFYF+ F+FL K+ ++ + ++ NG FGS++GFS RR R Q   +G+PTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  152 bits (383), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 104/189 (55%), Gaps = 15/189 (7%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQT-KHSSRVNFCMFAAVYGLVTDSLYGFLA 59
           ML   DN+ RI N  F             T+   HSSRVN+CMF   +GLV+DS YG LA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 60  NF-WTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCH 118
           N       +P IL   DFLNF+FTF A T LAVGIR HSC NK Y  +N IIQGS  RC 
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 119 QSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNT--------GFSRR---RARRQM- 166
           ++QA +AFFYFS FLFL+KV +  +     G  G            F RR   RA  QM 
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 167 -GIPTISQV 174
            G  +ISQV
Sbjct: 181 KGGISISQV 189

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  150 bits (380), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 115/182 (63%), Gaps = 8/182 (4%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML+ AD  +R++N VF             TQ  HSSR+N+CMF A YG+ TDS YG +AN
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGHSSRINYCMFTAAYGITTDSFYGVVAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           FW  L++P +L  LDFLNF+FT  A   LAVGIR HSCKN  Y  +NKI+QGS +RC Q+
Sbjct: 61  FWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGS------NTGFSRRRARR--QMGIPTIS 172
           QAAVAFF+FS  +FL K  ++ + +  NG FGS       + FS+R+  +    G+P IS
Sbjct: 121 QAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRKRTQGVPQGVPNIS 180

Query: 173 QV 174
            V
Sbjct: 181 TV 182

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  145 bits (367), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/184 (46%), Positives = 111/184 (60%), Gaps = 10/184 (5%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           ML  ADN++R +N  F             TQ +HSSRVN+C+F   + LVTD+ YG LAN
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQHSSRVNYCIFVPPFALVTDTFYGALAN 60

Query: 61  FW-TSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
            W T L +P IL   DFLNF FTF A T LAVG R HSC N++YL+ N I QGS+ RC +
Sbjct: 61  IWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNT---------GFSRRRARRQMGIPT 170
           +QAA AFFYFS F+FL K+ ++++ +  NG  GS +               A  Q+G+P 
Sbjct: 121 AQAATAFFYFSFFIFLAKLIMSSINLFTNGALGSMSFGRRRGGAGVGVPGAASPQIGVPN 180

Query: 171 ISQV 174
           ISQV
Sbjct: 181 ISQV 184

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  139 bits (349), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 113/174 (64%), Gaps = 4/174 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R  N VF             T+  ++ +VNF +FAA +GL+ D+LY   AN
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRDNNNPQVNFAVFAAAFGLLFDTLYAIPAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F ++L +P ++ V DFLNF+FTF AATALAV IR HSC N  Y++ NK+ QGSS RC ++
Sbjct: 61  FISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRKA 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QA+VAF YF+ F+FL+K+ ++ + +   G F +++G    R    +G+PTISQV
Sbjct: 121 QASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSG----RKSANVGVPTISQV 170

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  135 bits (339), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 82/175 (46%), Positives = 113/175 (64%), Gaps = 5/175 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSS-RVNFCMFAAVYGLVTDSLYGFLA 59
           MLS  DN +R +N  F             T   H++ +VNF +F A +GL+ DSLY   A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
           NF ++L +P ++ V DFLNF+FTF AATALAV IR HSC N+ YL+ N + QGS+ RC +
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           +QA+VAF YFS F+FL K+ ++ + ++  G FG+  G SRR     +G+PTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGLSLVNLISVGAFGA--GSSRRTG--NVGVPTISQV 171

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  133 bits (334), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 114/186 (61%), Gaps = 12/186 (6%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKH-SSRVNFCMFAAVYGLVTDSLYGFLA 59
           ML+ ADN +R++N  F             T+  H S+RVN+CMFA  +G++TDS+YG  A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119
           NF+  L +P IL V DFLNF+F F A T LAVGIR H+C N+ Y   NKI++GS +RC  
Sbjct: 61  NFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCRV 120

Query: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGG--FGSNTGFSRRRARR---------QMGI 168
           +QAAVAFFYFS  +FL+K   + M  +  G    GS+ GF  RR RR           G+
Sbjct: 121 AQAAVAFFYFSMAIFLVKGVFSIMKAISEGPFGSGSSFGFGSRRKRRSAGTGVPTTSTGV 180

Query: 169 PTISQV 174
           PT+S+V
Sbjct: 181 PTVSEV 186

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  105 bits (261), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 70/122 (57%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R +N VF              Q    SRVNF +F AV+ LVTDS Y  +AN
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHSRVNFGLFTAVFALVTDSFYSIVAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F ++  +P I + LD LN IFTF AATAL   I  HSC N+ +L+ N I + S+ RC + 
Sbjct: 61  FISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRKV 120

Query: 121 QA 122
           QA
Sbjct: 121 QA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  105 bits (261), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 97/174 (55%), Gaps = 5/174 (2%)

Query: 1   MLSAADNLVRIINAVFXXXXXXXXXXXXXTQTKHSSRVNFCMFAAVYGLVTDSLYGFLAN 60
           MLS  DN +R  N +F              Q +  SRVNF +F A++ L+ DSLY  LAN
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHSRVNFGLFTAIFALLFDSLYSVLAN 60

Query: 61  FWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQS 120
           F ++L +P +L+  D LN IFTF AATAL   I  HSC N  +L  N I +G   RC + 
Sbjct: 61  FISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRKV 120

Query: 121 QAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQMGIPTISQV 174
           QA+  F +FS F+FL K  ++ + ++  G F S +G      +   G+PTISQV
Sbjct: 121 QASSVFLFFSFFIFLAKAVLSGLNIVSTGAFSSGSG-----RKTGGGVPTISQV 169

>KAFR0B03820 Chr2 complement(791679..792263) [585 bp, 194 aa] {ON}
           Anc_8.805 YMR255W
          Length = 194

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 17/25 (68%)

Query: 92  GIRCHSCKNKTYLEQNKIIQGSSSR 116
           G R HS +NKT L QNK I+ S ++
Sbjct: 72  GSRAHSSENKTPLSQNKQIKSSQNK 96

>YDL222C Chr4 complement(60872..61801) [930 bp, 309 aa] {ON}
           FMP45Integral membrane protein localized to mitochondria
           (untagged protein); required for sporulation and
           maintaining sphingolipid content; has sequence
           similarity to SUR7 and YNL194C
          Length = 309

 Score = 29.3 bits (64), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 11/109 (10%)

Query: 36  SRVNFCMF-AAVYGLVTDSLYGFLANFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIR 94
           SRV + M   +++ +V   + GFLA F      P +  VL +L F F  +AA  L  G  
Sbjct: 110 SRVGWAMLLISLFFIVLALVPGFLATFLPFKAVPVLYCVLSWLAFFFIILAA-CLYTGC- 167

Query: 95  CHSCKNKTYLEQNKIIQGSSSRCHQSQAAVAFFYFSCFLFLIKVTVATM 143
                   Y++  K  + S           AF + S FL L+    +T+
Sbjct: 168 --------YVKARKTFRNSGRSARLGPKNFAFIWTSVFLMLVNAIWSTI 208

>Smik_4.18 Chr4 complement(38898..39827) [930 bp, 309 aa] {ON}
           YDL222C (REAL)
          Length = 309

 Score = 28.5 bits (62), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 44/109 (40%), Gaps = 11/109 (10%)

Query: 36  SRVNFCMF-AAVYGLVTDSLYGFLANFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIR 94
           SRV + M   A++ +V   + GFLA F      P +  VL +L F F  +AA  L  G  
Sbjct: 110 SRVGWAMLLVALFFIVLALVPGFLATFLPFKAVPVLYCVLSWLAFFFIILAA-CLYTGC- 167

Query: 95  CHSCKNKTYLEQNKIIQGSSSRCHQSQAAVAFFYFSCFLFLIKVTVATM 143
                   Y++       S           AF + S FL L+    +T+
Sbjct: 168 --------YVKARNTFHDSGRSAKLGAKNFAFIWTSVFLMLVNAVWSTI 208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.331    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 13,807,639
Number of extensions: 457618
Number of successful extensions: 1532
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1516
Number of HSP's successfully gapped: 36
Length of query: 174
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 72
Effective length of database: 41,785,467
Effective search space: 3008553624
Effective search space used: 3008553624
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 62 (28.5 bits)