Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR127W3.487ON31231215860.0
Smik_6.2233.487ON31331313430.0
Suva_7.4153.487ON31331313170.0
Skud_7.4383.487ON31331313060.0
NCAS0E008403.487ON3363257801e-102
CAGL0I10582g3.487ON3193257425e-97
NDAI0G009703.487ON3323387298e-95
KAFR0C019303.487ON3133226983e-90
SAKL0F02882g3.487ON2983156946e-90
Kpol_1017.93.487ON3103246401e-81
KNAG0B008403.487ON3133206305e-80
TDEL0D055503.487ON3103156243e-79
KLLA0E04687g3.487ON3063206095e-77
TPHA0D032603.487ON3143206011e-75
AFR305W3.487ON3093205374e-66
KLTH0F14718g3.487ON3003155271e-64
Kwal_55.212173.487ON3033135261e-64
ZYRO0D10098g3.487ON2762605162e-63
Ecym_12423.487ON3113225104e-62
TBLA0D029903.487ON3183244751e-56
Smik_5.871.450ON56064750.80
KLLA0A00176gsingletonON46998731.1
SAKL0E07018g2.311ON107971712.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR127W
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   615   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   521   0.0  
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   511   0.0  
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   507   0.0  
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   305   e-102
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   290   5e-97
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   285   8e-95
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   273   3e-90
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   271   6e-90
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   251   1e-81
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   247   5e-80
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   244   3e-79
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   239   5e-77
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   236   1e-75
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   211   4e-66
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   207   1e-64
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   207   1e-64
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   203   2e-63
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   201   4e-62
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   187   1e-56
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    33   0.80 
KLLA0A00176g Chr1 complement(10102..11511) [1410 bp, 469 aa] {ON...    33   1.1  
SAKL0E07018g Chr5 complement(578410..581649) [3240 bp, 1079 aa] ...    32   2.5  

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/312 (96%), Positives = 301/312 (96%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120
           GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK
Sbjct: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120

Query: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180
           STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW
Sbjct: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180

Query: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTMNTI 240
           EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTMNTI
Sbjct: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTMNTI 240

Query: 241 YVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSVT 300
           YV           GASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSVT
Sbjct: 241 YVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSVT 300

Query: 301 SPKEEKRFKFKL 312
           SPKEEKRFKFKL
Sbjct: 301 SPKEEKRFKFKL 312

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/313 (79%), Positives = 283/313 (90%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHN+DFILSPYDLA+TS E Q FGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLARTSKEGQEFGTWS 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120
           GINKEGKLATILNLKL +E++  KS+SRGLLP+IFLS H+A+F+DWD+Y KF  HYDGLK
Sbjct: 61  GINKEGKLATILNLKLGSERSTIKSKSRGLLPYIFLSNHEANFKDWDSYSKFGNHYDGLK 120

Query: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180
           +TGDFNFFYGDVI+KQYKVIDSLGRTFDVLSSTCRKDLDSYMV+SNG+FY++SSIP +AW
Sbjct: 121 ATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKAW 180

Query: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM-VDPNVTMNT 239
           EKVK+ARDSLE+LV +NI  DEE IISSCFQLASKSSLP T+S PDVLQM VDPNVTM+T
Sbjct: 181 EKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMST 240

Query: 240 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299
           IYV           GASIPDGD+YGTRSQIVLL+SKDST+ TFIER++YSSDEDVR+YSV
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIYSSDEDVRQYSV 300

Query: 300 TSPKEEKRFKFKL 312
           ++PKEEKRF+F+L
Sbjct: 301 SAPKEEKRFEFEL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  511 bits (1317), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 278/313 (88%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCILMATRAHP YELILISNRDEFL RKTHATCWHN+DFILSPYD+AKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSMEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120
           GINKEGKLATILNLK+D++++ TKS+SRG+LPF FL+ HKA F+DWD+Y KFE HYDGL+
Sbjct: 61  GINKEGKLATILNLKMDDQRSCTKSKSRGMLPFTFLTSHKARFQDWDDYNKFEKHYDGLR 120

Query: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180
           +TGDFNFFYGDVI+K+YKVIDSLG TFDVL STCR+D DSYMV+SNGK+++SSSI  QAW
Sbjct: 121 TTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQAW 180

Query: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM-VDPNVTMNT 239
           EKVK+ARDSLE L+L+NIESDEE +IS+CFQLASKSSLP T   PD+LQM VDPNVTMNT
Sbjct: 181 EKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNT 240

Query: 240 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299
           IYV           GASIPDGDYYGTRSQIVLLVSKDS++VTFIERVLYSSDEDV  YS 
Sbjct: 241 IYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSDEDVSHYSA 300

Query: 300 TSPKEEKRFKFKL 312
           ++PKEEKRF+F+L
Sbjct: 301 SAPKEEKRFEFEL 313

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  507 bits (1306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/313 (77%), Positives = 274/313 (87%), Gaps = 1/313 (0%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCILMATRAHPDYELILISNRDEFLARKTHATCWHN+DFILSPYDLAKTS EKQIFGTWS
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAKTSKEKQIFGTWS 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYDGLK 120
           GIN+EGKLATILNLKLD +++  KS+SRGLLPF FLS HKADF++WDNY KFE +YDGL 
Sbjct: 61  GINREGKLATILNLKLDGQRDTIKSKSRGLLPFTFLSTHKADFQNWDNYDKFEMNYDGLN 120

Query: 121 STGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQAW 180
           +TGDFNFFYGDVI+KQYK+IDSLGRTF+VL STC+ +L+SYM VSNG+FY+S SI  QAW
Sbjct: 121 TTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQAW 180

Query: 181 EKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMV-DPNVTMNT 239
           +KVKVARD LE LVL NI+SDEE IIS+CFQLASKSS+P T S P+ LQM+ DPNV MNT
Sbjct: 181 KKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNT 240

Query: 240 IYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKYSV 299
           IYV           GASIPDGDYYGTRSQIVLLVSK+S++VTFIER+LYSSDEDV  YSV
Sbjct: 241 IYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSDEDVNHYSV 300

Query: 300 TSPKEEKRFKFKL 312
            +PKEEKRF+FKL
Sbjct: 301 ATPKEEKRFEFKL 313

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  305 bits (780), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 211/325 (64%), Gaps = 25/325 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSA--EKQIFGT 58
           MCIL+AT AHP YELILISNRDEF  RKTH +CWHN+DFILSP+D+AK+    EK+IFGT
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHEKKIFGT 76

Query: 59  WSGINKEGKLATILNLKLDNE---QNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGH 115
           W GIN++ K+ATILNLKL+++   +   K +SRG++PF+FLS H +DF  WD Y+KF+G 
Sbjct: 77  WIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWDTYEKFDGK 136

Query: 116 YDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSI 175
           Y+ L+ TGDFNFFYGD +  +Y++IDS G TF VLS       D Y+ VSN  F      
Sbjct: 137 YNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSG------DPYLTVSNDMFATGGIT 190

Query: 176 PGQA-------WEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVL 228
             +A       W K+K  +  L++LV E+   DE+ +I  CF+LAS  S+      P   
Sbjct: 191 VERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSV-----QPKEN 245

Query: 229 QMVDPNVT--MNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERV 286
              + N T  M TI+V           G S+  G YYGTRSQIV+L+SK+  RV  +E +
Sbjct: 246 TKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLVEHI 305

Query: 287 LYSSDEDVRKYSVTSPKEEKRFKFK 311
           LY+SD D++ YS T+PKE K F+FK
Sbjct: 306 LYTSDNDIQHYSSTNPKEVKSFEFK 330

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  290 bits (742), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 211/325 (64%), Gaps = 20/325 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQ--IFGT 58
           MCIL ATR HPDYELI+ISNRDEFL RKTH+TCWHN+DFILSPYDLA+  A +    FGT
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLARIGAGQSNDTFGT 60

Query: 59  WSGINKEGKLATILNLKLDNEQNNTK---SRSRGLLPFIFLSIHKADFEDWDNYKKFEGH 115
           W+G+N++G++AT+LNL++ +E +  +    RSRG LPF+FL+  + +FEDWD Y KF   
Sbjct: 61  WTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKFCKC 120

Query: 116 YDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNG-------K 168
           Y  +K TGDFN FYGD  + +Y +IDSLG T  + S   +     Y+V+SN        +
Sbjct: 121 YPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGK----GYLVISNNIHDKLHLQ 176

Query: 169 FYDSSSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNP-DV 227
             D +S P + W K+K  +  +E  V  N    +E +I +CF+LAS + +   I+   D+
Sbjct: 177 SQDINSGP-EEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEFDL 235

Query: 228 LQMVDPNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVL 287
           ++ +   VT  TIYV           G+ +  G YYGTRSQIVLLV K  T+ TFIER++
Sbjct: 236 VKSL--GVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293

Query: 288 YSSDEDVRKYSVTSPKEEKRFKFKL 312
           YSSD+D+  YS ++PKEE R+++ +
Sbjct: 294 YSSDQDISLYSTSNPKEELRYEYDI 318

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  285 bits (729), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 155/338 (45%), Positives = 210/338 (62%), Gaps = 34/338 (10%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSA--EKQIFGT 58
           MCIL+AT AHPDYELILISNRDEFL RKTH +CWHN+DFILSPYD+AK     +K++FGT
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYNDKKVFGT 60

Query: 59  WSGINKEGKLATILNLKLDNE---QNNTKSRSRGLLPFIFLSIHKAD-FEDWDNYKKFEG 114
           W GINK+GK+AT+LNLKL+     +     +SRG+LPF++LS    D F +WD Y  F  
Sbjct: 61  WLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDNFTK 120

Query: 115 HYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSS 174
            Y GL+STGDFN FYGDV +KQY+++DS+G T   L+S C+     Y+VVSN  F  +  
Sbjct: 121 KYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQ-----YLVVSNDVFTCNGQ 175

Query: 175 IPG------------------QAWEKVKVARDSLENLVLENI--ESDEEKIISSCFQLAS 214
           +                    + W KVK+    L++LV ++I  + DE+ IIS CF+L+S
Sbjct: 176 LGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFKLSS 235

Query: 215 KSSLPSTISNPDVLQMVDPNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVS 274
             S+  T+ +       +  +   TI V           G S+P G+YYGTRSQIV+L+ 
Sbjct: 236 TCSV--TVEDHCKFHQ-NSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIK 292

Query: 275 KDSTRVTFIERVLYSSDEDVRKYSVTSPKEEKRFKFKL 312
           + +  V F E V+Y+SD D++ +S  +PKE  RF F L
Sbjct: 293 RGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTL 330

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  273 bits (698), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 143/322 (44%), Positives = 207/322 (64%), Gaps = 20/322 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE-KQIFGTW 59
           MCIL ATR+H +YELILISNRDE+L RKTH TCWHN++FILSPYD+++      +IFGTW
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENHGNKIFGTW 60

Query: 60  SGINKEGKLATILNLKLDNE---QNNTKSRSRGLLPFIFLS---IHKADFEDWDNYKKFE 113
            G+NK+GK+ATILNL+  +    +   K RSRGL+PF FL     ++  FE+W+ ++KF+
Sbjct: 61  LGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYSDWTNEDSFEEWETFEKFK 120

Query: 114 GHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSS 173
             Y  L+S+GDFNFFYGD+ +  Y++IDSLG TF VL +  R      M++SN  +    
Sbjct: 121 SKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN-----MIISNDLYQHKD 175

Query: 174 SIPGQ-AWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232
              G+  W K+K+  + L   + E   S+E+++++ CF+LAS  S+ S+I+  +     +
Sbjct: 176 EYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFELASYCSIDSSITREE-----N 230

Query: 233 PN--VTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSS 290
           PN  +   TIYV           G +  +G YYGTR+QIV+LV KD   VT +E  +++S
Sbjct: 231 PNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVHKDRKHVTLVEHTIHNS 290

Query: 291 DEDVRKYSVTSPKEEKRFKFKL 312
           DE++ KYS  +PKE +R  F +
Sbjct: 291 DEEIYKYSGLNPKEVQRLDFTI 312

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  271 bits (694), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 197/315 (62%), Gaps = 20/315 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCIL+ T AHP Y LILISNRDEF  R+TH TC H++DFI+SP+D++ T+  +  FGTW 
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMSITTKGRN-FGTWC 59

Query: 61  GINKEGKLATILNLKL---DNEQNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117
           G+NK+GK+A ILNL++    N +N    +SRG++P  FL+    DF +WD+Y+KF  HY 
Sbjct: 60  GVNKDGKVAVILNLRIASCGNPKNVECPQSRGIVPMKFLAGKDVDFNNWDSYEKFSHHYP 119

Query: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177
           G++ TG+FN FYGD  K +YK+I SL  T D   +      D YMVVSN           
Sbjct: 120 GIEKTGNFNLFYGDCSKGEYKLISSLSETTDGFQND-----DGYMVVSNDLISSK----- 169

Query: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237
           + W K+ +A++ L NLV  +++  ++ I+  CF+LAS S+    I       +   +VT 
Sbjct: 170 KKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHSTCSEKIV------VKHESVTN 223

Query: 238 NTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297
            TIYV             S+P G YYGTRSQIV+LVSKD  ++TF+ERVLY+ DEDV KY
Sbjct: 224 ETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFVERVLYTCDEDVLKY 283

Query: 298 SVTSPKEEKRFKFKL 312
              +PKE+  F+F +
Sbjct: 284 GPKNPKEQIEFEFDI 298

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  251 bits (640), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 148/324 (45%), Positives = 208/324 (64%), Gaps = 26/324 (8%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDF--ILSPYDLAKTSAEKQI--F 56
           MCIL+A+R HP+Y+LILISNRDEFL R+TH TCW+  ++  IL PYD++K S EK +   
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-SNEKNVNKI 59

Query: 57  GTWSGINKEGKLATILNLKLDNE-QNNTKS--RSRGLLPFIFLSIHKAD-FEDWDNYKKF 112
           GTW GIN+ G+++TILNLK D+  Q++  S  +SRG LP  FL   + D   +WD+Y+KF
Sbjct: 60  GTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIKFLDNKETDSLLNWDSYEKF 119

Query: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172
              Y  +K TGDFNFFYGDV   +Y VIDS+G T +VL+       + Y+V+SN KF  S
Sbjct: 120 VKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVD-----NPYLVISNDKFGKS 174

Query: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232
           +    + WEK+ +A++ L++L L   E D   +I  CF +AS ++L     N D+++ VD
Sbjct: 175 NGKSTKEWEKITLAKNLLKHLPLCETEDD---LIHKCFDIASTNTL-----NEDLIKDVD 226

Query: 233 PNVTMN-TIYV---XXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLY 288
               M  TI V              GAS+P G YYGTRSQIV+LV+K+ T+V FIER+LY
Sbjct: 227 VRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIVILVNKNRTKVKFIERILY 286

Query: 289 SSDEDVRKYSVTSPKEEKRFKFKL 312
           +SD+DV    ++SP ++  + F +
Sbjct: 287 NSDDDVTTQKLSSPIQDLTYNFTI 310

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  247 bits (630), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 191/320 (59%), Gaps = 17/320 (5%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKT--SAEKQIFGT 58
           MCIL+ TR HPDY+L+LISNRDEF  R TH T WH+ D+ILSPYD+ K      K + GT
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPGKCVRGT 60

Query: 59  WSGINKEGKLATILNLKLDNE------QNNTKSRSRGLLPFIFLSIHKADFEDWDNYKKF 112
           W G+N+ G+++T+LNLKL+ E      +N  K RSRGL+PF+FLS  +   + WD+++KF
Sbjct: 61  WMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS-DRGFIDQWDSFEKF 119

Query: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172
              Y  L+ +GDFN F GD+ ++ YKV+DS G TF VL+ T   +    MVVSN  + + 
Sbjct: 120 RDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYKEF 175

Query: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232
           +      W KVK+ +  L  LV   +  D+   I  CF  AS  S+    S+ D+ +   
Sbjct: 176 NENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFCSIEK--SHEDISKT-- 231

Query: 233 PNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292
           P V  NTI+V           G +   G Y+GTRSQ+V LVSKD  +VT  ER+L++SD 
Sbjct: 232 PEVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDL 291

Query: 293 DVRKYSVTSPKEEKRFKFKL 312
           D    S  +PKE K+F F L
Sbjct: 292 DRDFNSPHNPKEVKQFTFDL 311

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  244 bits (624), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 135/315 (42%), Positives = 191/315 (60%), Gaps = 10/315 (3%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCIL+AT  HP Y+L+L+SNRDE+ ARK     W  ++F+L P D    S+ + + GTW 
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGLDSSGEDL-GTWI 59

Query: 61  GINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117
           G N++GK+ T+LNLKL ++     +    SRG +P  FLS   A+F+DWD Y KF   + 
Sbjct: 60  GANRDGKIGTVLNLKLFSDPRGRPAVCPESRGKIPVSFLSSRGANFKDWDTYDKFCHQFQ 119

Query: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177
           GL+ T DFNFFYGD     Y+VIDSLG T  VL  T  K    Y+VVSN  F   S+   
Sbjct: 120 GLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEK----YIVVSNDIFQGESN-KN 174

Query: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237
           + W+K+ +A  +L +LV E  ++DE+K I  CF +AS +   S   + +   M    ++M
Sbjct: 175 RVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINPFHSKHDHGNYY-MKAVELSM 233

Query: 238 NTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297
            T++V           GAS+P G+YYGTRSQ V+LVSKD + +T++ER+++ SD D  +Y
Sbjct: 234 QTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKDRSHITYVERIIHDSDLDALQY 293

Query: 298 SVTSPKEEKRFKFKL 312
           S    KE+KR+ F L
Sbjct: 294 SRDHYKEQKRYDFDL 308

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  239 bits (609), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 136/320 (42%), Positives = 187/320 (58%), Gaps = 24/320 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCIL ATRAHPDY+LIL+SNRDEF  RKTHATCW+++ FILSPYD+A    + Q +GTW 
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA-IEKKGQGYGTWL 59

Query: 61  GINKEGKLATILNLKLDNEQN------NTKSRSRGLLPFIFLSIH-KADFEDWDNYKKFE 113
           GIN+ G++A ILNLK+D+  +      N + RSRG++P  FL     A F++WD+++KF 
Sbjct: 60  GINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDNWDSWEKFN 119

Query: 114 GHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSS 173
           G +  L+ TG F  FYGD    +Y VID L  + +            +MV+SN  F+ + 
Sbjct: 120 GQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM------EHMVISNDIFHCAV 173

Query: 174 SIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDP 233
                 W K +     L+ L        +E+++  CF+L S  +           + VD 
Sbjct: 174 GEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELLSNHTFNEG-------EDVD- 225

Query: 234 NVTMNTIYVXXXXXXXXX-XXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292
           +VT ++IYV            G S+P GDYYGTRSQIV+LV KD+ RVT+ E V+Y SDE
Sbjct: 226 SVTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVILVDKDN-RVTYEEHVIYESDE 284

Query: 293 DVRKYSVTSPKEEKRFKFKL 312
           D   YS   PKE  +F+F +
Sbjct: 285 DCETYSFMDPKEVIQFQFNM 304

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  236 bits (601), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 194/320 (60%), Gaps = 15/320 (4%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWH--NNDFILSPYDLAKTSAEKQIFGT 58
           MCIL  TR+HPDYELILISNRDEFL RKT  +CW+  +N  +L PYDL++   +   FGT
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSRNETDPSKFGT 60

Query: 59  WSGINKEGKLATILNLKLDN---EQNNTKSRSRGLLPFIFLSIHKAD-FEDWDNYKKFEG 114
           W GIN+ G+++++LNLK+D    E  N + +SRG LP  FL   K + F DW++Y KF  
Sbjct: 61  WCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYSKFLK 120

Query: 115 HYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSS 174
            Y  L+ TG FN F GDV K++Y +IDS G+T  +L     ++  S +V+SN +F  +  
Sbjct: 121 QYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGK-DENGKSSVVISNSEFISNDK 179

Query: 175 IPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTI--SNPDVLQMVD 232
              + W K+      ++  + ++I  DE  +I SCF++AS S L +    S+ D+L ++ 
Sbjct: 180 ---ERWHKISNGEKLMDEFLSKDIR-DENSVIESCFKIASTSELTNEYLHSHDDILDLMT 235

Query: 233 PNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292
             V +  I +           GAS+P G +YGTRSQIV+LV+K+ T V ++ERVLY  D+
Sbjct: 236 ETVFVPPIKLENPVEKDNI--GASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYECDD 293

Query: 293 DVRKYSVTSPKEEKRFKFKL 312
           DV K  +  P  E  F++ +
Sbjct: 294 DVSKAGIEKPINELNFEYNI 313

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  211 bits (537), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/320 (39%), Positives = 179/320 (55%), Gaps = 22/320 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE----KQIF 56
           MCIL AT AHP Y+L+LISNRDE+ ARKTH TCW +ND IL+PYD+A   A+        
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMALQDADGLDHGSPC 60

Query: 57  GTWSGINKEGKLATILNLK---LDNEQNNTKSRSRGLLPFIFLS-IHKADFEDWDNYKKF 112
           GTW GIN+ G ++ +LNL     D +   +   SRG +   +L      +++ W+ Y+KF
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYSHRHSRGAVTMEYLKDFDHNNWDSWNTYEKF 120

Query: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172
             H+  L  T  F  FYGDV+  Q+ VI+SLG+T D  S +       Y VVSNG   D 
Sbjct: 121 GAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQS------PYYVVSNGP-SDG 173

Query: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232
           +   GQ W KV       + ++ E+++  EE+++  CF LAS S     +SN  +  + D
Sbjct: 174 AKALGQ-WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQY---VSNQPI-GVHD 228

Query: 233 PNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292
            ++   TI+V             S   G YYGTRS IV+LVS+D   VT  E V++ SD+
Sbjct: 229 DSIPKRTIFV-PALYNLSGQANLSFAAGMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQ 286

Query: 293 DVRKYSVTSPKEEKRFKFKL 312
           D+  YS+ +PKE+   +F L
Sbjct: 287 DLDSYSILNPKEQVTHRFSL 306

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  207 bits (527), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 178/315 (56%), Gaps = 21/315 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCILMA+ AHP Y LI ISNRDEF  RKT  TC +++D+ILSP D A  S  K   GTW 
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTALRSNNKPALGTWC 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSR---SRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117
           G+N++G++A ILNL+          +   SRG +P  +L + +    DW++++KF   Y 
Sbjct: 61  GVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYL-MDRGPSTDWNSFEKFVSKYP 119

Query: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177
            + +  +FN FYGD I  +Y  IDSLG + + L++         +V+SN    DSSS   
Sbjct: 120 QI-TECEFNMFYGDCIAGEYTCIDSLGYSSEALTAN-----KPNLVLSNDHI-DSSS--- 169

Query: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237
             W KV+ A   L+ LV  +    EE++I  CF LAS +  P+ I N D  +      T 
Sbjct: 170 -RWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTE-PAEIDNSDKEEF-----TC 222

Query: 238 NTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297
           ++I++           GAS+P G +YGTRSQIV+LV +    ++F ERVL+ SD +V  +
Sbjct: 223 SSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPLH 282

Query: 298 SVTSPKEEKRFKFKL 312
           S   PKE+ +F   +
Sbjct: 283 SEKHPKEKLQFNLHV 297

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  207 bits (526), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 176/313 (56%), Gaps = 22/313 (7%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAEKQIFGTWS 60
           MCIL+A+ AHP Y LILISNRDEF+ R+T  TC +++D+++SP D+      +   GTW 
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTLKDNNEPNLGTWC 60

Query: 61  GINKEGKLATILNLKLDNEQNNTKSR---SRGLLPFIFLSIHKADFEDWDNYKKFEGHYD 117
           G N+ G++A ILNL+  N  N TK++   SRG +   +L+  K    DW++Y KF     
Sbjct: 61  GANRNGRIAVILNLRTGN-TNQTKTKRIVSRGNVTMRYLT-DKQPASDWNSYAKFASKCP 118

Query: 118 GLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPG 177
            +KS  +FN FYGD     Y  IDS G +F+VL S      + Y+V+SN     ++    
Sbjct: 119 DIKSC-EFNMFYGDCKSGDYTAIDSSGHSFEVLRSQ-----NPYLVISNDSIESATK--- 169

Query: 178 QAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVDPNVTM 237
             W K+++A   + +LV +++   E+ +++ CF LAS         + +V  M    VT 
Sbjct: 170 --WPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHK------QDYNVDHMDKEKVTS 221

Query: 238 NTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDEDVRKY 297
           + I+V           GAS+P G +YGTRSQIV+LVSK+   + F+E VLY SD +   +
Sbjct: 222 SNIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHF 281

Query: 298 SVTSPKEEKRFKF 310
              +PK+   +K 
Sbjct: 282 CAANPKKCVSYKI 294

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  203 bits (516), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 157/260 (60%), Gaps = 10/260 (3%)

Query: 56  FGTWSGINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFLSIHKADFEDWDNYKKF 112
           FGTW GINK+G++ T+LNLKLD            SRG +P  FLS H  D+E W++Y KF
Sbjct: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82

Query: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172
              +  L +TGDFNFFYGD    QYK+IDSL +T DVL++   +D  SYMVVSN  +   
Sbjct: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142

Query: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232
                + W KV++A+ +L  L+ +N+  D++  IS CFQ+AS S  P      + L +  
Sbjct: 143 GE---ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQSEEL-LKS 196

Query: 233 PNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292
            +VT  +I+V           G +   G +YGTRSQIVLLVSKD  +VTF+ERVL++SDE
Sbjct: 197 SDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDE 255

Query: 293 DVRKYSVTSPKEEKRFKFKL 312
            V + S   P E+ +F+F L
Sbjct: 256 QVSQRSPDHPAEQLKFQFDL 275

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  201 bits (510), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/322 (36%), Positives = 176/322 (54%), Gaps = 22/322 (6%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKT------SAEKQ 54
           MCIL+AT  HPDY+LILISNRDEF  R+TH TCWH +  IL+PYD++ +      S  + 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISNSENASDASKAEL 60

Query: 55  IFGTWSGINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFL-SIHKADFEDWDNYK 110
            +GTW GIN+ G ++ +LNLK  +E  N  +   +SRG +   FL  +   +++ W+NY+
Sbjct: 61  SYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYE 120

Query: 111 KFEGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFY 170
           KF  H+  L  T  F  FYGD+    + +IDS  R+ +  SS        Y+V+SN +  
Sbjct: 121 KFSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSK-----QPYVVISNSRV- 174

Query: 171 DSSSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQM 230
            +    G  W+KV      L+ LV  N+   +E ++  CF+LA  S          V+Q+
Sbjct: 175 -NCEDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQFDVN----GVIQV 229

Query: 231 VDPNVTMNTIYVXXXXXXXXXXXGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSS 290
            D ++   TI+V           G S   G+YYGTR+ IV+LV  +   VT  E V++ S
Sbjct: 230 TDTSLPEKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDS 288

Query: 291 DEDVRKYSVTSPKEEKRFKFKL 312
           D+D+   S  +PK +  ++F +
Sbjct: 289 DKDIGLSSAMNPKTKVAYEFDI 310

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  187 bits (475), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 175/324 (54%), Gaps = 42/324 (12%)

Query: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE-------- 52
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW++N  IL PYD++K            
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 53  KQIFGTWSGINKEGKLATILNL------KLDNEQNNTKSRSRGLLPFIFLSIHKADFEDW 106
           K   GTW G+NK+GK+ T+LNL      + D + NN+  +SRGL+P  +L      F+DW
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-LQSRGLIPIKYLCDFDHGFQDW 119

Query: 107 DNYKKF---EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMV 163
           + Y KF    G  DG    G FN F GD+   +Y +I+S+G++  VL        + YMV
Sbjct: 120 NTYDKFIEQNGSIDG--KVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMV 172

Query: 164 VSNGKFYDSSSIPGQAWEKVKVARDSLENLV---LENIESDEEKIISSCFQLASKSSLPS 220
           VSN  + D   +    W K+K     LE L+   L+N   DE +I+  CFQ++S  +L  
Sbjct: 173 VSNINWGDPKKMG--EWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSG 230

Query: 221 TISNPDVLQMVDPNVTMNTIYVXXXXXXXXXXXGASIPDG---------DYYGTRSQIVL 271
              + ++ ++     T + I+V           G +  D           YYGTRSQIV+
Sbjct: 231 KKIDGNIERL---EQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVV 287

Query: 272 LVSKDSTRVTFIERVLYSSDEDVR 295
           L  + S +VTF+ER+L+  +ED +
Sbjct: 288 LCERKSNKVTFVERILHCKNEDAK 311

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 150 LSSTCRKDLDSYMVVSNGKFYDSSSIPGQAWEK-VKVARDSLENLVLEN-IESDEEKIIS 207
           LS  CR DL    + +NG F ++ S  G++++K V+++R  +E  V+   IE  E+K IS
Sbjct: 492 LSKNCRYDLVGKGLGANGFFVNTLSELGRSFQKAVQLSRTKMETSVINVIIEPGEQKQIS 551

Query: 208 SCFQ 211
             +Q
Sbjct: 552 FAWQ 555

>KLLA0A00176g Chr1 complement(10102..11511) [1410 bp, 469 aa] {ON}
           similar to uniprot|P24031 Saccharomyces cerevisiae
           YBR092C PHO3 Constitutively expressed acid phosphatase
           similar to Pho5p; brought to the cell surface by
           transport vesicles; hydrolyzes thiamin phosphates in the
           periplasmic space, increasing cellular thiamin uptake;
           expression is repressed by thiamin
          Length = 469

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 44/98 (44%), Gaps = 17/98 (17%)

Query: 106 WDNYKKFEGHYDG-LKSTGDFNFFYGDVIKKQYKVIDSLGRTFDV------LSSTCRKDL 158
           WD  K F+G +DG L+   D+ FF  D      K  D L  + DV      + S   + L
Sbjct: 94  WDKLKVFQGQFDGPLEIFNDYEFFVSDT-----KYFDQLTNSSDVDPSNPYMGSKTAEIL 148

Query: 159 DSYMVVSNGKFYDS-----SSIPGQAWEKVKVARDSLE 191
             Y+  + G+ + +     +S  G+ ++  K A  +LE
Sbjct: 149 GKYIAFNYGELFGNYTPVFTSSSGRVYQTAKYAVSALE 186

>SAKL0E07018g Chr5 complement(578410..581649) [3240 bp, 1079 aa]
           {ON} highly similar to uniprot|P22855 Saccharomyces
           cerevisiae YGL156W AMS1 vacuolar alpha mannosidase
          Length = 1079

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/71 (21%), Positives = 34/71 (47%), Gaps = 3/71 (4%)

Query: 172 SSSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMV 231
           +  +PG +W+K +     + N++++  +  + K +  C +L         + +P+V Q  
Sbjct: 225 ARELPGNSWQKHRARH--VGNIIMDLFDPGDPKSVEKCRELCHAEMFDKFVESPEVYQQG 282

Query: 232 DPNVTMNTIYV 242
           D  V MN ++ 
Sbjct: 283 DSQV-MNNVFA 292

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,482,500
Number of extensions: 1516448
Number of successful extensions: 4721
Number of sequences better than 10.0: 41
Number of HSP's gapped: 4776
Number of HSP's successfully gapped: 41
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)