Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR128C (UTP8)3.489ON71371333690.0
Skud_7.4393.489ON71371327010.0
Smik_6.2243.489ON70571326590.0
Suva_7.4163.489ON71371426470.0
NCAS0E008303.489ON67172814280.0
TDEL0D055703.489ON64972013521e-178
Kpol_480.163.489ON65571513481e-177
ZYRO0D10054g3.489ON66472013061e-171
SAKL0F02838g3.489ON65471812921e-169
TBLA0C044603.489ON69873312941e-169
NDAI0G009603.489ON70075612891e-168
TPHA0D042303.489ON65271412461e-162
CAGL0I10560g3.489ON67871812411e-161
KLTH0F14762g3.489ON65071911931e-154
AFR307C3.489ON65072311341e-145
KLLA0E04665g3.489ON64772311251e-144
Kwal_55.212223.489ON3734026598e-79
KAFR0C019403.489ON6095885235e-57
KNAG0B008303.489ON6075725183e-56
Kwal_55.21225singletonOFF2152503287e-34
KLLA0D19941gsingletonON611134870.086
YKR105C (VBA5)singletonON582124810.47
YCL069W (VBA3)singletonON458124790.64
Skud_18.3singletonON590115771.1
TDEL0H014104.292ON175110741.2
ZYRO0E08074g6.271ON59235771.2
TBLA0D01940singletonON1078132752.6
KLTH0G03586g5.523ON62156742.7
KNAG0D015607.253ON30580707.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR128C
         (713 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...  1302   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...  1045   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...  1028   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...  1024   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   554   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   525   e-178
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   523   e-177
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   507   e-171
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   502   e-169
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   503   e-169
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   501   e-168
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   484   e-162
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   482   e-161
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   464   e-154
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   441   e-145
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   437   e-144
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   258   8e-79
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   206   5e-57
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   204   3e-56
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   130   7e-34
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    38   0.086
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    36   0.47 
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    35   0.64 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    34   1.1  
TDEL0H01410 Chr8 (240642..240693,240799..241274) [528 bp, 175 aa...    33   1.2  
ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {...    34   1.2  
TBLA0D01940 Chr4 complement(480209..483445) [3237 bp, 1078 aa] {...    33   2.6  
KLTH0G03586g Chr7 complement(275721..277586) [1866 bp, 621 aa] {...    33   2.7  
KNAG0D01560 Chr4 complement(262229..263146) [918 bp, 305 aa] {ON...    32   7.1  

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score = 1302 bits (3369), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/713 (91%), Positives = 651/713 (91%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420
           FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN
Sbjct: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420

Query: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480
           NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF
Sbjct: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480

Query: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXXX 540
           KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPK                   
Sbjct: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFPLSRTRNL 540

Query: 541 XXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEMK 600
                DQPRLFKQAIVTC            FSIRNRELLLDISFRILQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMK 600

Query: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTL 660
           KLSKLDVQNFIEFITSGGEDSSPECFNP              DSIGLFSLEGALLENLTL
Sbjct: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI
Sbjct: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1045 bits (2701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/713 (72%), Positives = 584/713 (81%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKLTFDYPIPSTN+ITAC+A + Q N++ +++ S DD  + EK  N+Q KRN+EIW+FG 
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           MVNKGNYTLNV TK LE   +TSN+HL E  ID++ + G+D+FLSQ+KIK KAKVM+IKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           D KNSL+IA+LQNGLIE +D KL LL+SFDISYDNLKYAKWFTENGT++VFVLCPL+DDK
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VCYK+LEL+D  S ++SPIKELSSTIIEGFSFE+SKLCYQFGKLYKLNQGKIY+YSLPHC
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QLQQ+IE P+++K +  DDLISFQPVSVNR+LLTVNN+IYLLDLLHCS L+ RELTHVKT
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420
           FQLLKSA+I+SEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 
Sbjct: 361 FQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGK 420

Query: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480
           ND+SVILKPLFDD+D+ +  VK ND+ G+ +VP+ H +EVIEKLS L++NDI SFD+IFF
Sbjct: 421 NDASVILKPLFDDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFF 480

Query: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXXX 540
            +LK+KEEHYTEKDR+ISDPGFLNKVLDLIF KF GNDYPK                   
Sbjct: 481 NDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLFPLNRTHGL 540

Query: 541 XXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEMK 600
                DQPRLFKQAIVTC            FSIRNRELLLDISFR+LQDFTRDSIKQEMK
Sbjct: 541 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMK 600

Query: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTL 660
           KLSKLD+QNFIE IT+  ED   E FN               DSIGLFSLEGALLENLTL
Sbjct: 601 KLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTL 660

Query: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           YIDKQV+IAERNTELWNLID KG QHGFA+ +  + TSQK+ALP Y MEYLDI
Sbjct: 661 YIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLDI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score = 1028 bits (2659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/713 (72%), Positives = 577/713 (80%), Gaps = 8/713 (1%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSNFSLQA+YVQVADGTFNESTNNITL            NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL FDYPIPSTNIITACNA + Q NI+        D+ NNEK IN+Q KRN+EIW+FGL
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQTKRNIEIWSFGL 112

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           MVNKGNYTLNVITK LE+T + ++++L E+ I+N  YTGS+  LSQYKIKAKAKVMSIKI
Sbjct: 113 MVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKI 172

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           DTKN+L+IAILQNGLIE +DFKL LLHSFDISYDNLKYAKWFTENG E++FVLCPLQDDK
Sbjct: 173 DTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDK 232

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VCYKLLELTD  + E+SPIKELSSTIIEGFSF++SKLCYQFGKLYKLN+GKIY+YSLPHC
Sbjct: 233 VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHC 292

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QLQQVIE P+++      DLISFQPVSVNRVLLTVNN++YLLDLLHCSTL QREL+HVKT
Sbjct: 293 QLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKT 352

Query: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420
           FQLL +AVINSEKSH+SKTIAIGISTKNG NPTSSLEIINIDVGTNTLKDSLGKSFQ   
Sbjct: 353 FQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEK 412

Query: 421 NDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFF 480
            DSSVILKPLFDD+++ +  VK N++ GD S+P    +E+I KLSAL+ NDITSFDDIFF
Sbjct: 413 KDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFF 472

Query: 481 KELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXXX 540
           K+LKIKEEHYTEKDR+ISD  FLNKVLDLIF KF+GNDYPK                   
Sbjct: 473 KDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNL 532

Query: 541 XXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEMK 600
                DQPRLFKQAIVTC            FSIRN+ELLLDISFRILQDFTRDSIKQEMK
Sbjct: 533 LSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMK 592

Query: 601 KLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTL 660
           +LSKLD+QNFIEF+TS   D+S E FN               DSIGLFSLEGALLE+LT 
Sbjct: 593 RLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTS 652

Query: 661 YIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           YIDKQV+IAERNTELWNLID K  QHGF +  F++ +SQK+ALPTYTMEYLDI
Sbjct: 653 YIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score = 1024 bits (2647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/714 (71%), Positives = 581/714 (81%), Gaps = 2/714 (0%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLATLPKIASLSNFSLQADYVQVADG FNE TNNITL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKLTFDYPIPSTNIITACNA +GQ  I+ + + S +D+ ++E T N Q KR+VEIW+FGL
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVT-NFQSKRDVEIWSFGL 119

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           MVNKGNYTLNVITKA+ED  DTSNDHL+E+  D KAY G+D+ LSQYKIK K KVM+IKI
Sbjct: 120 MVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKI 179

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           D KNSLVIA+LQNGL+E +DFKL LLHS+DISY NLKYAKWFTENGTE+VFVLCPL+DDK
Sbjct: 180 DAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDK 239

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VCYKL EL+D    ESSPIKELSSTIIEGFSFE+SK CYQFGKLYKLNQGKI++YSLPHC
Sbjct: 240 VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHC 299

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QLQQ+I+ P+++K +  +DLISFQPVSVNR+LLTVNN IYLLDLLHCS L+QRELTHV+T
Sbjct: 300 QLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRT 359

Query: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420
           FQLL+SAVI+SEKS NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ+G 
Sbjct: 360 FQLLRSAVIDSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQIGK 419

Query: 421 ND-SSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479
           ND SSV+LKPLFDD+++ D  VK ND+ G+ SVP    +E+I+K+SAL++ND+ SFDDIF
Sbjct: 420 NDTSSVVLKPLFDDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIF 479

Query: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXX 539
           FK+LK+KEEHYTEKDR+ISD  FLN+VLDLIF KF+GNDYPK                  
Sbjct: 480 FKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPLNRTHN 539

Query: 540 XXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEM 599
                 DQPRLFKQAIVTC            FSIRN+ELLLDISFRILQDFTRDSIKQEM
Sbjct: 540 LLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEM 599

Query: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLT 659
           K LSKLD+QNFI+FIT+  EDS+ E  N               DSIGLFSLEGALL+NL 
Sbjct: 600 KNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLA 659

Query: 660 LYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
            YIDKQVEIAERNTELWNL++TKG QHGF +   D+ TSQK+ALPTYTMEYL+I
Sbjct: 660 SYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/728 (45%), Positives = 446/728 (61%), Gaps = 72/728 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSNF+LQ+DY+QV D TF+ +TN IT+            NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL F++PIPSTNI+TACN                         +  QK  + E W F  
Sbjct: 61  PKLIFNFPIPSTNIVTACN-------------------------VFEQKGSSEETWCFAT 95

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           M NK + TLN+I K    T +  +   + SD             S++KIKA   V+ IKI
Sbjct: 96  MANKTS-TLNLINKNQYQTNEEESGDSAPSD---------SSVTSEFKIKADDHVVDIKI 145

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
             K  +++ +L+NG I+ +DF+L LL+S +++Y+N+++ + F E+G +++FVLC L++DK
Sbjct: 146 LNKKKIIV-VLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLENDK 204

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VC KL ++ +     +    EL+STI+E F  EN+K CYQFGK YKL   KI +YSLP  
Sbjct: 205 VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVYSLPQF 264

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           Q Q  I  PM+  L  G+ ++SF+P+S NR+LLTVNN IYLLDL+H S LS+RELTH+KT
Sbjct: 265 QFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSERELTHLKT 324

Query: 361 FQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGN 420
           FQLLK+AV+++  + N +T+AIG+STK G NPTSSLE++N+DVGT+T+KDSLGKSFQ  +
Sbjct: 325 FQLLKTAVVDTNINQN-RTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKSFQTSS 383

Query: 421 NDSSV-ILKPLFDDK-DINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDI 478
            +++V  LK LFDD+ D +DK+ +  + +           E I K      ND+T FDDI
Sbjct: 384 TENNVQSLKSLFDDENDYSDKKKQVKNFNY----------EKIYKELVDSKNDVTKFDDI 433

Query: 479 FFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXX 538
           FFK   IK+E+YTEKDR+I +  FL +++DLIF  F   +YPK                 
Sbjct: 434 FFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFK-EEYPKTFTYLLTDPLFPLERTK 492

Query: 539 XXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQE 598
                  + PRLFKQAIVTC            F+I N EL LDIS RILQD+TRDSIK+E
Sbjct: 493 GLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKE 552

Query: 599 MKKLSKLDVQNFIEFITSGGED-----SSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGA 653
           +KKL K++V+NFIEFI     D     ++P  F                DSIGLF+L+ A
Sbjct: 553 LKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQ---------LLSLVVDSIGLFALDNA 603

Query: 654 LLENLTLYIDKQVEIAERNTELWNLIDTKGF----QHGFASSTF-DNGTS---QKRALPT 705
           +LE L+ YID+QV IA+ NTELW+L+D           F +ST  D+ TS   Q+  LP 
Sbjct: 604 VLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPK 663

Query: 706 YTMEYLDI 713
           Y++EYLD+
Sbjct: 664 YSVEYLDL 671

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  525 bits (1352), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 313/720 (43%), Positives = 417/720 (57%), Gaps = 78/720 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQ F+LA LP++ASLSNF+ Q +++QVAD     ++N IT+            NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL    PIPSTNI+TAC+             A +D++               EIW + L
Sbjct: 60  PKLVLSIPIPSTNIVTACDV------------ARSDEQ---------------EIWCYAL 92

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
              K   TLNV +K               S  +N     SD+ L   K+K   + + + +
Sbjct: 93  QAGKV-CTLNVASKV--------------SHAENGV--NSDDVL---KVKVDDQAVGVHV 132

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           + K+  ++ +L+NGLI+ +DF+L LLHS D+SY ++   K+FTE   +++F+LC L +DK
Sbjct: 133 NGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK 192

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VC+KL EL+   +    PIKELSS I+E FS   SK+CYQ G+LY+L   ++ +Y+LP C
Sbjct: 193 VCFKLFELS-LPNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQC 251

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QL Q +  PMV     G D+IS +P+S NR+L+T +N IYLL+L H S L QRELTH+K+
Sbjct: 252 QLVQAVTLPMVQ----GADVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKS 307

Query: 361 FQLLKSAVINSEKSH---NSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417
           FQLLKSAVI+S  S    N KT  IG+ TK+G NPTSSLEI+N+DVGT TLKDSLGK F 
Sbjct: 308 FQLLKSAVIDSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFT 367

Query: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477
           V N   S +LKPLF D+D   +         D        N++ + L       I+SFD 
Sbjct: 368 VSNEPISQVLKPLFSDEDNEAEDEDNKFEHFD-------FNQIYQHLEK-NKQSISSFDR 419

Query: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXX 537
           IF +EL IK EHYTE DR+I D  FL+ V+ LI   F   +YPK                
Sbjct: 420 IFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQ-EEYPKALTFLLTHPLFPVDCT 478

Query: 538 XXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQ 597
                   + PRLFKQAIVTC            FSI N EL LDIS RILQD+T D IKQ
Sbjct: 479 PKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQ 538

Query: 598 EMKKLSKLDVQNFIEFITSGGED----SSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGA 653
           E++KL+K+DVQNFIEF+ S  ++    SS + F                DSIGLF+L+G 
Sbjct: 539 EVRKLNKIDVQNFIEFVISSNDENAIRSSHQLFQ---------LLSLVLDSIGLFALDGV 589

Query: 654 LLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           LL+ L  YI ++V IAERN++L +L+D K    GFA S   +  S + A+P YT+EYLD+
Sbjct: 590 LLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  523 bits (1348), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 306/715 (42%), Positives = 418/715 (58%), Gaps = 62/715 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS SQPFRLA LPKI SLSN   Q   +Q+AD  F+  +N IT+            NPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           P L F+ PIPSTN +TACN     ++ DG+                      +E WA+GL
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHFVSDTDGS---------------------KLECWAYGL 98

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
             NK N+TLN+  K    T+D           D+K  T   E +  Y  K   K+  IKI
Sbjct: 99  SYNK-NHTLNISIK----TSD-----------DDKYATSGGEVVETYSQKCDDKIEHIKI 142

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           + K  +++ +L+NGLI+ +DF L LL S ++ Y ++ + + F E+G ++  +L  ++  K
Sbjct: 143 NEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKK 202

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           + +KL EL    + + + I ELSSTI+E      S++CYQFGK+Y+L + ++YIY+LP C
Sbjct: 203 ISFKLYELF---TNDKTSINELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQC 259

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QLQQ IE P + K     D++SF P++ NR+LLTVNN IYLLDL+H S L++R+L+HVK 
Sbjct: 260 QLQQTIELPFIQK--KDSDVLSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKV 317

Query: 361 FQLLKSAVINSE-KSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           +QLLKS V+ S+ ++ NSKTIAIG+S KNGP+P SSLE+IN+DVG+ TLKDSLGKSFQV 
Sbjct: 318 YQLLKSIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSFQVA 377

Query: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479
           N   ++ L+ LF + +          +             ++++L     NDI  FDDIF
Sbjct: 378 NVKKNIPLQSLFPEDET---------IYAKGEQKSFDYKNILQELQN-NKNDINKFDDIF 427

Query: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXX 539
           FK+L I +E+YTE+DR+I D  FL+ VLDLIF  F   DYP+                  
Sbjct: 428 FKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFK-KDYPRALTFLLTHPLFPISHTRN 486

Query: 540 XXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEM 599
                 +QPRLFKQA+VTC            F+I N EL LDIS RILQD+TRDSIKQE+
Sbjct: 487 LLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQEL 546

Query: 600 KKLSKLDVQNFIEF-ITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENL 658
           K LSK+D+QNFIEF I +  ED S   FNP              D+ GLF+LE   LE L
Sbjct: 547 KTLSKVDIQNFIEFVIDTDSEDKSQ--FNP----QLFQLLSLVLDASGLFALEEETLEKL 600

Query: 659 TLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           + YID QV +AERN  LW+L+D    +    +   D    Q ++L  Y++EYL++
Sbjct: 601 SAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  507 bits (1306), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 298/720 (41%), Positives = 411/720 (57%), Gaps = 63/720 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    + ++N IT+            NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL  +  IPSTN+++AC+           +    DD+               EIW + +
Sbjct: 60  PKLLSNISIPSTNVVSACD-----------VATLADDK---------------EIWCYCV 93

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
              K ++ LN   K ++  T    D             G D+    +KIK  +KV+ IKI
Sbjct: 94  KSGKSHF-LNASVKPVDADTVLDTD-------------GGDK-TEDFKIKMDSKVVGIKI 138

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
                 ++ +L++GLI+ +DF+L  L S DISY N+K   +F+ENG  ++FVL   +++K
Sbjct: 139 IPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK 198

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           VC+KL EL        +PIKELS+TI+E F+ + SKLCYQ GKLY+L    I  Y+LP C
Sbjct: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
            L Q    PM+  L P    +S  PVS NR+LLTVNN +YLLDL+H S LS+R LTH KT
Sbjct: 259 HLVQTTHLPMI--LDPNSQKVSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKT 316

Query: 361 FQLLKSAVINSEKS-----HNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKS 415
           FQLL+SA +N   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKS
Sbjct: 317 FQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKS 376

Query: 416 FQVGNNDSSVILKPLF--DDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDIT 473
           FQ  N+  +  L+PLF  D+ D  D        + DS   V    E I K  +  +  I+
Sbjct: 377 FQSINDSKTHNLQPLFSDDESDAGD--------NADSDEVVAFAYEDIFKELSKNNKSIS 428

Query: 474 SFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXX 533
            FD  F K L I+EEHYT+++R+I D  FL+KV+ LI   F   +YP+            
Sbjct: 429 KFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRALTFLLTHPLFP 487

Query: 534 XXXXXXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRD 593
                       + PRLFKQAIVTC            FSI N EL LDIS RILQDFT D
Sbjct: 488 TDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTD 547

Query: 594 SIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGA 653
            IK E+KKL+K+DV NF+ F+ S  ++   E                  D+IGLF+L+GA
Sbjct: 548 MIKDEVKKLNKVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDGA 604

Query: 654 LLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           LL+ L+ YID+QV +AERN  LWNL+DT+    G   S   +  ++++ LP YT+EYL++
Sbjct: 605 LLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  502 bits (1292), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 310/718 (43%), Positives = 417/718 (58%), Gaps = 71/718 (9%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL  LPKIASL+NFS Q DY+QVA+ T   S N I +            NPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVAN-TLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL  +  IPST+I+TAC+  + Q N +G+ E                     E+W + L
Sbjct: 60  PKLVHNLSIPSTSIVTACDVSEIQQN-EGDTETQ-------------------EVWCYAL 99

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           + NK  +TLN I K L     + N               S +    YK+  K KV S+KI
Sbjct: 100 VANKS-FTLNTIIKPLTADAPSVN---------------STQTFENYKVSIKHKVASVKI 143

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT-ENGTEYVFVLCPLQDD 239
                 +IA+LQNGL++ FDF+L LLHS DISY N+   K+FT E   +++ VL  L DD
Sbjct: 144 FPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDD 203

Query: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299
           KVCYKL E+    S    P+KEL+S I+EGFS +NSK  YQFGK+Y L+ GKI IYSLPH
Sbjct: 204 KVCYKLFEIIHHDSN--VPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPH 261

Query: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359
            QL   I  P V      ++++SF+P+S NR LLTV+N IYLLDLLH + LSQRELTHVK
Sbjct: 262 FQLSNTINLPFVTH----ENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVK 317

Query: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           TFQLL +A+I    + N+KTIAIG+STK+  N TS+L+I+NI+VG+ TLKDS+ K F + 
Sbjct: 318 TFQLLTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGF-LT 376

Query: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479
            + +  +L  LF      D++    D  G S       N+++ +L   + +    FD++F
Sbjct: 377 QDATEEVLNSLF------DEQDDELDEDGTSQ---FDYNQILSELEKAK-SKTEKFDNVF 426

Query: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXX 539
           FK L IK+E+YTE DR+ +  GFL+KVL LIF  F   +YP+                  
Sbjct: 427 FKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENF-NKEYPRALTYLLTHPLFPAKHATC 485

Query: 540 XXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEM 599
                 + PRLF+QAIVTC            F++ N EL LD+S RILQDFT+DSIKQ +
Sbjct: 486 LLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSI 545

Query: 600 KKLSKLDVQNFIEFITSGGED-----SSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGAL 654
           KK+SK+D+ NFI F+ +  +D     S P+ F                DSIGLF+L+G  
Sbjct: 546 KKMSKVDINNFIGFVINEDDDEERNKSKPQLFQ---------LLNLVLDSIGLFALDGES 596

Query: 655 LENLTLYIDKQVEIAERNTELWNLI-DTKGFQHGFASSTFDNGTSQKRALPTYTMEYL 711
           LENL  +I+ QV+I E+N EL NL+ DT        SS   + ++ ++ALP+Y++EYL
Sbjct: 597 LENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  503 bits (1294), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 305/733 (41%), Positives = 432/733 (58%), Gaps = 55/733 (7%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA  TF   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANID-GNIEASTD-----DEANNEKTINTQ------ 108
           PKL F+  IPSTN +TA N       ++  N   +TD     D+ N E T          
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 109 -KKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQY 167
             KR+VE+WA+GL+ NK N TLN+  K       T  D  S         T   E + + 
Sbjct: 121 VTKRSVELWAYGLVANKSN-TLNISVKT------TGLDEFS---------TTPGEIIRKK 164

Query: 168 KIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGT 227
            IK  +KV++IKI  +   ++ +L+NGL+++FDF L L  S DI+Y+++++ + FTE+  
Sbjct: 165 TIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQ 224

Query: 228 EYVFVLCPLQDDK--VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLY 285
            ++ +L  + ++K  VC+KL +L      +S+ + ELS +I++ F    SKL YQFGKLY
Sbjct: 225 NFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLY 282

Query: 286 KLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLL 345
           +L   ++++YSLP CQL Q I   + +      D+ S +PV+ NR++L +NNV+YL+D L
Sbjct: 283 RLTGSELFVYSLPQCQLLQNIS--LAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTL 340

Query: 346 HCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGT 405
           H S L++RE THVKTFQLL+SA I  + +   +TIAIG+STK+GP   S+LE+INI+VG+
Sbjct: 341 HRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGS 399

Query: 406 NTLKDSLGKSFQVGNNDSSVI-LKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKL 464
            TLKDSLGK      ++ S   LKPLFD+ D  +K +    V   S+V   + N+++  L
Sbjct: 400 GTLKDSLGKGVSKKLSEGSHSDLKPLFDEND--EKSLIGTPVHDISNVKSFNFNKILADL 457

Query: 465 SALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXX 524
            +   + I+ FD  FF+ L+IKE HYTE DR+ISD  F+   +DLIF KF   ++PK   
Sbjct: 458 KS--SDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKF-DTEFPKAFT 514

Query: 525 XXXXXXXXXXXXXXXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISF 584
                                D PRLFKQAIVTC            F+++N EL LDIS 
Sbjct: 515 FLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISL 574

Query: 585 RILQDFTRDSIKQEMKKLSKLDVQNFIEFI----TSGGEDSSPECFNPXXXXXXXXXXXX 640
           R+LQD++R+ +KQE+KKL  +D++NFIEFI    T   + ++P+ F              
Sbjct: 575 RVLQDYSRNDVKQEIKKLDNVDIENFIEFIITPTTEEIQTNTPQLFQ---------LLSL 625

Query: 641 XXDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQK 700
             DSIGLF+L+G LLE L+ YI++QV IAER++ELW+L+DT      F ++   +    K
Sbjct: 626 VLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNK 685

Query: 701 RALPTYTMEYLDI 713
             L  Y+++YLDI
Sbjct: 686 ETLSVYSVDYLDI 698

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  501 bits (1289), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 318/756 (42%), Positives = 428/756 (56%), Gaps = 99/756 (13%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL  LPKIASLSN+SLQ DY+QV   TFN +TN + +            NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL F+YPIPSTNI+TAC+                          N     N E+W FGL
Sbjct: 61  PKLIFNYPIPSTNIVTACDV-----------------------LENDNDNTNNEVWCFGL 97

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
           + NK  YTL +ITK  + ++ T      E  +D    T  DEF  +   K     +  K 
Sbjct: 98  VANKT-YTLTLITKDKQKSSATM--EDDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKK 154

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQD-D 239
               S++I +L+NGLI+ F+  L LL++  I+Y N+K+ + F E+  +++F +C L D +
Sbjct: 155 ADDISIMI-VLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFKEDNKDFMFTICDLGDNN 213

Query: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299
           KVC KL ++ +      S I EL+S I+E F+ +N+K CYQFGK YKL    + +YSLP 
Sbjct: 214 KVCIKLFQINN-----DSAI-ELNSIIMENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQ 267

Query: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359
            QL+     PM+      D ++S +P+S NR+LLT+NN IYLLDL+H S LS+RELTH+K
Sbjct: 268 FQLEHTTTIPMI---KTDDQIVSMKPISTNRILLTINNKIYLLDLIHNSILSERELTHLK 324

Query: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           + QLL+SAVI  +  +N+KTI IG+STK G NPTSSLEIIN+DVG+NTLKDSLGK FQ  
Sbjct: 325 SLQLLRSAVI-GKGENNNKTITIGVSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNL 383

Query: 420 N-----NDSSVILKPLFD-------DKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSAL 467
           N       S+  LKPLFD       D D+  K V     + D         E++ KLS  
Sbjct: 384 NLQNQIQISTQALKPLFDPNTDGDKDDDLFKKLVTKEQFNYD---------EILTKLSE- 433

Query: 468 QDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSG-------NDYP 520
             NDI  FD+IFF+   IK+EHYTE DR+I +  F  K++DLIF KF         N+YP
Sbjct: 434 NTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTAQTNEYP 493

Query: 521 KXXXXXXXXXXXXXXXXXXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLL 580
           K                        + PRLFKQAIVTC             +I+N EL L
Sbjct: 494 KTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIKNNELSL 553

Query: 581 DISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITS---GGEDSSPECFNPXXXXXXXXX 637
           DIS RILQD+++DSIKQE++ L +L+++NFI+FI +     + +SP+ F           
Sbjct: 554 DISLRILQDYSKDSIKQELRNLPRLEIENFIDFILNDEIKDDQNSPQLFQ---------L 604

Query: 638 XXXXXDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKG--FQHGFASSTFDN 695
                DSIGLF+L   +LENL+ YID+QV I E+NTELW LID+    F H    ++F +
Sbjct: 605 LALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDNSFSS 664

Query: 696 GTS------------------QKRALPTYTMEYLDI 713
            ++                  QK ALP Y+++YL++
Sbjct: 665 ASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  484 bits (1246), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 301/714 (42%), Positives = 419/714 (58%), Gaps = 63/714 (8%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIA LS++++Q+  +QVAD  F   +N IT+            NPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           P ++   PIPSTN +TACN  + +             +A+ E+          EIW + L
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQYK-------------DADTEELF--------EIWVYNL 98

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
            VNK N TL+V  K +              D D  + T SD  L  Y +K  A V+ IKI
Sbjct: 99  AVNKKN-TLHVAIKTV--------------DPDKFSTTQSDA-LETYTVKCDASVVGIKI 142

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240
           + ++  ++  L NG I+IFDFKL LL+S + SYDN+ +++ F EN   +  +L  ++ +K
Sbjct: 143 NKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNK 202

Query: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300
           + YKL EL   G  ++S IKELSSTI+E    ++SK+ YQFGKLY+L + ++++YSLP C
Sbjct: 203 LSYKLYEL--FGQDKTS-IKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQC 259

Query: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
           QL   I  P +D        ISF+PVS NR+LLTV+N I++LDL+H +TL++R L HVK 
Sbjct: 260 QLVDTITLPQID--LKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKM 317

Query: 361 FQLLKSAVINS-EKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
           FQLLKS VI + + S+N KTIAIG+S KNGP+P ++LEIIN +VGT TLKDSLG SF V 
Sbjct: 318 FQLLKSVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVS 377

Query: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479
            +  S IL+PLF D D N   VK +D   ++         +++KLS+  +NDI  FDDIF
Sbjct: 378 KSFKSNILQPLFTD-DAN--LVKRHDFKYEA---------ILKKLSS-TENDIKKFDDIF 424

Query: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXX 539
           F +L I++ +YT+ +R+I D  FL+ V+DLIF  F   +YP                   
Sbjct: 425 FGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQ-KEYPSALTFLLTHPLFPIHQTKN 483

Query: 540 XXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEM 599
                 + PRLFKQA+VTC            FSI N EL +DIS RILQD+T+DSIK E+
Sbjct: 484 LLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLEL 543

Query: 600 KKLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLT 659
           K L+K+D+QNFI+F+     +   +                  D+ GLFS+EG LL  L+
Sbjct: 544 KNLNKIDIQNFIDFVIDPNNEEEKK-----HNEQLFVLLSLVLDASGLFSIEGPLLTQLS 598

Query: 660 LYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
            YIDKQVE+ E++ +LW+LID    +      T      + +AL  Y++EYL++
Sbjct: 599 EYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALTAYSVEYLEL 652

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  482 bits (1241), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 283/718 (39%), Positives = 420/718 (58%), Gaps = 45/718 (6%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASL NFS +  Y++VAD +F   +N++ L             PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVAD-SFTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLTFDYPIPSTNIITACN--AEKGQANIDGNIEASTDDEANNEKT-INT-QKKRNVEIW 116
           P+L F+ PIPST++++ACN       + +  + +A+ D+  +   T  NT ++ ++ EIW
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIW 119

Query: 117 AFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVM 176
            + L  N   +TLN + + +    D +N  ++E++              Q+  K K +++
Sbjct: 120 CYALSANNKTHTLNCLIREV----DNNNTSITENN-------------PQFNAKFKEQII 162

Query: 177 SIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPL 236
           +I++DTK+ +++ + + GL++ +D +L LL+S +  Y ++K  K F ENG EY+ ++  L
Sbjct: 163 NIEVDTKHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDL 222

Query: 237 QDDKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYS 296
           +D KV  +L E+    S E   +KEL+S+IIE F+ ++S LCYQFG++Y+L + +I +YS
Sbjct: 223 KDQKVALQLYEV----STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYS 278

Query: 297 LPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELT 356
           +P  QL   ++ P + ++   + LIS +P++ NRVLLTV N IYLLDLLH S LS+RE++
Sbjct: 279 IPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVS 338

Query: 357 HVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 416
           H+KTFQ+LK+A +N + S +  T+A+GISTKNG NPTS+LEIINIDVG+N+LKDSLGKSF
Sbjct: 339 HMKTFQILKTA-MNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSF 397

Query: 417 QVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFD 476
              NN     LK LF +                  +P ++  E++ KL     N    FD
Sbjct: 398 LRRNNQIQGQLKNLFPEPKY--------------ELPSINFPEILGKLK--NANSAEKFD 441

Query: 477 DIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGN-DYPKXXXXXXXXXXXXXX 535
           + FF  L IKEE +TE  R+++D  FL  VLDLIF K   N   P+              
Sbjct: 442 ETFFNLLNIKEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKE 501

Query: 536 XXXXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSI 595
                        RLFKQAIVTC            F+I+N EL++DIS RILQD+T+D+I
Sbjct: 502 KAIGLLTKVKSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAI 561

Query: 596 KQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALL 655
           K+E+KKL ++ V+NF+ FI       +                    DSIGLF LE ++L
Sbjct: 562 KEEIKKLDQVSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESIL 621

Query: 656 ENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
             L+  I+K+V+IAERN ELWN++D K      +SST  +  ++    P Y +EY+DI
Sbjct: 622 IQLSSIIEKEVKIAERNVELWNIMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  464 bits (1193), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 279/719 (38%), Positives = 406/719 (56%), Gaps = 75/719 (10%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q +Y+QVAD T   +TNNI +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVAD-TLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL ++ PI STN+++AC             E +T  E +++           E+  +G+
Sbjct: 60  PKLVYNQPISSTNVVSACAVA----------EITTTSEKDSQ-----------EVICYGI 98

Query: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180
             N+  Y+L    K +  T   S+                 E  + +K+    +++++K+
Sbjct: 99  QSNRV-YSLCATIKPVSSTASDSS---------------FGETYAAHKVSVSDQIVNLKV 142

Query: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT-ENGTEYVFVLCPLQDD 239
                 ++A+L++GLI+ FDF+L L HS D SY N+ Y + FT E+G  Y F+L  +   
Sbjct: 143 FPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGH 202

Query: 240 KVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPH 299
           KV +KL E+    S  ++P  ELSS I+E    ++S++ YQFG++Y+L+   + IY+LPH
Sbjct: 203 KVSFKLFEIGQSDS--ATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPH 260

Query: 300 CQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVK 359
            Q  + IE P    L+P + +ISF+P+S NR LLT +N I+LLDLLH + LSQRE+ HVK
Sbjct: 261 FQHSRTIELPF---LAP-ESIISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVK 316

Query: 360 TFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVG 419
            FQLL++AVI    + N+KTIA+G+S K+G NP+SSL+IINIDVGT TL+DS+GK F   
Sbjct: 317 IFQLLETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSR 376

Query: 420 NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIF 479
            N S   L+PL    +             D+     + + ++++LS   DN I +FD +F
Sbjct: 377 ENKSQH-LQPLISTLN-------------DTEAAEFNYDRILKELSKAADN-IENFDSVF 421

Query: 480 FKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXX 539
           FK L IK  +YT+ DR+++D  FL  V  LIF  F  ++YPK                  
Sbjct: 422 FKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFK-SEYPKALTYLLTNPLFPVSHTHN 480

Query: 540 XXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEM 599
                 D PRLFKQAIVTC            F++ N EL LD+S RILQDF +DSIK+ +
Sbjct: 481 LLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAI 540

Query: 600 KKLSKLDVQNFIEFITSGG--ED---SSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGAL 654
           K+ SK+DV NFI F+ S    ED   + P  F                DS+GLF+LE  +
Sbjct: 541 KQKSKIDVNNFINFVISENFEEDRIKNKPRLFQ---------LLSLVLDSVGLFALENEM 591

Query: 655 LENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           LE LT YID+Q+ + + N EL+NL++ K F++GF     D  TS +  +  Y++E L++
Sbjct: 592 LEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  441 bits (1134), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 264/723 (36%), Positives = 396/723 (54%), Gaps = 85/723 (11%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M  ++QPFRLA LPKI+SL+N++ Q  Y+QVAD     ++N +T+            NPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVAD-VLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL ++ PIPSTN++T C+     A  DG                        E+W++ L
Sbjct: 60  PKLVYNIPIPSTNVVTGCDV---LAMSDG-----------------------AELWSYAL 93

Query: 121 MVNKGNYTLN-VITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIK 179
             N   +TL+ V+ KA     +T  D               DE    +K   K +V+ ++
Sbjct: 94  TANGKVHTLHAVLRKAGAAPQETGLD------------ASEDE---HFKQTLKGRVVRVR 138

Query: 180 IDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTEN-GTEYVFVLCPLQD 238
           I +    ++ +L  GLI+ +D++L LLHS DISY N+   ++FT++ G +Y+FVLC +Q+
Sbjct: 139 ILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVLCDIQN 198

Query: 239 DKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLP 298
            K CYKL +L    S E+ PI EL+S I+E F+   SK+ YQFGKLY+L   K+Y+YSLP
Sbjct: 199 KKTCYKLFQLNH--SAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMYVYSLP 256

Query: 299 HCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHV 358
           H QL   +  P V K    DD +S Q +S NR+LLT  N I+LLDLLH + L +REL+++
Sbjct: 257 HFQLSHCVPLPFVRK----DDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYERELSNI 312

Query: 359 KTFQLLKSAVI-NSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417
           K FQLL++AVI  +    +++T AIG+STK G NP+S+L+++ I VGT TLKDSLGK F 
Sbjct: 313 KFFQLLRAAVIPGTTPGESNRTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDSLGKGFL 372

Query: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477
            G +  +  LKPLF               + D   P +    ++ +L++       +FD 
Sbjct: 373 SGEHRRTEALKPLFG--------------TDDDESPNIDFAAILAELTS--RTTPKAFDS 416

Query: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXX 537
           IF+K L  K+E+YTE DR+I++  FL  +LD IF  F+ +++PK                
Sbjct: 417 IFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFA-DEFPKALIYLLTHPLFPSSHT 475

Query: 538 XXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQ 597
                     PRLFKQA+VTC            F++ N EL LD+S R+LQ+FT++ IKQ
Sbjct: 476 KGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQ 535

Query: 598 EMKKLSKLDVQNFIEFITSGGED------SSPECFNPXXXXXXXXXXXXXXDSIGLFSLE 651
            +++LS++D+ NF+ F+     D      + P+ F                D++GL +LE
Sbjct: 536 GIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQ---------LLSLVIDAVGLLALE 586

Query: 652 GALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHG--FASSTFDNGTSQKRALPTYTME 709
           G +L  L+ +ID QV +A++  EL  L++    + G    S T  + +     +P Y++E
Sbjct: 587 GDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGKHLNSVTRLDESPVAATIPLYSVE 646

Query: 710 YLD 712
           YLD
Sbjct: 647 YLD 649

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  437 bits (1125), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 268/723 (37%), Positives = 402/723 (55%), Gaps = 88/723 (12%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           M S+SQPFRL+ LPKI SL+N++ Q DY+QV D   + S N + +            NPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120
           PKL F+ PIPSTNI+TAC+  +  AN                           E+W +GL
Sbjct: 60  PKLVFNLPIPSTNIVTACDVVEDAAN--------------------------TEVWCYGL 93

Query: 121 MVNKGNYTLNVITKAL-EDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIK 179
              K ++ L++ TK + +D   +SN                 E  SQ+K K K++V+SIK
Sbjct: 94  EARKVSH-LHLATKPMIQDAVSSSNA----------------EITSQFKYKLKSEVVSIK 136

Query: 180 IDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTE-NGTEYVFVLCPLQD 238
           I +K   V+ IL+NGLI+ FD++L L ++ DISYD++++ ++F +  G ++ FVLC L D
Sbjct: 137 IYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSD 196

Query: 239 DKVCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKL-NQGKIYIYSL 297
           +K+CYKL ++      ES    EL+S I+E ++ EN+KLC++FGKLY L N  ++ IY L
Sbjct: 197 EKICYKLFQV----RSESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQL 252

Query: 298 PHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTH 357
           PH QLQ  I+ P + K    D ++S +PVS NRVLLT +N IYL+DLL+ + L Q++L +
Sbjct: 253 PHLQLQTSIQLPFISK----DAVVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQN 308

Query: 358 VKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQ 417
           +K  QLL +AV+      N KTIA+ ++TKNG NPTS L++INIDVGT TLKD++GK F 
Sbjct: 309 IKAIQLLSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFM 368

Query: 418 VGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDD 477
           V        L+ LF++ + +D          D  +P      +I++L   +   I +FD 
Sbjct: 369 VKQKQK---LQKLFEESNEDD----------DVELPSPDYERIIKQLHICK--KIENFDS 413

Query: 478 IFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXX 537
           IFFK L + +E+YT+ DR+++D   L +++D +F  F  ++YPK                
Sbjct: 414 IFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFK-DEYPKALTYLLTHPLFPPVHA 472

Query: 538 XXXXXXXXDQPRLFKQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQ 597
                   + PRLFKQAIVTC            F+I N EL  DI+ R+LQD+ ++SIK 
Sbjct: 473 KGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKA 532

Query: 598 EMKKLSKLDVQNFIEFITSGGEDSS------PECFNPXXXXXXXXXXXXXXDSIGLFSLE 651
            ++K+ K+D+ NF++ I +  +  S      P+ F                DSIGLF+L+
Sbjct: 533 GIRKIEKMDITNFLDMILNSNKADSDLKLNKPQIFQ---------LMSLIIDSIGLFALD 583

Query: 652 GALLENLTLYIDKQVEIAERNTELWNLID--TKGFQHGFASSTFDNGTSQKRALPTYTME 709
              LE L+ ++D QV +  +N EL +L +  TK        S     +S  + +  YT++
Sbjct: 584 DEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVD 643

Query: 710 YLD 712
           YL+
Sbjct: 644 YLE 646

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  258 bits (659), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 155/402 (38%), Positives = 222/402 (55%), Gaps = 38/402 (9%)

Query: 321 ISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTI 380
           +SF P+S+NR LLT +N +YLLDLLH + LSQRE THVKTFQLL +AVI    S N+ TI
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTI 60

Query: 381 AIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSFQVGNNDSSVILKPLFDDKDINDKR 440
           AIG++TK G   TSSL+++NIDVGT TLKDS+GK F                       +
Sbjct: 61  AIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLSSKT------------------K 102

Query: 441 VKCND----VSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRY 496
           V+C         D+ V   +  ++++ L+  + N    FD +FFK+L IK ++YT+ DR+
Sbjct: 103 VQCPQSLLGTPNDTEVQEHNYTQILKDLAKTKSNS-DKFDSVFFKKLNIKNDYYTDSDRF 161

Query: 497 ISDPGFLNKVLDLIFGKFSGNDYPKXXXXXXXXXXXXXXXXXXXXXXXXDQPRLFKQAIV 556
           ++D  FL   L LIF  F   +YPK                        D PRLFKQAIV
Sbjct: 162 LNDQEFLGNSLKLIFENFQS-EYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIV 220

Query: 557 TCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITS 616
           TC            F++ N EL LD+S RILQDF++DSIK  +K+ SK+DV  FI F+ +
Sbjct: 221 TCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMN 280

Query: 617 GGED-----SSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTLYIDKQVEIAER 671
              D     + P  F                DS+GLF+LE   L+ L+ YID+Q+ + ++
Sbjct: 281 ENVDEDRVKNKPRLFQ---------LLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQ 331

Query: 672 NTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713
           N +L+NL+D + F++       D+ +  + A+  Y++E L++
Sbjct: 332 NVQLYNLVDERNFKNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  206 bits (523), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 176/588 (29%), Positives = 284/588 (48%), Gaps = 88/588 (14%)

Query: 154 NKAYTGSDEFLSQYKIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFD-------FKLTLL 206
           N+ YT     L+  K+  ++K+M  K+ +  S  I IL+NG IE +D       +K    
Sbjct: 82  NQKYTLH---LNGKKVPIQSKIM--KLFSDESQTITILENGTIEKYDSNLIKSTYKTPHK 136

Query: 207 HSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESSPIKELSSTI 266
              ++ +   KYA   ++N          L D     +L  + +      S  K L    
Sbjct: 137 DLVNVEFIESKYALLISQNS-------ISLYDINTMIELRNVANVQDIVDSDFKSLD--- 186

Query: 267 IEGFSFENSKLCYQFGKLYKLNQ--GKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQ 324
                          GKLY+ NQ   K  I+ +    +  +I  P ++ +    D++SF 
Sbjct: 187 ---------------GKLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVE--KDVVSFT 229

Query: 325 PVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGI 384
            V  N V++ VN+ IY L+L   S +S  EL ++K F+L+ +          S    +G+
Sbjct: 230 VVDDNCVVMAVNSTIYALNLHLSSVISMSELLNLKWFKLIDNL---------SNQFVLGL 280

Query: 385 STKNGPNPTSSLEIINIDVGTN-TLKDSLGKSFQ-----VGNNDSSVILKPLFDDKDIND 438
           S  N        E+IN+D+ +N  LKDSLGK F+       +   +++LK LF   + ++
Sbjct: 281 SFNNE---NYKFELINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADE 337

Query: 439 KRVKCNDVSGDSSVPVLHC---NEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDR 495
                 D+  DS   V H    +++I  L+    N  + FD IFF++  IK+EHYTE DR
Sbjct: 338 ------DLHNDSDSDVEHTFNYDKIIVDLNKAVKNP-SKFDKIFFEKFNIKKEHYTEADR 390

Query: 496 YISDPGFLNKVLDLIFGKFS----GNDYPKXXXXXXXXXXXXXXXXXXXXXXXXDQPRLF 551
           ++ +  FL KV++LI   +     GN+YPK                        + PRL+
Sbjct: 391 FLVNQDFLAKVIELILQNYKFDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLY 450

Query: 552 KQAIVTCXXXXXXXXXXXXFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFI 611
           KQAIVTC            F+I N EL LDIS R+LQD+T+DSIK+++K L K+D++NFI
Sbjct: 451 KQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFI 510

Query: 612 EFITSG-GEDSSPECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTLYIDKQVEIAE 670
           EF+T    +  S + F                DSIGLF+L+  +L  ++ +I+++  +A+
Sbjct: 511 EFVTQDEDQQVSSQLFQ---------LLSLIIDSIGLFALDMDILGRISNFINEKTLVAK 561

Query: 671 RNTELWNLIDTKGFQHGFASSTF-----DNGTSQKRALPTYTMEYLDI 713
           +N+EL +L+D    +   A  +      +N +  ++ LPTYT+E+LD+
Sbjct: 562 QNSELLHLLDYNPSKQSSARQSSKLINNNNKSLHRKTLPTYTVEHLDL 609

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 1  MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
          MPS+SQPF + T+PK +S S        + V+  +   ++N++ +            NPT
Sbjct: 1  MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61 PKLTFDYPIPSTNIITA 77
          PKL    PIPS  ++TA
Sbjct: 54 PKLINSIPIPSNEVVTA 70

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  204 bits (518), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 180/572 (31%), Positives = 264/572 (46%), Gaps = 94/572 (16%)

Query: 171 AKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYV 230
           A    +S KI  ++ +  AILQ+G ++                   KY       G E V
Sbjct: 101 AVVNCLSEKIHDESVVTTAILQDGTVQ-------------------KY------KGGEQV 135

Query: 231 FV-LCPLQDDKVCYKLLELTD-----CGSGESSPIKELSS----TIIEGFSFENSKLCYQ 280
           F    PL+D     K +E  D       + +S+ + EL +     +     FE  K   Q
Sbjct: 136 FAKHLPLKD----IKQVEFIDGQYALIVAAQSTALYELENLTELRVSTTLHFEQFKQIRQ 191

Query: 281 -FGKLYK--LNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNN 337
             GK+Y+  L      I+ L       V+  P +   S G  L +F  V  +RV L + N
Sbjct: 192 HLGKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSA-SKGAPL-TFTVVGDSRVCLALAN 249

Query: 338 VIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTS-SL 396
            IYLLDL   S LS  +   +K  +L+  A           + AI +S  +GP   + SL
Sbjct: 250 EIYLLDLHLGSVLSHNKFAQLKQVELIAGA--------RDGSFAIALS--HGPQDNAVSL 299

Query: 397 EIINIDVGTNTLKDSLGKSF-----QVGNNDSSVILKPLFDDKDINDKRVKCNDVSGDSS 451
           +IIN+++G+ ++KDSLGK F     +  + +S V L+P+ D              +GD +
Sbjct: 300 DIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPILD--------------AGDKT 345

Query: 452 VPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIF 511
                   +++KL+A    D   FD IFFKEL I +E YTE DR+I D  FL++ + +I 
Sbjct: 346 KRSFDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVIL 404

Query: 512 GKFS---GNDYPKXXXXXXXXXXXXXXXXXXXXXXXXDQPRLFKQAIVTCXXXXXXXXXX 568
             +S    + YP                           PRL+KQ IVTC          
Sbjct: 405 KNYSFEPSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLT 464

Query: 569 XXFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDS------S 622
             F I N EL LD+S +ILQD+T+DSIK+EMK L +++V NFI+F+     +S      +
Sbjct: 465 ESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVAT 524

Query: 623 PECFNPXXXXXXXXXXXXXXDSIGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTK 682
           P+ F                DSIGLF+L+G LL  L  YID  V+IAE NTELWNL++ +
Sbjct: 525 PQLFQ---------LLSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFR 575

Query: 683 GFQHGFASSTFDNGT-SQKRALPTYTMEYLDI 713
             +   A S       +QK+  P Y +++L+I
Sbjct: 576 TNKASVAGSNRSKYVKTQKKVFPPYLVDHLEI 607

 Score = 35.4 bits (80), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 7/75 (9%)

Query: 3  SLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPTPK 62
          S+SQPF +A +P+ AS +        V ++  +   + N + +            NPTPK
Sbjct: 4  SISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63 LTFDYPIPSTNIITA 77
          L     IPS   +TA
Sbjct: 57 LVNSKAIPSNLTVTA 71

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  130 bits (328), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 130/250 (52%), Gaps = 40/250 (16%)

Query: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+N++ Q  Y+QVAD T   +TN + +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVAD-TLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLTFDYPIPSTNIITACN-AEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFG 119
           PKL ++ PI STN++TAC+ AE    N +G  EA                    E+  + 
Sbjct: 60  PKLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAH-------------------EVLCYA 100

Query: 120 LMVNKGNYTLNVITKALED-TTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSI 178
           L  NK  +++  + K +    TD+S                  E  + +K+    + +++
Sbjct: 101 LQANK-TFSICAVKKPIPSAATDSS----------------FGETYATHKVALANQAVNV 143

Query: 179 KIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWF-TENGTEYVFVLCPLQ 237
           K+      ++A+L +GLI+ FD+ L L HS D SY N+++ + F +E+  +++F+L  L 
Sbjct: 144 KVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLD 203

Query: 238 DDKVCYKLLE 247
             KV +KLL+
Sbjct: 204 GRKVSFKLLK 213

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 38.1 bits (87), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 65/134 (48%), Gaps = 18/134 (13%)

Query: 302 LQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCST---LSQRELTHV 358
           L  V +F + DK++P    +SF+P+ V  +L   N  I L +L+ C++    S   L  V
Sbjct: 322 LSVVYDFYIFDKINPEPSNLSFRPMLVKGLL--NNRFILLPNLVTCASAIAFSGYMLYSV 379

Query: 359 KTFQL-LKSAVINSE--------KSHNSKTIAIGISTKNG---PNPTSSLEIINIDVGTN 406
           + FQL + S+  N+          S  S  I  GI  K G   P   S++ I+ I  G +
Sbjct: 380 QFFQLVMGSSAWNAGLHLIPLVIASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVS 439

Query: 407 TLKDSL-GKSFQVG 419
           TL D+  G S Q+G
Sbjct: 440 TLLDNHSGNSMQIG 453

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 23/124 (18%)

Query: 260 KELSSTIIEGFSFENSKLC----------YQFGK-LYKLNQGKIYIYSLPHCQL---QQV 305
           K L + II  F F    LC            FG   Y  N G++  Y +    L     V
Sbjct: 245 KRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLGVLLFIFSLV 304

Query: 306 IEFPMVDKLSPGDDLISFQPVSVNRV-----LLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
            +F + DK +P  D IS++P+ + R+     ++ VN V +LL    C+  + + +  V+ 
Sbjct: 305 YDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLL----CTGYNGQMIYSVQF 360

Query: 361 FQLL 364
           FQL+
Sbjct: 361 FQLI 364

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 56/124 (45%), Gaps = 23/124 (18%)

Query: 260 KELSSTIIEGFSFENSKLC----------YQFGK-LYKLNQGKIYIYSLPHCQL---QQV 305
           K L + II  F F    LC            FG   Y  N G++  Y +    L     V
Sbjct: 121 KRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFSLV 180

Query: 306 IEFPMVDKLSPGDDLISFQPVSVNRV-----LLTVNNVIYLLDLLHCSTLSQRELTHVKT 360
            +F + DK +P  D IS++P+ + R+     ++ +N V +LL    C+  + + +  V+ 
Sbjct: 181 YDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLL----CTGYNGQMIYSVQF 236

Query: 361 FQLL 364
           FQL+
Sbjct: 237 FQLI 240

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 22/115 (19%)

Query: 261 ELSST----IIEGFSFENSKLCYQFGKL--YKLNQGKIYIYSLPHCQLQQVIEFPMVDKL 314
            LSST     + G +F  +K  +  G++  Y +    ++I+SL       V +F + DK 
Sbjct: 269 ALSSTGLVLFLLGLTFGGNKYTWSSGQVITYLVLGIVLFIFSL-------VYDFFLFDKF 321

Query: 315 SPGDDLISFQPVSVNRV-----LLTVNNVIYLLDLLHCSTLSQRELTHVKTFQLL 364
           +P  D IS++P+ + R+     ++ VN V +LL    C+  + + +  V+ FQL+
Sbjct: 322 NPERDNISYRPLFLRRLVAKPAIIIVNMVTFLL----CTGYNGQMIYSVQFFQLI 372

>TDEL0H01410 Chr8 (240642..240693,240799..241274) [528 bp, 175 aa]
           {ON} Anc_4.292 YKL190W
          Length = 175

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 57/110 (51%), Gaps = 17/110 (15%)

Query: 231 FVLCP-LQDDKVCYKLLELTDCGSGESSPIKELSS--TIIEGFSFENSKLCYQFGKLYKL 287
           F++ P +  + +  +++E+ D  +  S   +E  S  +I  G   ++ KL + F K+Y +
Sbjct: 46  FMMIPGVSSNPLAGRIMEVFDADNNGSVDFQEFISGLSIFSGRGSKDEKLKFAF-KIYDI 104

Query: 288 NQ------GKIYIY-------SLPHCQLQQVIEFPMVDKLSPGDDLISFQ 324
           ++      G+++I        +L   QLQQV++  +V+  S GD  +SF+
Sbjct: 105 DKDGYISNGELFIVLKIMVGNNLDDEQLQQVVDRTIVENDSDGDGHLSFE 154

>ZYRO0E08074g Chr5 complement(633136..634914) [1779 bp, 592 aa] {ON}
           similar to uniprot|P38687 Saccharomyces cerevisiae
           YPL243W SRP68 Component of the signal recognition
           particle (SRP) ribonucleoprotein (RNP) complex that
           functions in protein targeting to the endoplasmic
           reticulum (ER) membrane
          Length = 592

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 646 GLFSLEGALLENLTLYIDKQVEIAERNTELWNLID 680
           GL+ L+G  LE+L L++D   ++ ER TE+ N  D
Sbjct: 420 GLYQLKGRYLESLALHVDAHQKLEERLTEMGNFQD 454

>TBLA0D01940 Chr4 complement(480209..483445) [3237 bp, 1078 aa] {ON}
           
          Length = 1078

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 13/132 (9%)

Query: 161 DEFLSQYKIKAKAKVMSIKIDTKNSLVI----AILQNGLIEIFDFKLTLLHSFDIS---- 212
           D  L+ YKI     +    I++ +  +I    +  ++  ++I+D++L L  SF+I     
Sbjct: 774 DTSLTAYKIIKNVPIQMEYIESIDKFIILNQNSQTRHVYLQIYDYQLNLTDSFEIHKLCE 833

Query: 213 YDNLKYAKWFTENGTEYVFVLCPLQDDKVCYKLLELTDCGSGESS-PIKELSSTIIEGFS 271
           + N  Y  W   N + Y+F+ C         ++ EL   G  + +  I E ++ ++   S
Sbjct: 834 HSNFTYVSW---NISHYIFLNCVENGKLSIIRIFELNYRGRLKGTRKIVENNNFLVSTIS 890

Query: 272 FEN-SKLCYQFG 282
           F    KL Y FG
Sbjct: 891 FSKYDKLLYLFG 902

>KLTH0G03586g Chr7 complement(275721..277586) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q04049 YDR419W Saccharomyces
           cerevisiae RAD30 DNA polymerase eta involved in the
           predominantly error-free bypass replication of DNA
           lesions
          Length = 621

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 283 KLYKLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNV 338
           K+ KLN GK  +YSL   Q+QQ+ +   + +L+ GD  + F P  V + +++  N+
Sbjct: 339 KIRKLNSGKEKLYSLDDAQVQQMAD--KIFQLARGDFKMPFNPRPVIKSMMSNKNL 392

>KNAG0D01560 Chr4 complement(262229..263146) [918 bp, 305 aa] {ON}
           Anc_7.253 YIL063C
          Length = 305

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 41/80 (51%), Gaps = 3/80 (3%)

Query: 87  IDGNIEASTDDEANNEKTINTQKKR-NVEIWAFGLMVNKGNYTLNVITKALEDTTDTSND 145
           ++ + EAS D  A  E T+  +KK    + +AFG   + G+   NV+ K  E T +T ++
Sbjct: 90  VNKDSEASPDSSAQKEDTVEAEKKELRTKPFAFGSKFSFGS-GFNVLKKT-EGTPETGDN 147

Query: 146 HLSESDIDNKAYTGSDEFLS 165
              ES  +NK+    DE  S
Sbjct: 148 TPHESSPENKSGVSGDERSS 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,343,148
Number of extensions: 3416406
Number of successful extensions: 13231
Number of sequences better than 10.0: 84
Number of HSP's gapped: 13605
Number of HSP's successfully gapped: 88
Length of query: 713
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 596
Effective length of database: 40,065,477
Effective search space: 23879024292
Effective search space used: 23879024292
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)