Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR130C3.492ON81659324460.0
Skud_7.4413.492ON80760419040.0
Smik_6.2263.492ON83963019060.0
Suva_7.4183.492ON83146016900.0
NCAS0E008103.492ON6924269261e-113
CAGL0I10516g3.492ON8134198412e-99
SAKL0F02772g3.492ON7734638341e-98
NDAI0G009403.492ON6564306991e-80
KLTH0F14828g3.492ON8365196821e-76
Kwal_55.212293.492ON7874926141e-67
KLLA0D16236g3.492ON8714886022e-65
TDEL0D056003.492ON7002665908e-65
ZYRO0D09988g3.492ON9943426001e-64
Kpol_480.143.492ON6993115441e-58
TPHA0D042503.492ON6292735216e-56
KNAG0B008103.492ON7572713771e-36
Ecym_12373.492ON7272963582e-34
KAFR0C019603.492ON5632672964e-27
AFR310C3.492ON6232632441e-20
TBLA0C044803.492ON802941825e-13
KNAG0A079403.492ON2751341453e-09
KAFR0G036903.492ON3631301332e-07
NCAS0F035503.492ON4411191172e-05
NDAI0B058603.492ON6811131056e-04
Suva_4.1914.238ON1782151840.26
ZYRO0B06182g3.106ON856236734.4
KNAG0F001301.19ON36391724.5
Ecym_21466.269ON1621198734.8
KLLA0E14851g2.329ON669142725.7
KNAG0F036507.488ON1264145725.8
KLLA0F07997g7.101ON1119107726.2
Ecym_24785.123ON96192726.6
AGL058Cna 1ON969137717.3
KLLA0F13442g8.444ON58759718.1
YMR183C (SSO2)6.258ON29589708.2
KNAG0F017006.263ON19145698.5
TDEL0F047508.351ON70569709.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR130C
         (816 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   946   0.0  
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   738   0.0  
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   738   0.0  
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   655   0.0  
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   361   e-113
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   328   2e-99
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   325   1e-98
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   273   1e-80
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   267   1e-76
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   241   1e-67
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   236   2e-65
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   231   8e-65
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...   235   1e-64
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   214   1e-58
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   205   6e-56
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   149   1e-36
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...   142   2e-34
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...   118   4e-27
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    99   1e-20
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    75   5e-13
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    60   3e-09
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    56   2e-07
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    50   2e-05
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    45   6e-04
Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W...    37   0.26 
ZYRO0B06182g Chr2 complement(496610..499180) [2571 bp, 856 aa] {...    33   4.4  
KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON} A...    32   4.5  
Ecym_2146 Chr2 complement(272237..277102) [4866 bp, 1621 aa] {ON...    33   4.8  
KLLA0E14851g Chr5 complement(1328372..1330381) [2010 bp, 669 aa]...    32   5.7  
KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7....    32   5.8  
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    32   6.2  
Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar t...    32   6.6  
AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON} N...    32   7.3  
KLLA0F13442g Chr6 complement(1244416..1246179) [1764 bp, 587 aa]...    32   8.1  
YMR183C Chr13 complement(626921..627808) [888 bp, 295 aa] {ON}  ...    32   8.2  
KNAG0F01700 Chr6 complement(311082..311657) [576 bp, 191 aa] {ON...    31   8.5  
TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {O...    32   9.4  

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  946 bits (2446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/593 (82%), Positives = 492/593 (82%)

Query: 224 NAVENSADEATSVEEEHEDKVSESTSIGKGTADSAQINVAEPISSENGVLEPRTTDQSGG 283
           NAVENSADEATSVEEEHEDKVSESTSIGKGTADSAQINVAEPISSENGVLEPRTTDQSGG
Sbjct: 224 NAVENSADEATSVEEEHEDKVSESTSIGKGTADSAQINVAEPISSENGVLEPRTTDQSGG 283

Query: 284 SKSGVVPTDEQKEEKSDVKKVNPPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 343
           SKSGVVPTDEQKEEKSDVKKVNPPS                                   
Sbjct: 284 SKSGVVPTDEQKEEKSDVKKVNPPSGEEKKEVEAEGDAEEETEQSSAEESAERTSTPETS 343

Query: 344 XXXXXXXXXXXXXXKAPKVPFQEPSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPE 403
                         KAPKVPFQEPSRKERTGIFALW                 NPVATPE
Sbjct: 344 EPESEEDESPIDPSKAPKVPFQEPSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPE 403

Query: 404 NPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQN 463
           NPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQN
Sbjct: 404 NPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQN 463

Query: 464 QIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEK 523
           QIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEK
Sbjct: 464 QIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEK 523

Query: 524 NEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQ 583
           NEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQ
Sbjct: 524 NEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQ 583

Query: 584 NEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTII 643
           NEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTII
Sbjct: 584 NEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTII 643

Query: 644 KQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 703
           KQENANEKTQLSAITKRLEDERRAH                                   
Sbjct: 644 KQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQL 703

Query: 704 DHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEAL 763
           DHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEAL
Sbjct: 704 DHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEAL 763

Query: 764 KQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816
           KQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA
Sbjct: 764 KQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816

 Score =  252 bits (644), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 121/156 (77%), Positives = 121/156 (77%)

Query: 1   MLFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFNINRQEDDPFTQLI               ESPYQFLQKVVSNEPKGKEEWVSPFRQD
Sbjct: 1   MLFNINRQEDDPFTQLINQSSANTQNQQAHQQESPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120
           ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ
Sbjct: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXXXXITDLTKDEK 156
           NEERQYQ                    ITDLTKDEK
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKKCQKITDLTKDEK 156

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/604 (65%), Positives = 438/604 (72%), Gaps = 15/604 (2%)

Query: 226 VENSADEATSVEEEHEDKVSESTSIGK---GTADSAQ--------INVAEP--ISSENGV 272
           V +S DEATS+EEE +DK SE+TS+ K   G  + AQ         +VAEP  ++++  V
Sbjct: 206 VGDSGDEATSIEEEQDDKASETTSVEKAAAGNGEGAQEPVALKNEGSVAEPTAVTTQVDV 265

Query: 273 LEPRTTDQSGGSKSGVVPTDEQKEEKSDVKKVNPPSXXXXXXXXXXXXXXXXXXXXXXXX 332
            EP  T QS   +S V+PT+E K E S VK+VNP                          
Sbjct: 266 PEPAVTSQSNVPESAVLPTEESKSETSVVKEVNP--TEEGQTEEVHDEEDEKSEQSSVEE 323

Query: 333 XXXXXXXXXXXXXXXXXXXXXXXXXKAPKVPFQEPSRKERTGIFALWXXXXXXXXXXXXX 392
                                    KAPKVPF+E  +KERTGIFALW             
Sbjct: 324 HGEETSTPETSEAESVEDKAPIDPSKAPKVPFKERPKKERTGIFALWKSPTSSSAQKGGV 383

Query: 393 XXXXNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNK 452
               NPVATPENPELIVKTKEHGYLSKAVYDKINYDEK+HQAWLADL+AKEK KYDA + 
Sbjct: 384 TAPSNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATST 443

Query: 453 EYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDT 512
            Y E+LQDLQNQIDEIENSMKAMR+ETSEKIEVSKNRLVK+IIDVN  HNNKKLMI KDT
Sbjct: 444 GYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNKKLMIFKDT 503

Query: 513 ENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 572
           ENMKNQKLQEK+EVL KQT VKSEID+LN+ KTNVQKEFNDWTTNLSNLSQQLDAQIFKI
Sbjct: 504 ENMKNQKLQEKDEVLGKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQQLDAQIFKI 563

Query: 573 NQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQ 632
           NQINLKQ KVQNEID L+KKKEDL+ QTEENKKLHE+NVQ LESVENKEYLPQINDIDNQ
Sbjct: 564 NQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVENKEYLPQINDIDNQ 623

Query: 633 ISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXX 692
           +S+LLN++TII+QENANEKT+LSAITKRLEDERRAH                        
Sbjct: 624 VSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERKRKEENLLEKQRQ 683

Query: 693 XXXXXXXXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEE 752
                      DHEQQITQVKQTYNDQLTELQDKLA EEKELEAVKRERTRLQ EKAIEE
Sbjct: 684 ELEEQAHQAQLDHEQQITQVKQTYNDQLTELQDKLAAEEKELEAVKRERTRLQGEKAIEE 743

Query: 753 QTRQKNADEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEED 812
           QTRQK++DEALKQEIL +QHKQAEG+HAAE H IPN  S KN  ++PKDDSLYEYHTEED
Sbjct: 744 QTRQKSSDEALKQEILGKQHKQAEGLHAAEKHNIPNSHSPKNEILVPKDDSLYEYHTEED 803

Query: 813 VMYA 816
           VMYA
Sbjct: 804 VMYA 807

 Score =  221 bits (563), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/154 (68%), Positives = 111/154 (72%)

Query: 1   MLFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFN NRQ++DPFTQLI               E PYQFLQKVVSNEPKGKEEWVSPFRQD
Sbjct: 1   MLFNTNRQDEDPFTQLINQSSANAQNQREQQEEKPYQFLQKVVSNEPKGKEEWVSPFRQD 60

Query: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120
           AL+  QNNR Y  DAKN+KFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT+
Sbjct: 61  ALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTK 120

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXXXXITDLTKD 154
           NEERQYQ                    ITDLT D
Sbjct: 121 NEERQYQLLTELELKEKHLKYLKECQKITDLTSD 154

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/630 (63%), Positives = 445/630 (70%), Gaps = 44/630 (6%)

Query: 227 ENSADEATSVEEEHEDKVSESTSI----------------------------GKGTADSA 258
           E+ +DEATS+EE+  DK SESTSI                             K TADS 
Sbjct: 214 EHGSDEATSIEEKQGDKASESTSIEESTSKNDNNVREAASLNDEGNVAESSISKTTADST 273

Query: 259 QINVAEP------------ISSENGVLEPRTTDQSGGSKSGVVPTDEQKEEKSDVKKVNP 306
           Q+NV EP            ++S N   EP T  +SG SKS ++PT+E KEE    KK++ 
Sbjct: 274 QMNVPEPAATSQRDTSAQVVTSSNDASEPHTKSESGISKSDIIPTEELKEETVVAKKIS- 332

Query: 307 PSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKAPKVPFQE 366
                                                              KAPKVPFQE
Sbjct: 333 ---SAVKSTEEEEGEGEETEQSSVEEPGEETSTPGTSESESEEDKVPIDPSKAPKVPFQE 389

Query: 367 PSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYLSKAVYDKIN 426
             RK +TGIFALW                 NPVATPE PELIVKTKEHGYLSKAVYDKIN
Sbjct: 390 RPRKGKTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEHGYLSKAVYDKIN 449

Query: 427 YDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVS 486
           YDEK+HQAWL DLRA+EK KYDAKNKEY+EKLQDLQNQIDE+E+SMKAMR+ETSEKIEVS
Sbjct: 450 YDEKVHQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVS 509

Query: 487 KNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTN 546
           KNRLVK+IIDVNA HNNKKLMI KDTENMKNQKL+EKN VL+KQTNVKS+ID+LN+EKTN
Sbjct: 510 KNRLVKQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTN 569

Query: 547 VQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKL 606
           VQK+FNDWTTNLSNLSQQLDAQIFKINQINLKQ KVQ+EID+LE+KK  LVTQT+EN+KL
Sbjct: 570 VQKDFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKL 629

Query: 607 HEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERR 666
           HEKNVQVLESVEN+EYLPQINDIDNQIS+LLNE+TIIKQENANEKTQLSAITKRLEDERR
Sbjct: 630 HEKNVQVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERR 689

Query: 667 AHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQVKQTYNDQLTELQDK 726
           AH                                   DHE+QITQVK+TYNDQLTELQDK
Sbjct: 690 AHEEQLKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQLTELQDK 749

Query: 727 LATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAENHKI 786
           LA EEKELE VKRE+TRLQ EKAIEEQTRQ+NADEALKQEILS+QHKQAEG+HAAE +KI
Sbjct: 750 LAAEEKELETVKREKTRLQGEKAIEEQTRQRNADEALKQEILSKQHKQAEGLHAAERYKI 809

Query: 787 PNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816
           PND  QKN +V+PKDDSLYEYHTEEDVMYA
Sbjct: 810 PNDHPQKNKNVVPKDDSLYEYHTEEDVMYA 839

 Score =  233 bits (595), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/157 (72%), Positives = 118/157 (75%), Gaps = 1/157 (0%)

Query: 1   MLFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFNINRQ DDPFTQLI               E+PYQFLQKVVSNEPKGKEEW+SPFRQD
Sbjct: 1   MLFNINRQNDDPFTQLINQSSENGQSKQAQQKENPYQFLQKVVSNEPKGKEEWISPFRQD 60

Query: 61  ALANRQNN-RAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 119
           ALA++QNN R Y EDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT
Sbjct: 61  ALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLT 120

Query: 120 QNEERQYQXXXXXXXXXXXXXXXXXXXXITDLTKDEK 156
           QNEERQYQ                    ITDLTKDEK
Sbjct: 121 QNEERQYQLLTELELKEKHLQYLKKCQKITDLTKDEK 157

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/460 (74%), Positives = 378/460 (82%), Gaps = 1/460 (0%)

Query: 358 KAPKVPFQEPSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYL 417
           KAPKVPFQE  +KERTG FALW                 NPVATPENPELIVKTKEHGYL
Sbjct: 372 KAPKVPFQERPQKERTGFFALWKSPTSSSAKKGAATAPLNPVATPENPELIVKTKEHGYL 431

Query: 418 SKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMRE 477
           SKAVYDKINYDEKIHQAWL DLRA+EK KYDAKN EYKEKLQDLQNQIDEIENSMK +RE
Sbjct: 432 SKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNTEYKEKLQDLQNQIDEIENSMKQLRE 491

Query: 478 ETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEI 537
           ETS+KIEV+KNRLVK+IID+N EHNNKKLMI KDTENMK QKL+EKNEVL+KQTNVKSEI
Sbjct: 492 ETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDTENMKKQKLEEKNEVLNKQTNVKSEI 551

Query: 538 DDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLV 597
           D+LN+EK+NVQKEFNDWTTNLS+LSQQLDAQIFKINQINLKQ K QNEIDNLEK+K+DL+
Sbjct: 552 DELNSEKSNVQKEFNDWTTNLSSLSQQLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLI 611

Query: 598 TQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAI 657
           TQTEENKKLHEKNV+VLESVENKEYLPQINDID QIS+LLN++TII+QENANE+T LSAI
Sbjct: 612 TQTEENKKLHEKNVEVLESVENKEYLPQINDIDTQISTLLNQMTIIRQENANERTHLSAI 671

Query: 658 TKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQVKQTYN 717
           TK+LEDERRAH                                   +HE+QITQVK+TYN
Sbjct: 672 TKKLEDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYN 731

Query: 718 DQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEG 777
           DQLTELQDKLA EE+ELEAVKRERT+LQ EKAIEEQTRQKNADE LKQ IL +QHKQA G
Sbjct: 732 DQLTELQDKLAAEEEELEAVKRERTKLQGEKAIEEQTRQKNADEILKQTILDKQHKQATG 791

Query: 778 IHAAENH-KIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816
           +HAAEN    P+   Q++   +PK+DSLYEYHTEEDVMYA
Sbjct: 792 LHAAENRVNTPSSNLQESKRAVPKNDSLYEYHTEEDVMYA 831

 Score =  208 bits (530), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 109/154 (70%), Gaps = 2/154 (1%)

Query: 1   MLFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKEEWVSPFRQD 60
           MLFN +RQEDDPFTQLI               E PYQFLQKVVSNEPKGKE+WVSPFRQD
Sbjct: 1   MLFNTSRQEDDPFTQLINQSSAQNQQVQQQ--EKPYQFLQKVVSNEPKGKEDWVSPFRQD 58

Query: 61  ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQ 120
           AL+  QNNR Y  DAKNRKFPTVSATS YSKQQP+DLGYKNIPK+ KRAKDI+FPTYLT+
Sbjct: 59  ALSGNQNNRLYVHDAKNRKFPTVSATSPYSKQQPQDLGYKNIPKDVKRAKDIKFPTYLTK 118

Query: 121 NEERQYQXXXXXXXXXXXXXXXXXXXXITDLTKD 154
           NEERQYQ                    ITDLT D
Sbjct: 119 NEERQYQLLTELELKEKHLKYLKKCQKITDLTGD 152

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 1/78 (1%)

Query: 228 NSADEATSVEEEHEDKVSESTSIGKGTADS-AQINVAEPISSENGVLEPRTTDQSGGSKS 286
           +SADEATS+EEE ++   E+T   + TAD+  +I   E    E  + EP   + +  +  
Sbjct: 203 DSADEATSIEEEQKENAGETTPTVETTADNEKEIQEPETFKDEQNLAEPAVAEITPVTAR 262

Query: 287 GVVPTDEQKEEKSDVKKV 304
             +P         DV +V
Sbjct: 263 SDIPESAVAAASDDVPEV 280

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  361 bits (926), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 280/426 (65%), Gaps = 6/426 (1%)

Query: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456
           NPVA+P N E IVKT + GYLSKAVYDKI YDE+ H+ WLAD   K+ +KY+AK +EYK+
Sbjct: 267 NPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQEYKK 326

Query: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516
            LQD+ NQ+ E+ + ++    +T EKI+V   +LVKK+ D      N K+ I  +T+ +K
Sbjct: 327 SLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQINDKMKIFNETKQIK 386

Query: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576
            +KL EK  VL+  T VK  ID+L NEK  V+ E+++WTTN++N+  +LDA++FKI+QIN
Sbjct: 387 LEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNIGSELDAKLFKISQIN 446

Query: 577 LKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL 636
           + Q  +QN+ID L  +K +L  +  +NK +H+ NV+++ESV+NKEYLP++NDIDN+I+ L
Sbjct: 447 VTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKEYLPKLNDIDNEINGL 506

Query: 637 LNEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXX 696
           LN++TI+KQENANEK QL+ ITK+LEDERRAH                            
Sbjct: 507 LNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERKRQEENLLGKQRDELEA 566

Query: 697 XXXXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQ 756
                  +H+Q+I  +K  Y  +L E +++L  E+ +L+ VKR++TRL+ EKA++EQ RQ
Sbjct: 567 KANTMQVNHQQEIDALKNDYETKLEEFKNQLKQEQDQLDQVKRQKTRLEGEKALDEQKRQ 626

Query: 757 KNADEALKQEILSRQHKQAEGIHAAE----NHKIPNDRSQKNTSVLP--KDDSLYEYHTE 810
           K+AD+ LK EI  +QHKQAE   AA+     H +     +      P  KD+SLY+Y TE
Sbjct: 627 KDADDVLKNEIFEKQHKQAEAFSAAQLKGRKHPLAALAREITGEAKPSSKDNSLYDYETE 686

Query: 811 EDVMYA 816
           EDVMY 
Sbjct: 687 EDVMYV 692

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 53/87 (60%), Gaps = 8/87 (9%)

Query: 40  QKVVSNEPKGKEEWVSPFRQD-ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLG 98
           +K+ ++E K   ++ SPFR + +  N QN        K R+FPTVSATS Y+ + PK  G
Sbjct: 60  KKIAASEAKAMSDYASPFRAEYSNVNVQNE-------KTRRFPTVSATSNYTLKNPKQKG 112

Query: 99  YKNIPKNAKRAKDIRFPTYLTQNEERQ 125
           +  I K    AKDI FP YLT+NE+RQ
Sbjct: 113 FTTIKKGQNFAKDIYFPNYLTENEQRQ 139

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  328 bits (841), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 193/419 (46%), Positives = 268/419 (63%), Gaps = 23/419 (5%)

Query: 398 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEK 457
           P+ATPENPELI KT+E+GY+SK +YDK+ YDE  H+ WL   +  EK KYD K +EY  +
Sbjct: 418 PIATPENPELIAKTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNE 477

Query: 458 LQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKN 517
           L++LQ +ID I  SM+ +++ET++KIEVS+N LVKKI + N  HN +K  I K+TEN+KN
Sbjct: 478 LEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKN 537

Query: 518 QKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 577
           QK+Q+K E+LDK   V+ EI  LN+ K  V++EF+ WTTN++ L QQLDA+I K+ QI +
Sbjct: 538 QKIQQKKEILDKHAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITM 597

Query: 578 KQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLL 637
           KQ + Q EI+ LE +K++   Q +  KK HE+  +V+ES ENKEYLP+I+ IDNQIS LL
Sbjct: 598 KQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELL 657

Query: 638 NEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 697
           NE+ IIKQENANE+T+LS ITK LE+ERRAH                             
Sbjct: 658 NELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEK 717

Query: 698 XXXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQK 757
                 +HE+Q+ ++K+ Y              E EL  VK+++  L+ EK +EE  R +
Sbjct: 718 AEQQKREHEEQVRKMKEQY--------------ENELNNVKKQKESLETEKLVEEHNRNE 763

Query: 758 NADEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPKDDSLYEYHTEEDVMYA 816
           N    +K+E+L +Q KQAE  HAA+   I       N +   +D+SLYE+ TEE++MY 
Sbjct: 764 N----IKKEVLDKQRKQAEAQHAAQTKSIAT-----NAANDMQDNSLYEFKTEEEIMYV 813

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 50/72 (69%), Gaps = 8/72 (11%)

Query: 54  VSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIR 113
           V+PF         N  AY ++AK  KFPTVSATSA + Q PK+LG+K + K+ KRAKDI+
Sbjct: 105 VNPFT--------NKPAYNKNAKQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIK 156

Query: 114 FPTYLTQNEERQ 125
           FP YLT+NE RQ
Sbjct: 157 FPVYLTENEFRQ 168

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  325 bits (834), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 192/463 (41%), Positives = 297/463 (64%), Gaps = 24/463 (5%)

Query: 358 KAPKVPFQEPSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYL 417
           KAP+VPF     K +TG+FALW                  P+ATP++PE IV+T + GY+
Sbjct: 325 KAPRVPF-----KAKTGVFALWTRSDKQD----------QPLATPQDPEYIVRT-DKGYM 368

Query: 418 SKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMRE 477
           SKA+YDK+ YDE++HQ  LA    ++ DKYDA  KEY +KL  LQ+QIDE++ +M+ +R 
Sbjct: 369 SKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRL 428

Query: 478 ETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEI 537
           +T EKI+VS++ L KK++D+NA H + K +I K+TEN+K QK+ E++E+  K   VK+EI
Sbjct: 429 DTKEKIKVSESELSKKMLDLNATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEI 488

Query: 538 DDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLV 597
           ++LN  K  V  EFN++   L +L+ QLD+++ KI ++N KQ ++   I  L +KK ++ 
Sbjct: 489 EELNVLKKQVDAEFNEYQAKLDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIE 548

Query: 598 TQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAI 657
           T+T + ++LH+++  +LES++NKEYLP+IN ID+Q+++LL  +T+IKQENAN+KT+ +AI
Sbjct: 549 TETRDAEELHKESTGILESIKNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAI 608

Query: 658 TKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHEQQITQVKQTYN 717
           TKRLE+ER+AH                                    HE+++ Q+K+ + 
Sbjct: 609 TKRLEEERKAHEEKLRREEEERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHE 668

Query: 718 DQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEG 777
             L +   +LA E++E E V+RE+TRL  EKAI+EQ R + AD ALKQE++ ++ KQAE 
Sbjct: 669 KALNDANVQLAKEKEEREVVEREKTRLAGEKAIQEQERAQEADLALKQELMEKRRKQAEA 728

Query: 778 IHAAENHKIPNDRSQKNTSV------LPKDDSLYEYHTEEDVM 814
           + AAE  +     +QK + +      L ++ SLY+Y T E+++
Sbjct: 729 VDAAEQAR--KISTQKKSVLSNPSQNLTRESSLYDYETVEEII 769

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 62/121 (51%), Gaps = 20/121 (16%)

Query: 7   RQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKE--EWVSPFRQDALAN 64
           +Q+ DPF  L+               E P  FL+KVV+N+ K +E  ++ SPFR      
Sbjct: 7   KQQVDPFAHLLQPEQPQ---------EQP-NFLRKVVTNKKKEEEEKDYSSPFRS----- 51

Query: 65  RQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEER 124
            Q      ++ K +KFPTVSATS  +     DLGYK I    +RAKDI  P YL   +E+
Sbjct: 52  -QQELIAAKNVKAKKFPTVSATSGTAS--AADLGYKVIDSAKRRAKDISVPRYLKNTDEK 108

Query: 125 Q 125
           Q
Sbjct: 109 Q 109

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  273 bits (699), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 168/430 (39%), Positives = 263/430 (61%), Gaps = 10/430 (2%)

Query: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456
           NP ATP + E IVKTK+ G LSK++YD++ YD++ H+ +LA  +A+ ++KYD K +EY+ 
Sbjct: 227 NPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYEN 286

Query: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516
           +L+ L  +I      ++  +++T  K+++    LVK++ D  +   + K+ I  +T+ +K
Sbjct: 287 ELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIK 346

Query: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576
            +K+ EK  V +    V  EID LN EK  V  EFN+WT N++N+++QLDA++FKI QIN
Sbjct: 347 REKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQIN 406

Query: 577 LKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL 636
           + Q  +QN+ID L  +K  L  + E NK  H  NV+ +E+V+NK+YLP++N+ID+QI+ L
Sbjct: 407 ITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDL 466

Query: 637 LNEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXX 696
           LN++T+IKQENANEK QLS +T++LE ER  H                            
Sbjct: 467 LNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQ 526

Query: 697 XXXXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVKRERTRLQAEKAIEEQTRQ 756
                  +HE ++T +K +Y  QL + + KL  ++ +++ +K +++RL+  KAIE+Q RQ
Sbjct: 527 KANDLQLNHETEMTNLKTSYEQQLADFKSKLMEQQDKVDDLKLQKSRLEGSKAIEDQDRQ 586

Query: 757 KNADEALKQEILSRQHKQAEGIHAAE-----NHKIPNDRSQKNTSVLP-----KDDSLYE 806
           K +D  LK EILS+QH+QAE  +A +      +  P        S +P     KDDSL+E
Sbjct: 587 KQSDNVLKNEILSKQHQQAEAYNAVQLAQKKKNASPVAEDLMKESHIPALSKAKDDSLFE 646

Query: 807 YHTEEDVMYA 816
           Y TEE++MY 
Sbjct: 647 YETEEEIMYV 656

 Score = 93.6 bits (231), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 51/140 (36%), Positives = 77/140 (55%), Gaps = 18/140 (12%)

Query: 1   MLFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSN--------------- 45
           M   +  +++DPF  L+                S   FLQ+V+S+               
Sbjct: 1   MSLKLGSKKNDPFEHLLNPQPKTTGSSDSSRPRSSSLFLQRVISSTSSIQKTPTTSSSSK 60

Query: 46  EPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKN 105
           +    EE++SPFR + + N   N+AY ++ K ++FPTVSATS Y+ +  K++G+K IPK+
Sbjct: 61  KKVSTEEYLSPFRSNLVTN---NKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKD 117

Query: 106 AKRAKDIRFPTYLTQNEERQ 125
              AKDI FP+YLTQNE+RQ
Sbjct: 118 KNFAKDIFFPSYLTQNEQRQ 137

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  267 bits (682), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 179/519 (34%), Positives = 272/519 (52%), Gaps = 115/519 (22%)

Query: 360 PKVPFQEPSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYLSK 419
           P+VPF        TGIFALW                  PVA+P +PE IVK  + GY+SK
Sbjct: 355 PRVPFA-------TGIFALWTRSDKRG----------QPVASPNDPEFIVKF-DKGYMSK 396

Query: 420 AVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREET 479
           A+YD + Y+E IH+  + D   +   KY+AK  EY+++L  L++QI E+E +M+ ++++T
Sbjct: 397 ALYDTLEYEEAIHKREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDT 456

Query: 480 SEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDD 539
           +EKIE+S+ +L  ++ID+NAEH++ K +I K+TENMK  K++EK  V  KQ +VK+E+++
Sbjct: 457 TEKIEISEAKLSAQMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEE 516

Query: 540 LNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQ 599
           L   +  +  E  +    +  L+ +LDA++  I ++N +Q ++Q  ID+L+++K+ L+++
Sbjct: 517 LEKLRAEIDAENREHQGRVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISE 576

Query: 600 TEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAIT- 658
                + H  NV VLES+ENKEYLP++N ID +IS LL  +T++KQE AN KT+ +A++ 
Sbjct: 577 ANAADEQHGSNVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSK 636

Query: 659 --------------------KRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 698
                               KRLE ER                                 
Sbjct: 637 RLEEEDEERKEKLRQEEENRKRLEAER--------------------------------L 664

Query: 699 XXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKEL-------EAVKRERTRLQAEKAIE 751
                +H+QQI  ++Q +  QL E   K A  E+ L       E V+RER +LQ EKAI 
Sbjct: 665 QKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQRELVERERVKLQGEKAIR 724

Query: 752 EQTRQKNADEALKQEILSRQHKQA---EGIHAA---------ENHKIP--NDRSQKNTSV 797
           EQ   K AD+AL++EI  R H +A   +G  AA         E  K P      QK T +
Sbjct: 725 EQEEAKAADKALEEEIKQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPL 784

Query: 798 LPK-----------------------DDSLYEYHTEEDV 813
           LP                        + SLYEY TE+++
Sbjct: 785 LPAPVQKETPLLPAPESAQPKALTNDNSSLYEYFTEKEI 823

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/89 (43%), Positives = 49/89 (55%), Gaps = 11/89 (12%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQD-ALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKD 96
           FL KVVS E + +  + SPFR   +LA  Q         K +KFPTVSA+ +       D
Sbjct: 27  FLHKVVSKE-QEQSAYNSPFRTSQSLAAAQKR-------KMQKFPTVSASVSAHSS--SD 76

Query: 97  LGYKNIPKNAKRAKDIRFPTYLTQNEERQ 125
           +GYK I    +RAKDI  P YL  N+ERQ
Sbjct: 77  MGYKVIDAARRRAKDIAVPRYLQGNDERQ 105

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  241 bits (614), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 169/492 (34%), Positives = 262/492 (53%), Gaps = 78/492 (15%)

Query: 360 PKVPFQEPSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYLSK 419
           P+VPF        TGIFALW                  PVA+P++PE IVK  + GY+SK
Sbjct: 327 PRVPFA-------TGIFALWTRSDKRG----------QPVASPDDPEFIVKF-DKGYMSK 368

Query: 420 AVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREET 479
           A+YD + Y+E +H+  +     +  DKYDAK +EY++ L  L++QI E+E +M+ ++ +T
Sbjct: 369 ALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDT 428

Query: 480 SEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDD 539
           ++KI +S   L  ++I+ NA+H+N K +I K+TEN K  K+ EK  V+ KQ  VK+E ++
Sbjct: 429 TDKINISAAELSARMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEE 488

Query: 540 LNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQ 599
           L  ++        +  + +  L+ QLD++   I ++N +Q ++Q  ID LE++K+ LV  
Sbjct: 489 LEAQRAEADATNQELLSRIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVAD 548

Query: 600 TEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAIT- 658
                +LH  N+ +LE + NK+YLP+IN +D+QIS LL+ + ++KQE AN+ T+ +A++ 
Sbjct: 549 ATAADELHNSNIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSK 608

Query: 659 ------------KRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHE 706
                        RLE+E R                                     +H+
Sbjct: 609 RLEEENEERKEKLRLEEENR------------------------KRLEAERFQKQRDEHD 644

Query: 707 QQITQVKQTYNDQLTELQDKLATEEKEL-------EAVKRERTRLQAEKAIEEQTRQKNA 759
           Q +  ++Q +  QL E   K A  E  L       E V+RER RLQ EKAI+EQ + K A
Sbjct: 645 QHVLTLQQEHERQLAEASQKAADTELLLQQEREKRELVERERVRLQGEKAIQEQEQAKLA 704

Query: 760 DEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSV----LPKDD------------S 803
           D+AL+ E+  R H +A+ I AAE  +  N +S  N +      PK+D            S
Sbjct: 705 DKALEDEVKERNHNRAQAIDAAEAARARNAKSISNNNAPALSTPKEDEKLNIKDATTDNS 764

Query: 804 LYEYHTEEDVMY 815
           LYEY TE++V Y
Sbjct: 765 LYEYFTEKEVRY 776

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 9/88 (10%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDL 97
           FL+KVV+ E +    + SPFR         ++   +  K ++FPTVSA+S  +     ++
Sbjct: 26  FLRKVVTKE-QEDATYSSPFRTS------QSQVEAQKRKVQRFPTVSASSGGNSS--AEM 76

Query: 98  GYKNIPKNAKRAKDIRFPTYLTQNEERQ 125
           G+K I    KRAKDI  P YL  N+ERQ
Sbjct: 77  GFKVIDAARKRAKDIAVPRYLQGNDERQ 104

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  236 bits (602), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 170/488 (34%), Positives = 269/488 (55%), Gaps = 36/488 (7%)

Query: 359 APKVPFQEPSRKER------------TGIFALWXXXXXXXXXXXXXXXXXN--------- 397
           AP+VPF  PS   +            +G+FAL+                           
Sbjct: 385 APRVPFT-PSGANKAGTAAATSGIAASGLFALFKRSKKPESSTKVAANAAAGTVVPGDDA 443

Query: 398 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKD-KYDAKNKEYKE 456
           PVATPE+PELIV+T+E GY+SK+VYDK+ YDE  HQA LA L +KE+D +Y+ K +EY+E
Sbjct: 444 PVATPEDPELIVRTQE-GYVSKSVYDKLQYDEDQHQAKLA-LYSKEQDERYETKAQEYEE 501

Query: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516
           K+Q +Q +I E++  M+ +R E  EK+++ +    + +++ N +H N K  + K TE +K
Sbjct: 502 KIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINAKGDLYKQTEEIK 561

Query: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576
           NQ + +K +       V+SEID+L   K  V KE  +  + +  L+ +LD +   +N+  
Sbjct: 562 NQTISDKEDKEVAHQTVQSEIDELLLLKDEVAKENQEHESKVEELTAELDNKTSALNESL 621

Query: 577 LKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL 636
            K+ +   EI  LE++K  L  + +E ++LH++NV  +ES++NKEYLP++N+I+ +ISSL
Sbjct: 622 AKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESIDNKEYLPKVNEINTEISSL 681

Query: 637 LNEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXX 696
           L  + +I+QE AN+K + S++T+RLE+ER+ H                            
Sbjct: 682 LASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERERLEKERLEKQRTEYEK 741

Query: 697 XXXXXXXDHEQQITQVKQTYNDQLTELQ-------DKLATEEKELEAVKRERTRLQAEKA 749
                   HE+++  +KQT+++ L E Q        +L  E++  E V+RERTRLQ EKA
Sbjct: 742 QAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQRREQVERERTRLQGEKA 801

Query: 750 IEEQTRQKNADEALKQEILSRQHKQAEGIHAAENHKIPNDRSQKNTSVLPK---DDSLYE 806
           IE Q R    D+ L+ E   +  +QAE   A EN    +++  K  +V P    + SLY+
Sbjct: 802 IEAQQRGNPEDKRLEAEHEEKLRRQAEAASAVENALKSSNKKTK-AAVPPANTTNSSLYD 860

Query: 807 YHTEEDVM 814
           Y T E+V+
Sbjct: 861 YETVEEVI 868

 Score = 36.2 bits (82), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 15/130 (11%)

Query: 2   LFNINRQEDDPFTQLIXXXXXXXXXXXXXXXESPYQFLQKVVSNEPKGKEE-----WVSP 56
           LF   R E DPF  L+                +    L++V + + + +EE     + SP
Sbjct: 6   LFR-KRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDDNEYHSP 64

Query: 57  FRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIP-KNAKRAKDIRFP 115
           FR       +  RA     +  KFPT+S  +   +  P+ +GY  +  K+ K+AKDI  P
Sbjct: 65  FR----TAEETQRAR--QVRQEKFPTLSQGAV--QLDPEQMGYSVVTDKSVKKAKDIIIP 116

Query: 116 TYLTQNEERQ 125
           + L   E  Q
Sbjct: 117 SGLKDTEAEQ 126

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  231 bits (590), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 122/266 (45%), Positives = 181/266 (68%), Gaps = 1/266 (0%)

Query: 403 ENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQ 462
           ENPE +VKTK+ GYL+K +YDKI   ++ H  W+A  +  E+ K+D K  E   K+  L+
Sbjct: 346 ENPEHVVKTKD-GYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 463 NQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQE 522
            QI EI+N M  +R +T  KIEVS+N L +K  ++   H  KK  + KDTE +K+QKL E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 523 KNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKV 582
           K+ VLDKQ  V+ EID+LN EK  V++E   WT ++  LS ++DA++  + ++N+KQ   
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 583 QNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTI 642
           Q EI+ L+++K D++ Q E+N   H +N +V+E  +NK YLP++N++DNQIS LL ++T 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 643 IKQENANEKTQLSAITKRLEDERRAH 668
           I+Q  ANE+T+LSAITK+L+ ER  H
Sbjct: 585 IRQHCANERTELSAITKKLDKERLEH 610

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 51/81 (62%), Gaps = 10/81 (12%)

Query: 49  GKEEWVSPFR--QDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNA 106
           G+ ++VSPFR  Q+ L+ ++         + ++FPT SA SAY   +P++LGYK I    
Sbjct: 36  GERDYVSPFRDEQEVLSAQRR--------RTQRFPTTSAASAYVNARPEELGYKKIGAGE 87

Query: 107 KRAKDIRFPTYLTQNEERQYQ 127
           KRAKDI FP YL + E++Q +
Sbjct: 88  KRAKDISFPVYLEEIEKKQLE 108

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 34/124 (27%)

Query: 719 QLTELQDKLATEEKELEAV--KRERTRLQAEKAIE---EQTRQKNADEALKQEILSRQHK 773
           QLT ++   A E  EL A+  K ++ RL+ E+ ++   E  R+K  D      +L +Q K
Sbjct: 581 QLTTIRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEED------LLGKQRK 634

Query: 774 QAEGI-------HAAENHKIPNDRSQ------------KNTSVLP----KDDSLYEYHTE 810
           + E         H  E  K+  D +Q            K+         KDDSLYEY TE
Sbjct: 635 ELEAKAQEAREKHEQEMQKLKTDYTQLEGKFKREQQQKKDALAFAHEPTKDDSLYEYGTE 694

Query: 811 EDVM 814
           E+++
Sbjct: 695 EEIL 698

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score =  235 bits (600), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 125/342 (36%), Positives = 207/342 (60%)

Query: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456
           NP+ATPENPE++VKT   G+LSKAVYDK+ Y+   H  WL +  + EK +Y+ K  +Y  
Sbjct: 487 NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDN 546

Query: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516
           +L++L+ +++++E SM+ ++++ +E IE+   RL KK ++   ++  KK  I  +T+ ++
Sbjct: 547 RLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQ 606

Query: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576
           +QK +E +E+  +Q  V+ EI  LN EK N+ +EF  WT  L++ S  LDA+++ ++ + 
Sbjct: 607 DQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQ 666

Query: 577 LKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL 636
            K  K Q +ID L  KK  L  +   +K+ H KN + +E   NKEYLP++++ID++IS+L
Sbjct: 667 QKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNL 726

Query: 637 LNEVTIIKQENANEKTQLSAITKRLEDERRAHXXXXXXXXXXXXXXXXXXXXXXXXXXXX 696
           L E+++IKQE+ANEK +L +ITK+LE ER+AH                            
Sbjct: 727 LGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQREEHEA 786

Query: 697 XXXXXXXDHEQQITQVKQTYNDQLTELQDKLATEEKELEAVK 738
                   HE+++ ++KQ Y  +L EL++  + +  E EA K
Sbjct: 787 VAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQTAEAEATK 828

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 49/76 (64%), Gaps = 6/76 (7%)

Query: 52  EWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKD 111
           E+ SPFR       ++N    E  + ++FPTVS  S +SK  PK+LGY+ + + ++RAKD
Sbjct: 68  EFASPFR------LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121

Query: 112 IRFPTYLTQNEERQYQ 127
           I+FP YL +NE RQ Q
Sbjct: 122 IQFPIYLRENEARQDQ 137

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  214 bits (544), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 198/311 (63%), Gaps = 6/311 (1%)

Query: 359 APKVPFQEPS-RKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYL 417
           AP +    P  +   TGI A++                 NP+++PENPE ++KTK+HGYL
Sbjct: 320 APMLHMGPPQPQSSSTGIMAIFKGNSSSNIQPVSK----NPMSSPENPEYVIKTKQHGYL 375

Query: 418 SKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMRE 477
           SKAVYDK+ YD+ +HQ WL +L   E++KY  K  EY++ L D+Q++ID I + M  ++ 
Sbjct: 376 SKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKL 435

Query: 478 ETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEI 537
           +TS+KIEV + +LVK I+D+   HN+ K  I K+TE MK +KL  K + + KQ  ++ EI
Sbjct: 436 KTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEI 495

Query: 538 DDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLV 597
           ++L+ E+T V  +FN+W + L+ ++ QLDA+I  I   N ++  ++ E+  L   K +L 
Sbjct: 496 ENLSEEQTGVTDDFNEWNSKLNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELE 555

Query: 598 TQTEENKKLHEKNVQVLESVE-NKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSA 656
            + ++N+++H+ N ++L  +   K YLP+IN+IDN+I+  L +++ IK+E   E  +L+ 
Sbjct: 556 EEIKKNEEIHKNNTELLTDLNVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTI 615

Query: 657 ITKRLEDERRA 667
           +TK+LEDER A
Sbjct: 616 LTKKLEDERIA 626

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 43/90 (47%), Positives = 57/90 (63%), Gaps = 5/90 (5%)

Query: 36  YQFLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPK 95
           +  L+KVVS +     E+VSPFR  +     N   Y +  K  +FPTVSA+S +S+  P 
Sbjct: 23  HSMLKKVVSRDHNV--EYVSPFRDPSNVQAAN---YAKAKKMERFPTVSASSHFSRMSPN 77

Query: 96  DLGYKNIPKNAKRAKDIRFPTYLTQNEERQ 125
           +LGYKNI K+ KRAKDI FP++L  NE RQ
Sbjct: 78  ELGYKNISKSTKRAKDISFPSFLIANERRQ 107

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  205 bits (521), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 187/273 (68%), Gaps = 5/273 (1%)

Query: 399 VATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKL 458
           VA+PENPE +V+T E+  +SKAVYD++NY++K+H  WL +  A E +KY+ K +EY++KL
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 459 QDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQ 518
            +LQ Q+D+IE   K    +  +KIE+ + +LVK ++DV +++N  K  ++K+TE MK Q
Sbjct: 375 VELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETELMKLQ 434

Query: 519 KLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLK 578
           K+  K ++L KQ +VK+EI+ LNNEK  +  E+N W  NL NL+  LD +I KI  IN  
Sbjct: 435 KINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEAINEN 494

Query: 579 QGKVQNEIDNLEKKKEDL---VTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISS 635
             ++Q +I+ L+ KK +L   +   EE  KL++  +Q L +VE K+YLP++N+ID QI++
Sbjct: 495 NMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKL-NVE-KDYLPRLNEIDEQIAA 552

Query: 636 LLNEVTIIKQENANEKTQLSAITKRLEDERRAH 668
             +++ IIK E  +E  QLS +TK+LE+ER AH
Sbjct: 553 KFDKLAIIKNETISENNQLSILTKKLEEERIAH 585

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 41/90 (45%), Positives = 57/90 (63%), Gaps = 4/90 (4%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDL 97
           FL + +S + +  E ++SPFR      R N   Y +  K +KFPT SATS ++K  P ++
Sbjct: 23  FLTRHISRKSENTE-YISPFRNPQDTVRSN---YAKSLKEKKFPTTSATSNFNKMVPGEM 78

Query: 98  GYKNIPKNAKRAKDIRFPTYLTQNEERQYQ 127
           GY ++ KN KRAKDI+FP YL  NE+RQ Q
Sbjct: 79  GYSSLAKNDKRAKDIQFPKYLLDNEKRQAQ 108

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  149 bits (377), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 171/271 (63%), Gaps = 2/271 (0%)

Query: 397 NPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKE 456
           NP AT + PEL++K  ++G++S AV++K+ YD+K+H+A +AD + +++ K+  K +EY++
Sbjct: 297 NPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQ 356

Query: 457 KLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMK 516
           KL  + ++   +   M   + +   K EV +N+ +K++ D NA  N+ K+ +L + + +K
Sbjct: 357 KLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVK 416

Query: 517 NQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQIN 576
            QKLQ+   +  K+T ++ E++ L  EK++ +K+++ WTTNL+N++++LDAQ+FK++Q N
Sbjct: 417 LQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476

Query: 577 LKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLP--QINDIDNQIS 634
            KQ K+  +I +L ++K +L  + + N+       + L  +E  ++L   ++  + + I 
Sbjct: 477 HKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHLKSHELVKVTDSIQ 536

Query: 635 SLLNEVTIIKQENANEKTQLSAITKRLEDER 665
             L+ + ++KQE + E+ +L  IT  +E  R
Sbjct: 537 GKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 2/75 (2%)

Query: 51  EEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAK 110
           EE+VSPFR   L      +   +  + +KFPTVSATS Y+    ++LG+  +  + +RA+
Sbjct: 46  EEYVSPFRGGQLTKASKKQLQLQ--RTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRAR 103

Query: 111 DIRFPTYLTQNEERQ 125
           DI FP YL +NE+RQ
Sbjct: 104 DIVFPEYLLENEDRQ 118

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score =  142 bits (358), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 167/296 (56%), Gaps = 14/296 (4%)

Query: 367 PSRKERTGIFALWXXXXXXXXXXXXXXXXXNPVATPENPELIVKTKEHGYLSKAVYDKIN 426
           P +  + GIFALW                    ATPE+PE IV T E GY+SK +YD++ 
Sbjct: 300 PFKFSKKGIFALWKRSEKPEKLN----------ATPEDPEFIVLT-EKGYMSKNIYDRLE 348

Query: 427 YDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVS 486
           Y+E++HQ  LA L      KY+   + Y+EKL  L N+I E+  +M  ++ +T  +++  
Sbjct: 349 YEEELHQEKLASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAI 408

Query: 487 KNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTN 546
           +  L + ++D+ A+H+ +K  +LK+ EN KN K+ EKN + +K T V+ E++ L   +  
Sbjct: 409 EASLSQNLMDIQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELE 468

Query: 547 VQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKL 606
            + E   + + +  L+ +LDA++ ++  ++ +Q +V   +  LE+++  +     E+  +
Sbjct: 469 RKVELQQYQSEVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAV 528

Query: 607 HEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLE 662
              N ++L+++EN    P I  +DNQ+S +   V+ ++QE+A +K +L+ ++ + E
Sbjct: 529 VANNKELLQNLENH---PSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 88/267 (32%), Positives = 158/267 (59%), Gaps = 13/267 (4%)

Query: 398 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEK 457
           PVA+PEN E +VK      +SK VYDKI +D K++  ++   +  + +K +    EY EK
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 458 LQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKN 517
           ++ +Q +  +  N ++ +  E+    EV +N+LVK ++D  A  ++ K+ IL+ T  +K 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 518 QKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 577
           QKL E   +  K+  ++ E + +N EK + +  FN    +L+ + Q+LDA++FK++Q N+
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 578 KQGKVQNEIDNLEKKKEDLVTQTE--ENKKLH-EKNVQVLESVENKEYLPQINDIDNQIS 634
           +   +++EI+ L+ KK+ L+ + +  E KKLH + + + LE          +N++D QI+
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476

Query: 635 SLLNEVTIIKQENANEKTQLSAITKRL 661
           S L+ + +IKQE  NEK ++S +T  L
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (58%), Gaps = 7/95 (7%)

Query: 36  YQFLQKVVSNEPKGKEE---WVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQ 92
           +QFL KV +N+ K  ++   + SPFR +A +  Q  +   +D K  KFP VSATS Y+  
Sbjct: 31  HQFLSKVNTNKSKENDDENKYNSPFRNNAPSREQ--KKQLQDLKTAKFPLVSATSTYN-T 87

Query: 93  QPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQ 127
             KD+ YK++      A+DI+FP+ L  NE RQ Q
Sbjct: 88  DTKDV-YKDLDPKKNFARDIKFPSRLIDNENRQNQ 121

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 144/263 (54%), Gaps = 1/263 (0%)

Query: 398 PVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYKEK 457
           P  TPE PE+++ T   GY+SKAVYD++N +EK H   L +        Y   ++ Y+++
Sbjct: 279 PNGTPEEPEVVLLTN-RGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVSQHYEKE 337

Query: 458 LQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKN 517
           + DL  +I ++   + A++ ET  +I+  +  L K I D+ AE+ +K+ ++ +  E  + 
Sbjct: 338 IADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADKQHVLHEQAEAQRA 397

Query: 518 QKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINL 577
           ++L +K E++ +   ++ EID L   K N   E  +    +  L QQLDAQ  ++  +  
Sbjct: 398 EQLADKEEIVHQNQELQPEIDRLRKLKENTAVEITECQARIDQLQQQLDAQSRELRLVTD 457

Query: 578 KQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSLL 637
           +Q +V   +  L+++K  L  +  ++ +  ++N + LE +   +Y   + +ID + S +L
Sbjct: 458 QQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLNQTDYTATVREIDAKNSEIL 517

Query: 638 NEVTIIKQENANEKTQLSAITKR 660
            E+  I+QE   ++ +L A+ +R
Sbjct: 518 TEIAKIRQEIEFQRKELVALKER 540

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 54/94 (57%), Gaps = 7/94 (7%)

Query: 35  PYQFLQKVVSNEP---KGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSK 91
           P   LQ  +++     KGK+ + SPFR     +  N        KN ++PT+SATS YS 
Sbjct: 36  PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMN---VALKKKNHRYPTISATSPYSN 91

Query: 92  QQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQ 125
             P+DLGYKNI  + KRAKDI FP  L +NE RQ
Sbjct: 92  MTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQ 125

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 109/199 (54%), Gaps = 14/199 (7%)

Query: 397 NPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKE 453
           NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ K+H   +       KD  +  N +
Sbjct: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRV-------KDYINDSNIK 428

Query: 454 YKEKLQDLQNQIDEIENSMKAMREETSE---KIEVSKNRLVKKIIDVNAEHNNKKLMILK 510
           YKEK ++  N I+E++  +K++ ++  +   KI+   N  V+K  D++ E+ ++K++I K
Sbjct: 429 YKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEK-NDIDIENYHEKMLIKK 487

Query: 511 DTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIF 570
           +    KN ++    +       +  +  D   ++++      DW +  S L++Q+D+++ 
Sbjct: 488 NQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVN 547

Query: 571 KINQINLKQGKVQNEIDNL 589
            I Q+N     V+ +I  L
Sbjct: 548 VIKQLNKNLADVKQKITEL 566

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 69/134 (51%), Gaps = 6/134 (4%)

Query: 397 NPVATPENPELIVKTKE----HGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNK 452
           NPVATPE PE +V  K     +   SK ++D I  D   H AWL     K  D+   K +
Sbjct: 120 NPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179

Query: 453 EYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDT 512
           EY ++L  L +QI   + +M  +R +    I++++NRL K  +    +   +K  I K+T
Sbjct: 180 EYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAEKNKIYKET 239

Query: 513 E--NMKNQKLQEKN 524
           E  N   +K Q+KN
Sbjct: 240 ERLNFAIRKHQDKN 253

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 3/51 (5%)

Query: 76  KNRKFPTVSATSAYSKQQPKDLGYKN-IPKNAKRAKDIRFPTYLTQNEERQ 125
           K +  P  +  S+Y+  +P++LGYK   PK  K A++I FP  LT+NE RQ
Sbjct: 9   KRKSSPISNPHSSYNTLKPEELGYKQKFPK--KYAREIHFPAELTENEMRQ 57

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 71/130 (54%), Gaps = 6/130 (4%)

Query: 397 NPVATPENPE-LIVKTKEHG---YLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNK 452
           N +ATP+N E +IV  K+ G   Y SK V+D I Y+ KIH   L  L AK  +++ +K  
Sbjct: 183 NSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGDERHASKIN 242

Query: 453 EYKEKLQDLQNQIDEIEN-SMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKD 511
           EY  ++ +L  +ID IEN  ++ +  + S   + S  +  K  +    E+NN K  +  +
Sbjct: 243 EYDTQVSNLNTKID-IENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNTKTRLYGE 301

Query: 512 TENMKNQKLQ 521
            E +KNQ+ Q
Sbjct: 302 IEAIKNQRNQ 311

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 49/91 (53%), Gaps = 10/91 (10%)

Query: 38  FLQKVVSNEPKGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDL 97
           FL+  ++++ K    + SPFR++   N  N   Y  + KN K+   +  S ++K     +
Sbjct: 28  FLKDTIAHDAK----YQSPFRRNINPNYLN---YIREHKNAKYTITNPNSDFNKLNLNTV 80

Query: 98  GYKNIP---KNAKRAKDIRFPTYLTQNEERQ 125
           GYK IP   K+ K AKDI FP  L +NEE Q
Sbjct: 81  GYKTIPTDRKSRKIAKDIDFPRSLRENEEAQ 111

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 67/119 (56%), Gaps = 8/119 (6%)

Query: 398 PVATPENPELIVKTKEH--GYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYK 455
           P+ATP+NPE++V+  E+    +SK  YD++   +  H AWL    A+    Y+ +++ Y+
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 456 EKLQDLQNQI---DEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILKD 511
           +++  L  +I    E+ N ++A     S   E++KN+ + K   +N     +K++++K+
Sbjct: 240 KQIDVLDEKIRYYQEMSNVLEADYLRVS---EINKNKALVKRFQINKLIGEEKILLMKN 295

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 60/113 (53%), Gaps = 1/113 (0%)

Query: 397 NPVATPENPELIVKTKE-HGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKEYK 455
           NP+AT  NPE+++K  +    ++K  YDK+    + H  W+ +   +  + Y+ K K Y+
Sbjct: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442

Query: 456 EKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMI 508
           EKL  L  QI+     +  ++++T +  E++   L  K   + +  N++K ++
Sbjct: 443 EKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHEKYVL 495

>Suva_4.191 Chr4 (335199..340547) [5349 bp, 1782 aa] {ON} YDL058W
            (REAL)
          Length = 1782

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 87/151 (57%), Gaps = 14/151 (9%)

Query: 419  KAVYDKI-NYDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMRE 477
            K++ D+I +Y EKI++A    L + E+D +++++   KE+L+ +Q    E+E  M  M E
Sbjct: 1432 KSMKDEILSYKEKINEAN-TKLLSTERD-HESRSNSLKEQLEAVQESKAEVERKMNEMEE 1489

Query: 478  ETSE-KIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSE 536
            E++  K E++K++ + + +  + E+N KKL +L ++    ++KL        KQ    S+
Sbjct: 1490 ESAHYKSELNKSKEIVENLKSDIENNEKKLELLVESGKESDEKL--------KQYTKNSQ 1541

Query: 537  ID--DLNNEKTNVQKEFNDWTTNLSNLSQQL 565
            ID  +L NEKT+++ +  ++   +  L  +L
Sbjct: 1542 IDIKELQNEKTDLESQIIEFKKKIEELHGKL 1572

>ZYRO0B06182g Chr2 complement(496610..499180) [2571 bp, 856 aa] {ON}
           some similarities with uniprot|Q12411 Saccharomyces
           cerevisiae YOL091W SPO21 Component of the meiotic outer
           plaque of the spindle pole body involved in modifying
           the meiotic outer plaque that is required prior to
           prospore membrane formation
          Length = 856

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 108/236 (45%), Gaps = 39/236 (16%)

Query: 433 QAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVK 492
           Q+   +LR + +DK D +N + K +L+ L+++   +E   +++ EE              
Sbjct: 406 QSSFGNLRKEVEDK-DRENVKLKTELELLKDKYSHLEKDFESLSEEA------------- 451

Query: 493 KIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFN 552
           +I+     H+ K     KD E   N++ QE+   L K+  +K+             KEF+
Sbjct: 452 EILTDEVAHSKKDFFAAKDCERTVNERTQEQVNTLKKELEIKT-------------KEFD 498

Query: 553 DWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQ 612
           +   +L     + D+       +  KQ  +QN++D LE   + +  + + +KK ++    
Sbjct: 499 ETLADLQRERAKQDSSQANQETLQSKQDSLQNKLDCLEADNKTINCEFQSSKKEYD---- 554

Query: 613 VLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAH 668
           ++++        + + +++Q  +L +E   I+ ++ + +T   ++ ++ E  R AH
Sbjct: 555 IMKA--------KYDFVESQYQTLRSECDAIRAKHESMQTNHHSMEEQYESLRAAH 602

>KNAG0F00130 Chr6 complement(7147..8238) [1092 bp, 363 aa] {ON}
           Anc_1.19 YDR532C
          Length = 363

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 52/91 (57%), Gaps = 7/91 (7%)

Query: 502 NNKKLMILKDTENMKNQKLQEKNEVLD--KQTNVKSEIDDLNNEKTNVQKEFNDWTTNLS 559
           N+K+++ LK   +MK + L+ + ++L+  +    +SE+D L +  TN+ K  ++   ++ 
Sbjct: 108 NDKEVLGLKSIHDMKYESLKNQIKILEGERLAETRSEVDALRSSITNLSKTISNSERDIL 167

Query: 560 NLSQQLDAQIFKINQI-----NLKQGKVQNE 585
           ++S+Q  AQI    ++      LK+ K++ E
Sbjct: 168 SISKQTSAQIDSCFELLKERDTLKRMKIETE 198

>Ecym_2146 Chr2 complement(272237..277102) [4866 bp, 1621 aa] {ON}
            similar to Ashbya gossypii AFL150C
          Length = 1621

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 92/198 (46%), Gaps = 14/198 (7%)

Query: 451  NKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNKKLMILK 510
            N +Y E + ++    + + N++  M +    +I+    +  + + D +    +    I K
Sbjct: 1099 NSKYVENMTNIWKSTESVRNALTLMIDSIPMEIKYLCTKAYRVVADRSTNFYDPLRAIAK 1158

Query: 511  D-TENMKNQKLQEKNE--VLDKQTNVKSEIDDLNNEKTNV--QKEFNDWTTNLSNLSQQL 565
               EN  N     +++  + DK +++ +++  L N  T +   KEFN + T L++  +++
Sbjct: 1159 VLIENYVNIFFANRSQYGIHDKSSDIDNKVQVLCNALTTIFNLKEFNGYYTPLTSYVEEV 1218

Query: 566  DAQIFKINQINLKQGKVQNEIDNL---EKKKEDLVTQTEENKKLHEKNVQVLESVENKEY 622
            +  I  + +  L   + +NE D++   +    D  T T +++ L +  +Q+   + +K  
Sbjct: 1219 EPAIVNLLKNMLISPQFENECDSVIYRDMGSTDRPTLTMKHQYL-DSMIQIF--IAHKSV 1275

Query: 623  LPQ---INDIDNQISSLL 637
            LP    I D+  Q+ S+ 
Sbjct: 1276 LPHDDAIVDLLKQMESIF 1293

>KLLA0E14851g Chr5 complement(1328372..1330381) [2010 bp, 669 aa]
           {ON} similar to uniprot|P33891 Saccharomyces cerevisiae
           YGL145W TIP20 transport protein that interacts with
           Sec20p required for protein transport from the
           endoplasmic reticulum to the golgi apparatus
          Length = 669

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 77/142 (54%), Gaps = 16/142 (11%)

Query: 523 KNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKV 582
           ++E+ ++   +K E DD  N+   ++K  +D T  +S++S      I  I  + LK G++
Sbjct: 22  RDELAERLKQLKDEEDDFINQMDLIEKRLDDATAEISSISN-----IAHIEPLRLKYGRL 76

Query: 583 Q--NEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVENKEYLPQINDIDNQISSL-LNE 639
           Q  ++I+NL ++KE    +TE  +++ + + + L+SV+    L  ++ +  +I SL +  
Sbjct: 77  QVLDQIENLFRQKEVFRHETEVIEEIEKVSTEQLQSVD----LEHLSTLKQRIVSLGIES 132

Query: 640 VTIIKQENANEKTQLSAITKRL 661
           + +I + N+     L AI K L
Sbjct: 133 MEVITRFNS----LLEAIAKEL 150

>KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7.488
           YBL047C
          Length = 1264

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 66/145 (45%), Gaps = 23/145 (15%)

Query: 545 TNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENK 604
           +    + ++ TT+L+NLS Q+++   +    N K+ +   E+  + + K+ + T+    +
Sbjct: 533 STASAQLSNATTDLANLSNQVNSLTTQATATNTKKARATQELQRVNEMKQSIQTKLATLR 592

Query: 605 KLHEKNVQVLES------VENKE-----------------YLPQINDIDNQISSLLNEVT 641
             H+ NV+  E       V NKE                    QIND++ Q++    E  
Sbjct: 593 STHDANVKQTEQLQSQLVVANKETETLQGELNVVEANFNAMQGQINDLNGQLTQAQTENQ 652

Query: 642 IIKQENANEKTQLSAITKRLEDERR 666
            +K+   N   Q +A+  +LE++++
Sbjct: 653 TLKERINNFNAQAAALQTQLEEKQQ 677

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 21/107 (19%)

Query: 532 NVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEK 591
           N KS+IDDL+  + + +  FN  T N+   S+ L     K+N +  +   +         
Sbjct: 339 NCKSDIDDLSRRRYSAKTSFNSSTENIQKTSKYLSECESKVNFLTTRNKSL--------- 389

Query: 592 KKEDLVTQTEENKKLHEKNVQVLESVENKEYLP---QINDIDNQISS 635
            KED+        K++E+ ++ LE   NK  LP   +I+++D  +S+
Sbjct: 390 -KEDI--------KVNEEKIKALEEERNKVVLPDPEKIHEVDENLST 427

>Ecym_2478 Chr2 (933106..935991) [2886 bp, 961 aa] {ON} similar to
           Ashbya gossypii ACL132C
          Length = 961

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 48/92 (52%), Gaps = 3/92 (3%)

Query: 499 AEHNNKKLMILKDTENMKNQKLQ---EKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWT 555
           A H      +L + E+++  K +   E+ E++ K TN +++   LN+E   +Q + ND  
Sbjct: 709 ATHTVIPPAVLSELEDLRAHKSKWNKERQELMAKLTNFQTQTSQLNSENQTIQDQLNDVQ 768

Query: 556 TNLSNLSQQLDAQIFKINQINLKQGKVQNEID 587
             L+  +  L ++  +I ++  +   +++E+D
Sbjct: 769 IALNEKTMALRSKDLQITKLKNRLATLESELD 800

>AGL058C Chr7 complement(599289..602198) [2910 bp, 969 aa] {ON}
           NOHBY706; No homolog in Saccharomyces cerevisiae
          Length = 969

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 64/137 (46%), Gaps = 27/137 (19%)

Query: 504 KKLMILKDTENMKN------QKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTN 557
           K+L I KD+  ++       Q ++EKNE + +   +K    DL  +K  +QKE      +
Sbjct: 514 KELNIYKDSPYLEKECQRLVQTIEEKNETVAQLMKIKENYRDLLVKKAAMQKELGVLRDH 573

Query: 558 LSNLSQQLDA-------QIFKINQINLKQGK----------VQNEIDNLEKKKED----L 596
              L +Q+ +       Q+ +++++ LKQ +           Q EI +LE + E+    L
Sbjct: 574 AEELERQMSSMEDAHRKQVRELSKLPLKQRRKTLGFFNEKLYQEEIHSLELQLEEAHDKL 633

Query: 597 VTQTEENKKLHEKNVQV 613
           +   EE  +LHEK   +
Sbjct: 634 LISAEEISELHEKIAHI 650

>KLLA0F13442g Chr6 complement(1244416..1246179) [1764 bp, 587 aa]
           {ON} similar to uniprot|P39081 Saccharomyces cerevisiae
           YDR228C PCF11 mRNA 3' end processing factor essential
           component of cleavage and polyadenylation factor IA (CF
           IA) involved in pre-mRNA 3' end processing and in
           transcription termination binds C-terminal domain of
           largest subunit of RNA pol II (Rpo21p)
          Length = 587

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%)

Query: 725 DKLATEEKELEAVKRERTRLQAEKAIEEQTRQKNADEALKQEILSRQHKQAEGIHAAEN 783
           DKLA   +       +  +LQA+ AI +Q RQ+   E L  E LS+ H+Q + I A E+
Sbjct: 176 DKLALITQSKLVSTPDDAKLQAKVAILKQLRQELQKERLAPEFLSQVHQQLKQIFAQEH 234

>YMR183C Chr13 complement(626921..627808) [888 bp, 295 aa] {ON}
           SSO2Plasma membrane t-SNARE involved in fusion of
           secretory vesicles at the plasma membrane; syntaxin
           homolog that is functionally redundant with Sso1p
          Length = 295

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 49/89 (55%), Gaps = 7/89 (7%)

Query: 547 VQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKL 606
           +Q++ N+  T  S+ S    A + KIN IN    + +N I+ ++ + +DL+TQ  E    
Sbjct: 19  MQEDLNNAPTGHSDGSDDFVAFMNKINSINANLSRYENIINQIDAQHKDLLTQVSE---- 74

Query: 607 HEKNVQVLESVENKEYLPQINDIDNQISS 635
            E+ +++  S++  +Y+ Q  D+  Q+ +
Sbjct: 75  -EQEMELRRSLD--DYISQATDLQYQLKA 100

>KNAG0F01700 Chr6 complement(311082..311657) [576 bp, 191 aa] {ON}
           Anc_6.263 YMR184W
          Length = 191

 Score = 31.2 bits (69), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 408 IVKTKEHGYLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNK 452
           I+  KE+G+ S+ VY K +  EKI +    D    EK+ Y  KNK
Sbjct: 86  IITAKEYGFTSEEVYTKDDILEKIREFCQMDTSLSEKEFYFYKNK 130

>TDEL0F04750 Chr6 complement(893402..895519) [2118 bp, 705 aa] {ON}
           Anc_8.351 YDR164C
          Length = 705

 Score = 31.6 bits (70), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 480 SEKIEVSKNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDD 539
           S+ IE+ + +L+  I D+  EHN K L+I    EN+ N    E  ++L   T V    D 
Sbjct: 2   SDLIELQREQLLGVINDIKTEHNVKFLVIDDYFENLLNYLFDEPQQLLRHVTAV----DR 57

Query: 540 LNNEKTNVQ 548
           +++ K N Q
Sbjct: 58  IDSPKRNGQ 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.304    0.123    0.326 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,508,527
Number of extensions: 2950548
Number of successful extensions: 28742
Number of sequences better than 10.0: 2441
Number of HSP's gapped: 27030
Number of HSP's successfully gapped: 4170
Length of query: 816
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 698
Effective length of database: 39,950,811
Effective search space: 27885666078
Effective search space used: 27885666078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 70 (31.6 bits)