Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR129W (SYF2)3.490ON21521510281e-143
Smik_6.2253.490ON2131957348e-99
Skud_7.4403.490ON2131946704e-89
Suva_7.4173.490ON2121956435e-85
TDEL0D055803.490ON1931952802e-30
ZYRO0D10032g3.490ON2091952585e-27
NCAS0E008203.490ON2021962298e-23
Kpol_480.153.490ON2071912168e-21
NDAI0G009503.490ON2131992081e-19
SAKL0F02816g3.490ON1921961982e-18
Kwal_55.212263.490ON1962051871e-16
Ecym_12393.490ON1931941861e-16
KLLA0E04643g3.490ON2211821722e-14
KLTH0F14784g3.490ON1951981703e-14
CAGL0I10538g3.490ON2001891703e-14
TBLA0C044703.490ON2221931705e-14
AFR308W3.490ON1921941572e-12
KNAG0B008203.490ON2071741062e-05
TPHA0D042403.490ON209202790.081
NDAI0E026808.568ON48356750.35
TBLA0G031203.284ON673129701.5
KNAG0H031608.274ON53981682.4
KLTH0G07238g5.264ON70785673.3
Kpol_505.52.177ON687165649.6
NOTE: 1 genes in the same pillar as YGR129W were not hit in these BLAST results
LIST: KAFR0C01950

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR129W
         (215 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...   400   e-143
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...   287   8e-99
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   262   4e-89
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...   252   5e-85
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   112   2e-30
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   103   5e-27
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    93   8e-23
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    88   8e-21
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    85   1e-19
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    81   2e-18
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    77   1e-16
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    76   1e-16
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    71   2e-14
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    70   3e-14
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    70   3e-14
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    70   5e-14
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    65   2e-12
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    45   2e-05
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    35   0.081
NDAI0E02680 Chr5 (557376..558827) [1452 bp, 483 aa] {ON} Anc_8.568     33   0.35 
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}               32   1.5  
KNAG0H03160 Chr8 (593242..594861) [1620 bp, 539 aa] {ON} Anc_8.2...    31   2.4  
KLTH0G07238g Chr7 complement(582101..584224) [2124 bp, 707 aa] {...    30   3.3  
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    29   9.6  

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score =  400 bits (1028), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 199/215 (92%), Positives = 199/215 (92%)

Query: 1   MDFYXXXXXXXXXXXXXXXXSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60
           MDFY                SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 61  SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120
           SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS
Sbjct: 61  SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120

Query: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARK 180
           KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARK
Sbjct: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARK 180

Query: 181 RQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE 215
           RQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE
Sbjct: 181 RQMQNAKTLYGVESFINDKNKQFNEKLSRESKGSE 215

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  287 bits (734), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (85%), Gaps = 2/195 (1%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           SIK+RKLADREIQE + NRKPRVY+MED+ND DESVG TES +K++AFHYT QEY AWE+
Sbjct: 21  SIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTESSDKDRAFHYTAQEYIAWEQ 80

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           RH Q K GQS+R GISYDQLAKLSYEKTLRNLA  TQ+ S+ D+  +E+D+KN+ K  RI
Sbjct: 81  RHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLA--TQDLSEYDNFVNEKDHKNISKISRI 138

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKN 200
            ++QKDTKTGKI IADD KLVNKLAVSL+SESKKRYEARKRQM++A    GVESFINDKN
Sbjct: 139 DRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQMESAVIPSGVESFINDKN 198

Query: 201 KQFNEKLSRESKGSE 215
           KQFNEKLSRES+ SE
Sbjct: 199 KQFNEKLSRESRNSE 213

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  262 bits (670), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 133/194 (68%), Positives = 158/194 (81%), Gaps = 2/194 (1%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           SIK+RKLADREIQE   NRKP+VYSMEDVND  E V D E+ +K+KAFHYTVQEY+AW++
Sbjct: 21  SIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAETSDKDKAFHYTVQEYNAWKQ 80

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           +  Q K GQ QR G SYDQ+AKLSYEKTLRNL   TQNS+K ++S ++ D+ + PK G I
Sbjct: 81  KQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNLV--TQNSNKNENSVNKNDSNSSPKNGAI 138

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKN 200
            K+Q++ KTGKI I DDDKLVNKLA +L+SESKKRYEAR++QM+NAKT   VESFINDKN
Sbjct: 139 HKIQRNIKTGKIEIVDDDKLVNKLAFTLESESKKRYEARRKQMENAKTPSSVESFINDKN 198

Query: 201 KQFNEKLSRESKGS 214
           KQFNEKLSRE K S
Sbjct: 199 KQFNEKLSREPKDS 212

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score =  252 bits (643), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 162/195 (83%), Gaps = 3/195 (1%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           S+K+RKLADREIQE S+NRKPRVYSMED +D DE V +T+S +K++AFHYTVQEY+AWE+
Sbjct: 21  SLKTRKLADREIQEASSNRKPRVYSMEDASD-DELVRETKSDDKDRAFHYTVQEYNAWEQ 79

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           +  Q K+G++Q  G SYDQLAKLSY+KTLRNL TQ  N  K +SS +E+D+K    K RI
Sbjct: 80  KQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQ--NYGKHESSVNEKDSKGSLGKSRI 137

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKN 200
            K+QK++ TGKI I DDD+LVNKLA +L+S+SKKR++ARKRQM+N KT  GVESFINDKN
Sbjct: 138 EKIQKNSITGKIRIVDDDELVNKLASTLESDSKKRHDARKRQMENVKTPSGVESFINDKN 197

Query: 201 KQFNEKLSRESKGSE 215
           KQFNEKL RES+GSE
Sbjct: 198 KQFNEKLGRESRGSE 212

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  112 bits (280), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 113/195 (57%), Gaps = 23/195 (11%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           +I+ RK+A+RE ++ S   KP++YSMED N+      D+    + K  +Y+++EY+ W++
Sbjct: 21  AIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSSERRRLKLMNYSMREYEEWDK 80

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           +    K  + +RGG +  +LAK SYEK L        + SKQ++              R+
Sbjct: 81  KQ---KGKEVKRGGANVQELAKYSYEKDL--------SRSKQNNG------------NRV 117

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKN 200
            K+  D KT ++ + DD+KLVNKLA  L+  +++R+ ARK+ M+ A        +IN+KN
Sbjct: 118 VKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADARATPGGYINEKN 177

Query: 201 KQFNEKLSRESKGSE 215
           KQFN KL R+ K +E
Sbjct: 178 KQFNLKLDRQMKETE 192

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  103 bits (258), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 110/195 (56%), Gaps = 26/195 (13%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           S+++RKL + E +E++A RKPRVY +E     + S+   +     +  +YT+Q+Y+ W  
Sbjct: 31  SVENRKLVNAESKELAAGRKPRVYQLEA---PEPSLPTQDDKHGNQLMNYTIQQYEEWNS 87

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           R  + +T +   G +    +AK +Y+K L  L   T   ++  +             G I
Sbjct: 88  RQ-RDQTNKRDSGNLQ--DMAKYTYDKELNKLHKDTMLQNRYTNG------------GSI 132

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQM-----QNAKTLYGVESF 195
            K+ ++ KTGK+TI DDD+LV KLA  +   + +RYEAR+R+M     QNA +  G   +
Sbjct: 133 QKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNVQNASSGGG---Y 189

Query: 196 INDKNKQFNEKLSRE 210
           IN+KNKQFNEKL R+
Sbjct: 190 INEKNKQFNEKLDRQ 204

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 92.8 bits (229), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 106/196 (54%), Gaps = 19/196 (9%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEK-EKAFHYTVQEYDAWE 79
           +I++R L DRE +++ ++ KPRVY+M+D  D      + ++ +K  K  +YT+++Y+ WE
Sbjct: 22  TIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEEDADDKVAKLMNYTLRQYEEWE 81

Query: 80  RRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGR 139
           ++    K            QLA  SY+K + NL     N  + D +  E          R
Sbjct: 82  KKQKDKKIKDDSS---DMKQLAMFSYDKGVSNL-----NRFRTDKTTTE----------R 123

Query: 140 IGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDK 199
             ++Q ++KTGK+ I D+ KLVN LA +L   + KRY   K+++         E +IN++
Sbjct: 124 EVQIQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARSKDSSAEGYINER 183

Query: 200 NKQFNEKLSRESKGSE 215
           NK FNEKL RES+  E
Sbjct: 184 NKHFNEKLDRESRYGE 199

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 87.8 bits (216), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 107/191 (56%), Gaps = 18/191 (9%)

Query: 22  IKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWERR 81
           I++RKL D   +E+  N KP+ YSME++ + D++V      E ++  +Y+++EY+ WE++
Sbjct: 24  IENRKLLDANTRELKKNSKPKTYSMEELAE-DDTVNTGTVDEADRLLNYSIREYEEWEKK 82

Query: 82  HPQGK--TGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGR 139
             + K     ++    S  Q+AK +Y+        Q +   KQ S+ D         +G+
Sbjct: 83  QGRHKENVHVTKSSVNSTAQIAKFTYD-------KQIKKLQKQKSTND--------NRGK 127

Query: 140 IGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDK 199
           I K++KD KTGKI + D  +L+ +LA  L   +K+RY+   ++ Q         S+IN+K
Sbjct: 128 ISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQNENYSYINEK 187

Query: 200 NKQFNEKLSRE 210
           NK+FN+KL R+
Sbjct: 188 NKEFNDKLERQ 198

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 84.7 bits (208), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 114/199 (57%), Gaps = 29/199 (14%)

Query: 24  SRKLADREIQEVSANRKPRVYSMEDVNDAD------ESVGDTESPEKEKAF---HYTVQE 74
           +RK AD+E++E S + KP+VY ++ V D D      + +GD  + E+++ F   +YT++E
Sbjct: 27  NRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIRE 86

Query: 75  YDAWERRHPQGKTGQSQR-GGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKN 133
           Y+ W++   Q K  Q +R  G    +LA  +YEK L  L ++ +N S +           
Sbjct: 87  YEEWDK---QQKDKQRKRVDGSDLTELATFTYEKELSKLNSKLENISHE----------- 132

Query: 134 VPKKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVE 193
             +K +IG    +T+ GK+ + D+++L+N L  +L   +KKRY  RK+++Q+  +     
Sbjct: 133 --QKHQIGV---NTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSDIAG 187

Query: 194 SFINDKNKQFNEKLSRESK 212
           ++  DKNKQFNEKL RE K
Sbjct: 188 NYFKDKNKQFNEKLERELK 206

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 80.9 bits (198), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/196 (34%), Positives = 111/196 (56%), Gaps = 33/196 (16%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGD-TESPEKEKAFHYTVQEYDAWE 79
           S+K+RK A++E ++   + KP+VYSM    + DE+  D  E   + K  +Y++++Y+ W+
Sbjct: 21  SVKNRKEAEKEEKQAKQSGKPKVYSM----NEDETFKDQKEEDTRGKLLNYSIKDYEKWQ 76

Query: 80  -RRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKG 138
            +R  + K       G S   LAK +Y+K +R +        ++D S +         +G
Sbjct: 77  LKRTAKLKNSD----GSSQQDLAKYTYDKEIREM--------EKDGSLN---------RG 115

Query: 139 RIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQ--NAKTLYGVESFI 196
           ++ K + + K G+I I DD K + +LA +L   +K+RY  RK+Q +  ++ T  G   FI
Sbjct: 116 KVTKARLNGK-GRIQINDDKKSLEQLADNLNKSTKRRYIERKKQAEKLDSSTTGG---FI 171

Query: 197 NDKNKQFNEKLSRESK 212
           NDKNKQFNEKLSR+ K
Sbjct: 172 NDKNKQFNEKLSRQFK 187

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/205 (34%), Positives = 103/205 (50%), Gaps = 42/205 (20%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWER 80
           S+K++    RE + VSA+RKP VYSM +   A+E +   +  E  K   Y++ EY+ W+ 
Sbjct: 21  SVKNKNEVIREEKMVSASRKPAVYSM-NAEGAEEEIA-KDVTEANKLLKYSMLEYEQWQD 78

Query: 81  RHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRI 140
           +    K      GG S+  LAK +Y+K ++ L       SK D +               
Sbjct: 79  KVK--KNSHRLEGGASFQDLAKSTYDKEVQQL-------SKIDGN--------------- 114

Query: 141 GKVQKDTK-----TGKITIADDDKLVNKLAVSLQSESKKRYEAR-----KRQMQNAKTLY 190
            +V K+TK      GKI + DD +LV  L  +L   + +RY AR      RQM N  T  
Sbjct: 115 -RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERY-ARIQKKIGRQMNN--TTS 170

Query: 191 GVESFINDKNKQFNEKLSRESKGSE 215
           G   +IN+KNKQFN+KL R++K  E
Sbjct: 171 G--GYINEKNKQFNDKLERQTKKRE 193

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 76.3 bits (186), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 100/194 (51%), Gaps = 27/194 (13%)

Query: 21  SIKSRK-LADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWE 79
           SIK+RK +   E+ +V  + KP VYS+ D   A   V  T + E+ K  +Y++ +Y+ W+
Sbjct: 21  SIKNRKEIVSEEVLQVGRS-KPEVYSINDEGAAVNEVQSTSNTERRKLLNYSLIDYEKWD 79

Query: 80  RRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGR 139
            +  Q     +  G I+Y      +Y+  ++ L        K               KGR
Sbjct: 80  EKEKQANFDGTYSGDIAYS-----TYKNEIKQLRKGGLTKGK-------------ITKGR 121

Query: 140 IGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKT-LYGVESFIND 198
           I      +++GK+ I D+ +LVNKLA +L+  S++R+   K+++   K     + +F+N+
Sbjct: 122 I------SESGKVAIEDEKELVNKLAQTLEKTSRERFLREKKRLDGHKANTSELGNFVNE 175

Query: 199 KNKQFNEKLSRESK 212
           KN+ FNEKLSR+ K
Sbjct: 176 KNRHFNEKLSRQFK 189

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 89/182 (48%), Gaps = 26/182 (14%)

Query: 32  IQEVSANRKPRVYSMEDVNDADESVGDTESPEKE-KAFHYTVQEYDAWERRHPQGKTGQS 90
           I E   N + RVYSM D +  D++  +   PE   K  +Y+++EY+ WE +    +  +S
Sbjct: 65  IAEEKKNSERRVYSMAD-DGEDKARSNKSEPEDPIKLANYSIREYEKWEAKTQNSRHNKS 123

Query: 91  QRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTG 150
             G   +  +AK SY+K +  L     +                P KG I      T+ G
Sbjct: 124 VMG--DFQTIAKNSYKKEVDALPKDISH----------------PLKGGI------TEDG 159

Query: 151 KITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFINDKNKQFNEKLSRE 210
           K+ + D+ +LV K+   L   SKKRY  RK+++     +   + FINDKNK+FN KL+ E
Sbjct: 160 KVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNKINLDDGFINDKNKRFNAKLNSE 219

Query: 211 SK 212
            K
Sbjct: 220 FK 221

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 98/198 (49%), Gaps = 28/198 (14%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAW-- 78
           S+K+++   +E ++ SA  KP VYSM+   +   S   TE  ++ K   Y++++++ W  
Sbjct: 21  SVKNKQQILQEEKQTSARAKPAVYSMK--TEEAPSSETTEESKEAKLLQYSMKDFEQWQD 78

Query: 79  -ERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137
            ERR  Q  +  ++     Y  LAK +Y+K ++ L     N  ++            PKK
Sbjct: 79  KERRKSQKSSDVAK-----YQDLAKFTYDKEVQQLRKNYTNKVEK------------PKK 121

Query: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIN 197
             I K       GKI + DD  LV  LA SL   + +RY   ++++           FIN
Sbjct: 122 VSINK------KGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMVSDTPGGFIN 175

Query: 198 DKNKQFNEKLSRESKGSE 215
           +KNKQFN+K+ R++K  E
Sbjct: 176 EKNKQFNDKIERQTKKRE 193

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 100/189 (52%), Gaps = 21/189 (11%)

Query: 22  IKSRKLADREIQEVSANRKPRVYSM-EDVNDADES-VGDTESPEKEKAFHYTVQEYDAWE 79
           I++R L  +E +E     KPRVYSM +D +D+DE    D +S  +   F YTVQ++  WE
Sbjct: 22  IRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQSDMRTNLFQYTVQDFIDWE 81

Query: 80  RRHPQGKTGQSQRG-GISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKG 138
           +R  + K  + +   G+    LAK +Y+K L+NL         +++            + 
Sbjct: 82  KRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRPEFKMKAKET------------QF 129

Query: 139 RIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAKTLYGVESFIND 198
           RI K      +GK+ I D+ +LV +L+ +L+  +K+RY++  R++ N K    +   IN 
Sbjct: 130 RINK-----DSGKVNIKDNKELVQRLSQNLKETAKQRYDSN-RKIANDKEHTSLSGSINA 183

Query: 199 KNKQFNEKL 207
           KN QFN+ L
Sbjct: 184 KNLQFNKSL 192

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 70.1 bits (170), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 65/193 (33%), Positives = 100/193 (51%), Gaps = 32/193 (16%)

Query: 36  SANRKPRVYSMEDVNDADESVGDTESPEKE--------KAFHYTVQEYDAWERRHPQGKT 87
           + N KP+VYSM D  D DE   + E+  K         K  +YT++EY  WE +  +  T
Sbjct: 37  ATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEY-T 95

Query: 88  GQSQRGGI-----SYDQLAKLSYEKTLRNL--ATQTQNSSKQDSSADEEDNKNVPKKGRI 140
            +SQ         S D LAK +Y+K +R L  A +  NS  + +           K G+I
Sbjct: 96  TESQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSN-----------KPGKI 144

Query: 141 GKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQN-AKTLYGVESFINDK 199
            K  ++ ++ KI I DD  LV +L  +L+++S + Y+    + +N + TL G    +N K
Sbjct: 145 IKNHRN-ESNKIVIKDDKFLVEELVNNLKTKSDRLYKHLGERRKNYSTTLSG---HVNTK 200

Query: 200 NKQFNEKLSRESK 212
           N++FNEKL+RE K
Sbjct: 201 NQEFNEKLTREWK 213

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 65.1 bits (157), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 94/194 (48%), Gaps = 32/194 (16%)

Query: 21  SIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAW-- 78
           SI++RK A  E +   A  KPRVYSM +    +    DT+S E+ K  +Y + +Y+ W  
Sbjct: 21  SIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQS-EQLKLLNYRIADYEKWDE 79

Query: 79  -ERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKK 137
            ++RH Q   G          +LA  +Y   L  L  +     +  +             
Sbjct: 80  KQKRHKQPSDG------ADLGELANSTYRSELHQLHRRGVVKGRATN------------- 120

Query: 138 GRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNAK-TLYGVESFI 196
           GRI      + +GK+ + D+ +LV KLA ++Q  +K+R+E  +RQ + AK         +
Sbjct: 121 GRI------SASGKVVLDDEPELVEKLAAAVQQTAKRRHE--ERQKKAAKDGGRATAGSL 172

Query: 197 NDKNKQFNEKLSRE 210
           NDKN+ FNEKL RE
Sbjct: 173 NDKNRHFNEKLDRE 186

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 76/174 (43%), Gaps = 42/174 (24%)

Query: 40  KPRVYSMEDVNDADESVGDTESPEKE--KAFHYTVQEYDAWERRHPQGKTGQSQRGGISY 97
           KP+VYS++    + + +   E  +    K  +  +++ +A E R  +G+ G      +  
Sbjct: 67  KPKVYSLQAAEPSVDGIDGAEVVDNVTVKLLNTPLRQLEAREAR--RGENGDDAVARVEG 124

Query: 98  DQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADD 157
           D++AK +Y+K L  L  ++   + +D+                                 
Sbjct: 125 DRVAKDTYKKELALLGRKSTRGTYRDN--------------------------------- 151

Query: 158 DKLVNKLAVSLQSESKKRYEARKRQM--QNAKTLYGVESFINDKNKQFNEKLSR 209
              V +L   L   SKKRY  RK +M  Q A+    ++ +IN+KNKQFN+KL R
Sbjct: 152 ---VERLVTHLNDVSKKRYLVRKNKMKRQGARGGSSLDGYINEKNKQFNKKLQR 202

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 35.0 bits (79), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 88/202 (43%), Gaps = 32/202 (15%)

Query: 22  IKSRKLADREIQEVSANRKPRVYS--MEDVNDADESVGDTESPEKEKAFHYTVQEYDAWE 79
           I+ RK  + + +E  +  KP+VYS  M+D  D D       +  +     YT+++Y+ WE
Sbjct: 22  IEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDLLTNNSERALLTYTIRDYEEWE 81

Query: 80  ----RRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSSKQDSSADEEDNKNVP 135
               R+H       +     S  Q AK +Y+K +  +        +Q   A +E+   + 
Sbjct: 82  ESLKRKHKN--VTNTSTSSSSQQQTAKFTYDKEIHRM------KKRQGKFATDEE---IT 130

Query: 136 KKGRIGKVQKDTKTGKITIADDDKLVNKLAVSLQSESKKRYEARKRQMQNA--------K 187
           +   + +V  D   GK+ I DD  LVN     +   S  RY   KR   NA        K
Sbjct: 131 RGSAMKEVLDD---GKLLIKDDKHLVNGFISDINKVSNDRY--IKRMKLNAVNNDATGSK 185

Query: 188 TLY--GVESFINDKNKQFNEKL 207
             +  G  S+ N KNK FN+KL
Sbjct: 186 VSHDKGKTSYNNAKNKDFNDKL 207

>NDAI0E02680 Chr5 (557376..558827) [1452 bp, 483 aa] {ON} Anc_8.568
          Length = 483

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 109 LRNLATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKL 164
           L N+  +   +SKQ+   DE  N NVP    +G VQ   +   + IA   KL N+L
Sbjct: 303 LENIGIEL--NSKQEIITDEYQNTNVPNVYSLGDVQGRVELTPVAIAAGRKLANRL 356

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score = 31.6 bits (70), Expect = 1.5,   Method: Composition-based stats.
 Identities = 29/129 (22%), Positives = 59/129 (45%), Gaps = 10/129 (7%)

Query: 45  SMEDVNDADESVGDTESPEKEKAFHYTVQEY-----DAWERRHPQGKTGQSQ-RGGISYD 98
           ++ D+N A+    DT+S E+ K  H  V  Y     D+++R  P G+  + + +  IS  
Sbjct: 27  NVSDINLAERYARDTQSDERSKPRHRNVHSYYQNWIDSFKRAEPVGERRRRRAQQDISTT 86

Query: 99  QLAKLSY-EKTLRNLATQTQNSSKQDSSADEEDNK---NVPKKGRIGKVQKDTKTGKITI 154
            +  ++  +++   +    + S+  D++ D   N+   N  K   I  +  D + G  +I
Sbjct: 87  NINNMNKGDESDFYMGNGGEPSTNIDTAYDMNSNEVDPNNKKNENIYALNDDLEDGTTSI 146

Query: 155 ADDDKLVNK 163
           A  + +  K
Sbjct: 147 AASEDMPKK 155

>KNAG0H03160 Chr8 (593242..594861) [1620 bp, 539 aa] {ON}
          Anc_8.274 YDR120C
          Length = 539

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 39/81 (48%), Gaps = 13/81 (16%)

Query: 25 RKLADREIQEVSAN--RKPRVYSMEDVNDADESVGDTESPEKEKAFHYTVQEYD------ 76
          +KL  R + E +A+    P   ++ED N  +E       P++E  F+  VQ+++      
Sbjct: 7  QKLIGRGVPEAAASGSATPEYLNVEDFNVVEEGKAQILFPKRETVFYNPVQQFNRDLSVT 66

Query: 77 ---AWERRH--PQGKTGQSQR 92
             AW+  +  PQ + G S++
Sbjct: 67 CIKAWDNLYGFPQHRQGPSRK 87

>KLTH0G07238g Chr7 complement(582101..584224) [2124 bp, 707 aa] {ON}
           similar to uniprot|P36056 Saccharomyces cerevisiae
           YKL155C RSM22 Mitochondrial ribosomal protein of the
           small subunit
          Length = 707

 Score = 30.4 bits (67), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 36/85 (42%), Gaps = 6/85 (7%)

Query: 89  QSQRGGISYDQLAKL------SYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRIGK 142
           QS R  ISY  + +       SY + L+       + S+QD      D +    +G  G 
Sbjct: 9   QSCRAHISYSSMVRFRLAFPTSYTRILKRFKGTGASFSRQDLDVFTMDKQGGGTRGAAGF 68

Query: 143 VQKDTKTGKITIADDDKLVNKLAVS 167
           V +D + G   + D D+L+    VS
Sbjct: 69  VVEDNQLGNEEVVDRDELLRNEYVS 93

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 29.3 bits (64), Expect = 9.6,   Method: Composition-based stats.
 Identities = 36/165 (21%), Positives = 67/165 (40%), Gaps = 21/165 (12%)

Query: 44  YSMEDVNDADESVGDTESPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKL 103
           +S  D +D DE+  D E+ + ++    +++EY   E R    K G  +    S++ +   
Sbjct: 122 FSTSD-SDTDET-SDFETSQFDEKVKQSLEEYRKSEIRKQLIKEGNFKEVEKSWNPV--- 176

Query: 104 SYEKTLRNLATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNK 163
                   + ++  N  K     DE D K + +KG  G       T   +   D+K    
Sbjct: 177 -------KMGSRAVNHLKLKIIDDEADLKVLQEKGSFGIASNHFITVNYS---DNKYFQA 226

Query: 164 LAVSLQSESKKRYEAR------KRQMQNAKTLYGVESFINDKNKQ 202
             +   S+ K  Y          + +QN+++ Y +E   NDK ++
Sbjct: 227 TEIISVSDEKSVYTNNASLINANKSLQNSESNYQIEQVSNDKEQK 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.123    0.324 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,816,534
Number of extensions: 946802
Number of successful extensions: 4727
Number of sequences better than 10.0: 275
Number of HSP's gapped: 4663
Number of HSP's successfully gapped: 285
Length of query: 215
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 110
Effective length of database: 41,441,469
Effective search space: 4558561590
Effective search space used: 4558561590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 63 (28.9 bits)