Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR126W3.486ON23023010621e-148
Smik_6.2223.486ON2302309651e-133
Skud_7.4373.486ON2302309451e-130
Suva_7.4143.486ON2302309241e-127
NCAS0E008503.486ON2302305154e-65
CAGL0I10604g3.486ON2112304866e-61
TDEL0D055403.486ON2162384172e-50
NDAI0G009803.486ON2342284156e-50
KAFR0C019203.486ON2232394076e-49
KNAG0B008503.486ON2252323973e-47
KLTH0F14696g3.486ON2191573563e-41
SAKL0F02904g3.486ON2221513321e-37
Kwal_55.212153.486ON1421443191e-36
TPHA0D032503.486ON2192302432e-24
Kpol_1017.103.486ON2342372275e-22
KLLA0E04709g3.486ON1661492219e-22
KLTH0G02266g3.503ON644671543e-11
Kwal_47.189193.503ON640671518e-11
KLLA0E03829g3.503ON609831519e-11
KAFR0C020303.503ON624721492e-10
AFR322C3.503ON592631464e-10
CAGL0I10384g3.503ON630881448e-10
TDEL0D057103.503ON6161011439e-10
KNAG0B007303.503ON622821439e-10
Skud_16.4503.503ON622731384e-09
YPR156C (TPO3)3.503ON622731375e-09
Smik_16.4083.503ON622711376e-09
NDAI0I027703.503ON626901367e-09
NCAS0F036203.503ON634711351e-08
YGR138C (TPO2)3.503ON614721341e-08
Suva_7.4253.503ON613721341e-08
Skud_7.4483.503ON611721332e-08
Suva_16.4843.503ON622731332e-08
Smik_6.2333.503ON614721332e-08
NCAS0E007503.503ON620731313e-08
TPHA0D033103.503ON613781305e-08
TBLA0D029003.503ON691881288e-08
SAKL0F02442g3.503ON610721271e-07
Kpol_1017.33.503ON621821242e-07
ZYRO0G19646g3.503ON594821172e-06
ZYRO0D08998g6.308ON842122810.088
ZYRO0F14036g8.350ON28062740.45
Kpol_1025.28.228ON150773730.85
KAFR0L011007.271ON61874692.5
Suva_4.4706.104ON66336683.6
Skud_10.3624.373ON1581111657.9
SAKL0A03740g6.243ON66457658.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR126W
         (230 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative pro...   413   e-148
Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W (...   376   e-133
Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W (...   368   e-130
Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W (...   360   e-127
NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON...   202   4e-65
CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa] ...   191   6e-61
TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3....   165   2e-50
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...   164   6e-50
KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.48...   161   6e-49
KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON...   157   3e-47
KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakl...   141   3e-41
SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {O...   132   1e-37
Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W...   127   1e-36
TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.48...    98   2e-24
Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON...    92   5e-22
KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {O...    90   9e-22
KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly...    64   3e-11
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    63   8e-11
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    63   9e-11
KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {O...    62   2e-10
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    61   4e-10
CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} high...    60   8e-10
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    60   9e-10
KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.5...    60   9e-10
Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {...    58   4e-09
YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON} ...    57   5e-09
Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {...    57   6e-09
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     57   7e-09
NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {O...    57   1e-08
YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}  ...    56   1e-08
Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON...    56   1e-08
Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON...    56   2e-08
Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {...    56   2e-08
Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON...    56   2e-08
NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON}               55   3e-08
TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {O...    55   5e-08
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    54   8e-08
SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly...    54   1e-07
Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON} (12526.....    52   2e-07
ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} simi...    50   2e-06
ZYRO0D08998g Chr4 (771821..774349) [2529 bp, 842 aa] {ON} simila...    36   0.088
ZYRO0F14036g Chr6 (1153919..1154761) [843 bp, 280 aa] {ON} conse...    33   0.45 
Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}...    33   0.85 
KAFR0L01100 Chr12 (206906..208762) [1857 bp, 618 aa] {ON} Anc_7....    31   2.5  
Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W ...    31   3.6  
Skud_10.362 Chr10 (643130..647875) [4746 bp, 1581 aa] {ON} YJR13...    30   7.9  
SAKL0A03740g Chr1 complement(345988..347982) [1995 bp, 664 aa] {...    30   8.3  

>YGR126W Chr7 (745835..746527) [693 bp, 230 aa] {ON} Putative
           protein of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           the nucleus and is induced in response to the
           DNA-damaging agent MMS
          Length = 230

 Score =  413 bits (1062), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/230 (94%), Positives = 217/230 (94%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60
           MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60

Query: 61  NVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120
           NVDDQ             TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP
Sbjct: 61  NVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120

Query: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180
           DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230

>Smik_6.222 Chr6 (363652..364344) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  376 bits (965), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 197/230 (85%), Positives = 208/230 (90%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60
           MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDS+ P+QPL+KNDTIVGKGQ E+D 
Sbjct: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQLPDQPLMKNDTIVGKGQSENDD 60

Query: 61  NVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120
            +DDQ             TLKRPTSNSIEKMVT NALEG SET+DSLKEDGLNL KKALP
Sbjct: 61  ILDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTQNALEGTSETLDSLKEDGLNLKKKALP 120

Query: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180
           DITAPVTNSAHDA FPEEYRLETETGLVKLKTLE+L+REDSRVSSTKKEH NDHTD+HST
Sbjct: 121 DITAPVTNSAHDATFPEEYRLETETGLVKLKTLETLRREDSRVSSTKKEHNNDHTDIHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           RSKVTTNSQGSSLEPNKLNMAVEKNKK+IE+YQKHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKKIEQYQKHKSEKGIKGFFHRIFD 230

>Skud_7.437 Chr7 (725052..725744) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  368 bits (945), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/230 (82%), Positives = 205/230 (89%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60
           MPVPSV+VTTDNEYEDISSFSSIDSYKPEPFTGFKDS+APEQPLLKNDTIVGK Q E++ 
Sbjct: 1   MPVPSVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKAQSENEE 60

Query: 61  NVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120
           N+D+Q             TLKRP+SNSIEKM+THNALEGNSET DSLK +GLNLNKKALP
Sbjct: 61  NIDEQHRHSDVYSHHSSSTLKRPSSNSIEKMITHNALEGNSETADSLKREGLNLNKKALP 120

Query: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180
           DITAPVTNSAH+ AFPEEYRLETETGLVKLKTLE+LKREDSRVSS KKEH NDH D HST
Sbjct: 121 DITAPVTNSAHNGAFPEEYRLETETGLVKLKTLETLKREDSRVSSAKKEHTNDHADAHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           RSKVTT SQGSSLE +KLNMAVEKNKK+IE+Y+KHKSEKGIKGFFHRIFD
Sbjct: 181 RSKVTTYSQGSSLESDKLNMAVEKNKKKIEQYRKHKSEKGIKGFFHRIFD 230

>Suva_7.414 Chr7 (715894..716586) [693 bp, 230 aa] {ON} YGR126W
           (REAL)
          Length = 230

 Score =  360 bits (924), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 202/230 (87%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60
           M VP+V+VTTDNEYEDISSFSSIDSYKPEPFTGFKDS+APEQPLLKNDTIVGKGQ E+D 
Sbjct: 1   MAVPTVSVTTDNEYEDISSFSSIDSYKPEPFTGFKDSQAPEQPLLKNDTIVGKGQSENDD 60

Query: 61  NVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120
           +VDDQ             TLKRPTSNSIEKMVTHNALEGNSETVDSLK++GLNLNKK  P
Sbjct: 61  SVDDQHRHSDVHSHHSSSTLKRPTSNSIEKMVTHNALEGNSETVDSLKKEGLNLNKKGTP 120

Query: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180
           DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLE+LKREDSRVS  KK+H +DHTD HST
Sbjct: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLETLKREDSRVSGAKKDHGHDHTDAHST 180

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           RSK T  SQGSSLE +KLN+AVEKNKKRIEKYQKHK EKGIKG FHR+FD
Sbjct: 181 RSKATAYSQGSSLESDKLNIAVEKNKKRIEKYQKHKGEKGIKGLFHRMFD 230

>NCAS0E00850 Chr5 complement(155265..155957) [693 bp, 230 aa] {ON}
           Anc_3.486 YGR126W
          Length = 230

 Score =  202 bits (515), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 116/230 (50%), Positives = 155/230 (67%), Gaps = 12/230 (5%)

Query: 7   TVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGK----GQLEDDSNV 62
           T +T++++ED+SSFSSIDSY+PEPFTG K+  A +    K DT+ G      Q   ++  
Sbjct: 7   TTSTEHDFEDVSSFSSIDSYQPEPFTGVKEPTAYKGTDRK-DTLSGDETELKQEHTNATA 65

Query: 63  DDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDI 122
                           TL+RP SN+IE+++T NA EGN+ET+ SL   GL+LNKKA  DI
Sbjct: 66  TSSHTKDGITSRTSMSTLRRPDSNAIERVITSNAKEGNTETLGSLAAKGLDLNKKATLDI 125

Query: 123 TAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRS 182
            AP+T++  D AFPEEY LETETGLVK KT+E+L+RE SRVSST++       D+ S +S
Sbjct: 126 NAPLTSNPADVAFPEEYNLETETGLVKAKTIETLRRETSRVSSTRR-----GDDVVSHKS 180

Query: 183 KVTTNSQGS--SLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           + T  SQ S  SL+  KLN+AVEKNKK +EK +KHK +KG+KGF +R+FD
Sbjct: 181 QATGKSQRSAQSLQAEKLNLAVEKNKKELEKIEKHKHQKGLKGFMNRLFD 230

>CAGL0I10604g Chr9 complement(1047516..1048151) [636 bp, 211 aa]
           {ON} similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126w
          Length = 211

 Score =  191 bits (486), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 147/230 (63%), Gaps = 19/230 (8%)

Query: 1   MPVPSVTVTTDNEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDS 60
           M     T  TD E EDISSFSS+DSYKPEPFTG + ++   + L +  T   +G   DD+
Sbjct: 1   MSYNGTTSDTDYEVEDISSFSSVDSYKPEPFTGLEHTK--NENLSRKATNASQGTYMDDA 58

Query: 61  NVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALP 120
                             TLK+  S +IEK+VT NA+ GNSET++SLK  GL++ +KA+P
Sbjct: 59  -----------TSKHSGATLKKLDSLAIEKVVTQNAVAGNSETIESLKAKGLDMQRKAIP 107

Query: 121 DITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHST 180
           D  AP+T +  +  FPEEYRLET+TGLVK+KTLE+LKR+ ++VS       +D +    +
Sbjct: 108 DYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKTLETLKRKSTQVSRN-----SDLSSKDKS 161

Query: 181 RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
            SK  +N    S    K+NMAVE+NKK I KYQKHKSEKGIKGFFHR+FD
Sbjct: 162 ISKSQSNKSEVSDIAQKINMAVERNKKEIAKYQKHKSEKGIKGFFHRMFD 211

>TDEL0D05540 Chr4 (1002467..1003117) [651 bp, 216 aa] {ON} Anc_3.486
           YGR126W
          Length = 216

 Score =  165 bits (417), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 131/238 (55%), Gaps = 33/238 (13%)

Query: 3   VPSVTVTTD---NEYEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDD 59
            P  T   D   N+++++SSFSSIDSY+P+PFTG ++    + P   +      G     
Sbjct: 2   APGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQEELPQEKNPDSSSRRSSKSG----- 56

Query: 60  SNVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKAL 119
                              TL    SN+IEK VTHNA+ G SET  SL++ GL+  KKA+
Sbjct: 57  ------------------TTLNHQDSNTIEKEVTHNAMNGTSETAKSLQQAGLDTEKKAI 98

Query: 120 PDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHS 179
           PDI  P+T +A  + FPEEYR+ET+TGLVKLKTL  L R D+RVS      I+  +    
Sbjct: 99  PDINGPITGNADTSQFPEEYRIETQTGLVKLKTLNDLSRSDTRVSIGSDGKISRKSSGPG 158

Query: 180 T-------RSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           T       +       Q ++     L  A+EKNK RIEK++KH+ EKG+KGF HR+FD
Sbjct: 159 TIDSKIEPKPDTAKAEQEAAQNAENLEHAIEKNKHRIEKFEKHRHEKGLKGFVHRLFD 216

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score =  164 bits (415), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 114/228 (50%), Positives = 145/228 (63%), Gaps = 13/228 (5%)

Query: 10  TDNEYEDISSFSSIDSYKPEPFTGFKDSEAPE-QPLLKNDTIVGKGQLEDDSNVDDQXXX 68
           TDNE++DISSFSSIDSY+PEPFTG K +E P  QP   + T     Q  DD+ +      
Sbjct: 13  TDNEFDDISSFSSIDSYQPEPFTGLKGNELPNAQP---STTATTTEQDHDDTVISSHSHD 69

Query: 69  XXXX---XXXXXXTLKRPTSN--SIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDIT 123
                        TLK+  SN   IEK +T N +   +ET+DSL + GLN  KK++ DI 
Sbjct: 70  TKHGEEPSRTSTATLKKLDSNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADIN 129

Query: 124 APVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSK 183
            P+  +A  A FPEEYR+ETETGLVK KT+ESL+R++S ++S       D     S R+ 
Sbjct: 130 TPL--NAGTAEFPEEYRIETETGLVKAKTIESLRRQES-IASANSRRSQDQGSFKSARTN 186

Query: 184 VTTNSQG-SSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
            T  S+  SSL+PNKLNMAVEKNKK +EKY KHK +KGIKGFF+R+FD
Sbjct: 187 NTRKSRASSSLDPNKLNMAVEKNKKELEKYSKHKQQKGIKGFFNRLFD 234

>KAFR0C01920 Chr3 (385431..386102) [672 bp, 223 aa] {ON} Anc_3.486
           YGR126W
          Length = 223

 Score =  161 bits (407), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 142/239 (59%), Gaps = 32/239 (13%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTG----------------FKDSEAPEQPLLKNDTIV 51
           ++ + + EDISSFSSI+SYKPEPF G                 KD+++      + + + 
Sbjct: 1   MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQSHTSEKFQEEQVD 60

Query: 52  GKGQLEDDSNVDDQXXXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDG 111
              Q++ + +                  LK+  S  IE++VT NA+ G +ETVDSL+  G
Sbjct: 61  PLKQVQTNDSFWS-FRSVSNTSRTSSKNLKKQRSRDIERIVTQNAMLGKAETVDSLRATG 119

Query: 112 LNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHI 171
           L+L K+A+PDI +P+   +H++   +E + ET+TGL+K KTLE+L R ++R SS+K++ +
Sbjct: 120 LDLTKRAVPDINSPI---SHESKLIDESKFETDTGLIKTKTLETLNRSNTRNSSSKRKIL 176

Query: 172 NDHTDMHSTRSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
            +             NS  S L+P ++NM VE+N+K++EKYQ+HK EKG+KGFF++IFD
Sbjct: 177 GND------------NSNTSGLDPERMNMVVERNRKKLEKYQQHKKEKGLKGFFYKIFD 223

>KNAG0B00850 Chr2 complement(155105..155782) [678 bp, 225 aa] {ON}
           Anc_3.486 YGR126W
          Length = 225

 Score =  157 bits (397), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 141/232 (60%), Gaps = 24/232 (10%)

Query: 8   VTTDNEYEDISSFSSIDSYKPEPFTGFK-DSEAPEQPLLKNDTIVGKGQLEDDSNVDDQX 66
           + TD E++++SSFSS+DSYKPEPF GF  + E  +  L KNDTI+    L +++      
Sbjct: 7   IVTDPEFDEVSSFSSVDSYKPEPFVGFGTEEEQHDSRLFKNDTILNSEDLAENT----AN 62

Query: 67  XXXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKA-LPDITAP 125
                       TL +  SN+IE++VT NA+   SE+ D+L+  GL+  K+  +PDI AP
Sbjct: 63  TPSDLNSKASSTTLGKRDSNAIERVVTKNAMNNQSESADALRSKGLDTTKRRNIPDINAP 122

Query: 126 VTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVT 185
           +T     + FPEEY++ETETGLVK+KT+ESLK   S  +     H +  +   STRSK  
Sbjct: 123 LT--LTQSHFPEEYQVETETGLVKMKTIESLKSRHSGGT-----HNSKKSKGASTRSK-- 173

Query: 186 TNSQGSSLE--------PNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229
            NS  SS+E          KLN AVE+N+K +E+Y+K++ +KGIKGF  ++F
Sbjct: 174 -NSLTSSMEEHGEAGLNAEKLNSAVERNRKELERYEKNRGKKGIKGFLSKMF 224

>KLTH0F14696g Chr6 (1205320..1205979) [660 bp, 219 aa] {ON} weakly
           similar to uniprot|P53274 Saccharomyces cerevisiae
           YGR126W Hypothetical ORF
          Length = 219

 Score =  141 bits (356), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 111/157 (70%), Gaps = 8/157 (5%)

Query: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEE 138
           TL++  SN+IE+++THNA EG SETV+SLK++GLNL KKA+PDI  P  N   + AFPEE
Sbjct: 66  TLRKQDSNAIEQIMTHNATEGRSETVESLKKNGLNLQKKAIPDINNPAAN-YKNCAFPEE 124

Query: 139 YRLETETGLVKLKTLESLKREDSRVS----STKKEHINDHTDMHSTRSKV-TTNSQGSSL 193
           Y++ET+TGLVK +TL  L R +SR S    +++K+ I   T   +T S + + N+  + L
Sbjct: 125 YQMETDTGLVKAQTLHGLNRLESRTSGRSGASQKKSI--RTANSTTNSDLASANNTINGL 182

Query: 194 EPNKLNMAVEKNKKRIEKYQKHKSEKGIKGFFHRIFD 230
           +  KL  AVEKN+K+I+KYQKHKS  G++ F  +IFD
Sbjct: 183 DGEKLRRAVEKNQKKIDKYQKHKSSGGLRRFLGKIFD 219

>SAKL0F02904g Chr6 complement(244726..245394) [669 bp, 222 aa] {ON}
           similar to gnl|GLV|CAGL0I10604g Candida glabrata
           CAGL0I10604g and weakly similar to YGR126W
           uniprot|P53274 Saccharomyces cerevisiae YGR126W
           Hypothetical ORF
          Length = 222

 Score =  132 bits (332), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 80/151 (52%), Positives = 106/151 (70%), Gaps = 5/151 (3%)

Query: 79  TLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEE 138
           TLK+  SN+IEK++THNA+EGN+ET++SLK  GL+L KKA+PD   P  ++   + FPEE
Sbjct: 76  TLKKLDSNAIEKVLTHNAVEGNTETLESLKTRGLDLRKKAIPDYNNPAMHTDR-SQFPEE 134

Query: 139 YRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKL 198
           Y++ETETGLVK+KTL+SL R D+RVS   K   N + +  S   +     +    +  KL
Sbjct: 135 YQIETETGLVKVKTLQSLNRLDTRVSLGNKPSTNQNMEAESAHDE----QRPVGYDEEKL 190

Query: 199 NMAVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229
             AV+KNKK+IEKYQKHK EKGIKGF  R+F
Sbjct: 191 KKAVDKNKKKIEKYQKHKHEKGIKGFMSRLF 221

>Kwal_55.21215 s55 (733385..733813) [429 bp, 142 aa] {ON} YGR126W -
           Hypothetical ORF [contig 131] PARTIAL
          Length = 142

 Score =  127 bits (319), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 95/144 (65%), Gaps = 7/144 (4%)

Query: 92  VTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLK 151
           +THNA EG SETVDSL+ +GLN+N+KA+PD   P  N   +  FPEEY+LET+TGLVK++
Sbjct: 1   MTHNATEGRSETVDSLQRNGLNINQKAVPDYNNPAANFT-NCEFPEEYQLETDTGLVKVQ 59

Query: 152 TLESLKREDSRVS-----STKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNMAVEKNK 206
           TL+ L R +SR S     S +K   +  +  HS  S     S  S L+  KL  AVEKNK
Sbjct: 60  TLQKLNRLESRTSIRSGNSQRKSMRSTPSTDHSI-SPSAGRSSNSGLDAEKLRKAVEKNK 118

Query: 207 KRIEKYQKHKSEKGIKGFFHRIFD 230
           ++I+KYQKHK+  G+K F  +IFD
Sbjct: 119 RQIDKYQKHKASGGLKKFLGKIFD 142

>TPHA0D03250 Chr4 (670720..671379) [660 bp, 219 aa] {ON} Anc_3.486
           YGR126W
          Length = 219

 Score = 98.2 bits (243), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 125/230 (54%), Gaps = 30/230 (13%)

Query: 9   TTDNE-YEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDSNVDDQXX 67
           TTD+E ++D+SSF+S +SY P+ F G              DT+ GK   E  + +DD+  
Sbjct: 10  TTDSENFDDVSSFNSDNSYTPQEFIG--------------DTL-GK---ESSTKMDDRAS 51

Query: 68  ------XXXXXXXXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPD 121
                            T+K  TSN + ++V+ N ++ N E+ ++LK    N+  +   D
Sbjct: 52  HLSHAIKETRSGTSDNNTIKPVTSNDVHRIVSRNIMDNNVESEEALKTQLTNMESRR-AD 110

Query: 122 ITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTR 181
           I  P +    ++ FPEEY +ET TGLV +KTLE +K++ +  S   ++ +   +++ +++
Sbjct: 111 IILPASMEG-NSNFPEEYTMETTTGLVPVKTLEDIKKKKTIDSENSRKSLVS-SELKASK 168

Query: 182 SKVTTNSQG-SSLEPNKLNMAVEKNKKRIEKYQKHKSEKG-IKGFFHRIF 229
           S  T  S+    L P KLN AVEKNK+ +EKYQ HK+EK  IK    ++F
Sbjct: 169 SNNTVKSRNEGGLNPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLF 218

>Kpol_1017.10 s1017 complement(30565..31269) [705 bp, 234 aa] {ON}
           complement(30565..31269) [705 nt, 235 aa]
          Length = 234

 Score = 92.0 bits (227), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 112/237 (47%), Gaps = 43/237 (18%)

Query: 14  YEDISSFSSIDSYKPEPFTGFKDSEAPEQPLLKNDTIVGKGQLEDDSNVDDQXXXXXXXX 73
           +EDISSF S +S+ P+ F G  DS       + N T  G  +                  
Sbjct: 18  FEDISSFDSQNSFAPQEFKGNLDSNNDNDTGVFNKTKSGTSE------------------ 59

Query: 74  XXXXXTLKRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDA 133
                TLK  +SN IEK+VT NALE N+ETV +L+E    L+K    ++  P T   ++A
Sbjct: 60  ---TNTLKVNSSNEIEKIVTRNALENNTETVATLRETESKLSKVPTENV-LPAT-MENNA 114

Query: 134 AFPEEYRLETETGLVKLKTLESLKREDSR------------------VSSTKKEHINDH- 174
           AFPEEYR+ET+TGLV +KTLE +    S                    +       ND  
Sbjct: 115 AFPEEYRIETKTGLVPIKTLEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDED 174

Query: 175 TDMHSTRSKVTTNSQGSSLEPNKLNMAVEKNKKRIEKYQKHKSEKG-IKGFFHRIFD 230
            D+         +     LE   +++ VE+NKK++EK+++HK E   +K F ++  D
Sbjct: 175 KDVEQKEKHPAEHLPHGKLEQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLD 231

>KLLA0E04709g Chr5 complement(417351..417851) [501 bp, 166 aa] {ON}
           weakly similar to uniprot|P53274 Saccharomyces
           cerevisiae YGR126W Hypothetical ORF
          Length = 166

 Score = 89.7 bits (221), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/149 (36%), Positives = 83/149 (55%), Gaps = 18/149 (12%)

Query: 81  KRPTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYR 140
           K  T+  +E  V  N  +G ++++DSLK   L+L+KKA+P    P+   A  A FPEEY 
Sbjct: 35  KISTTQEVEDYVKDNVQKGETDSIDSLKATNLDLSKKAIPGFNQPI---AEGAEFPEEYE 91

Query: 141 LETETGLVKLKTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNM 200
           +ET TGLVK+ TL  L R D+RV++        H+   ST+ K T+       + +KL  
Sbjct: 92  IETRTGLVKVATLHQLNRLDTRVTT--------HSSKKSTKEKNTS----CGYDNDKLQK 139

Query: 201 AVEKNKKRIEKYQKHKSEKGIKGFFHRIF 229
            +E+N+K I+ Y K   + G K F  ++F
Sbjct: 140 CIERNQKEIDSYHK---KSGFKKFIGKLF 165

>KLTH0G02266g Chr7 (178663..180597) [1935 bp, 644 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 644

 Score = 63.9 bits (154), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 1/67 (1%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+   +  LPD+ AP T     A FPEEY LET TGLV + TL+SL R  
Sbjct: 57  TETVKSLQDMGVT-PEAPLPDVNAPTTGKGGAAIFPEEYTLETATGLVPVATLQSLGRTQ 115

Query: 161 SRVSSTK 167
           S VS T+
Sbjct: 116 SAVSRTR 122

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 62.8 bits (151), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL+E G+   +  LPD+ AP   ++  A FPEEY LET TGLV + TL+SL R  
Sbjct: 51  TETVKSLQEMGVT-PEAPLPDVNAPAAATSGKAIFPEEYTLETATGLVPVATLQSLGRTT 109

Query: 161 SRVSSTK 167
           S V+ T+
Sbjct: 110 SGVTRTR 116

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 62.8 bits (151), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ET  SL++ GL  ++  +PD  AP T+ A +A FPEEY LET TGLV + TL SL R  
Sbjct: 48  TETAKSLQDMGLT-SEVPIPDFNAPTTSVAKNAIFPEEYTLETATGLVPVATLHSLGRTP 106

Query: 161 SRVSSTKKEHINDHTDMHSTRSK 183
           + +S T+   + D  D  S+  K
Sbjct: 107 TAISRTRTRQM-DRQDASSSEEK 128

>KAFR0C02030 Chr3 complement(401836..403710) [1875 bp, 624 aa] {ON}
           Anc_3.503 YPR156C
          Length = 624

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (66%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+N    A+PD+ AP +N   +A FPEEY +ET TGLV + TL+SL R  
Sbjct: 52  TETVKSLQDMGMN-ATPAVPDVNAPQSN--RNAIFPEEYTIETTTGLVPVATLQSLGRTS 108

Query: 161 SRVSSTKKEHIN 172
           + +S T+   ++
Sbjct: 109 TAISRTRTRQMD 120

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 44/63 (69%), Gaps = 3/63 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL+E GL+ ++K +PD+ AP T++     FPEEY LET TGLVK+ TL SL R  
Sbjct: 45  TETVKSLQEMGLS-SEKPIPDVNAPSTSAG--VIFPEEYTLETPTGLVKIATLVSLGRTG 101

Query: 161 SRV 163
           S V
Sbjct: 102 SAV 104

>CAGL0I10384g Chr9 (1027883..1029775) [1893 bp, 630 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138c
          Length = 630

 Score = 60.1 bits (144), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL+E G+      +PD+ AP T +  +A FPEEY +ET TGLV + TL+SL R  
Sbjct: 51  TETVKSLQEMGMT-QDAPIPDVNAPQTTT-KNAIFPEEYTMETPTGLVPVATLQSLGRTS 108

Query: 161 SRVSSTKKEHINDHTDMHSTRSKVTTNS 188
           + +S ++   I       S     ++NS
Sbjct: 109 TAISKSRTRQIERSVSRRSQNIAASSNS 136

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 57/101 (56%), Gaps = 6/101 (5%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL+E G+      +PD+ AP T +A    FPEEY +ET TGLV + TL+S+ R  
Sbjct: 45  TETVKSLQEMGMTATAP-VPDVNAPQT-TARPQIFPEEYTMETPTGLVPVATLQSIGRTS 102

Query: 161 SRVSSTKKEHI----NDHTDMHSTRSKVTTNSQGSSLEPNK 197
           + +S ++   +    ++ + M  T S    N +G + EP +
Sbjct: 103 TAISRSRTRQMERTSSESSSMDGTNSDAEINKEGKASEPQE 143

>KNAG0B00730 Chr2 (138284..140152) [1869 bp, 622 aa] {ON} Anc_3.503
           YPR156C
          Length = 622

 Score = 59.7 bits (143), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (60%), Gaps = 2/82 (2%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  N   +PD+ AP T +   A FPEEY +ET TGLV + TL+S+ R  
Sbjct: 51  TETVKSLQDMGMTKNAP-IPDVNAPQT-AKKTAIFPEEYTMETPTGLVPVATLQSIGRTA 108

Query: 161 SRVSSTKKEHINDHTDMHSTRS 182
           + +S T+   ++    M S+ S
Sbjct: 109 TSISRTRTRQMDRSISMRSSHS 130

>Skud_16.450 Chr16 complement(791420..793288) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.8 bits (138), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G++ +K  +PD+ AP   S+ +  FPEEY LET TGLV + TL S+ R  
Sbjct: 50  TETVKSLQDMGVS-SKAPIPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTKKEHIND 173
           + +S T+   I+ 
Sbjct: 107 TAISRTRTRQIDG 119

>YPR156C Chr16 complement(837909..839777) [1869 bp, 622 aa] {ON}
           TPO3Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; member of the major
           facilitator superfamily
          Length = 622

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G++ +K  +PD+ AP   S+ +  FPEEY LET TGLV + TL S+ R  
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAP--QSSKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTKKEHIND 173
           + +S T+   I+ 
Sbjct: 107 TAISRTRTRQIDG 119

>Smik_16.408 Chr16 complement(709761..711629) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 57.4 bits (137), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G++ +K  +PD+ AP   S  +  FPEEY LET TGLV + TL S+ R  
Sbjct: 50  TETVKSLQDMGVS-SKAPVPDVNAP--QSGKNKIFPEEYTLETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTKKEHI 171
           + +S T+   I
Sbjct: 107 TAISRTRTRQI 117

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 54/90 (60%), Gaps = 5/90 (5%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV +L++ G+      +PD+ AP T SA +  FPEEY +ET TGLV + TL+SL R  
Sbjct: 52  TETVKTLQDLGVT-RDAPVPDVNAPQT-SARNTIFPEEYTMETTTGLVPVSTLQSLGRTA 109

Query: 161 SRVSSTKKEHINDHTDMHSTRSKVTTNSQG 190
           + ++ T+   I   +   ++    T+NS+G
Sbjct: 110 TSITRTRTRQIERRS---TSGFSTTSNSKG 136

>NCAS0F03620 Chr6 complement(720240..722144) [1905 bp, 634 aa] {ON}
           Anc_3.503 YGR138C
          Length = 634

 Score = 56.6 bits (135), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 44/71 (61%), Gaps = 2/71 (2%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ET  +L++ G+  ++  LPDI AP   S   A FPEEY +ET TGLV + TL+S+ R  
Sbjct: 50  TETAKTLQDMGMT-SEAPLPDINAP-QGSKKPAIFPEEYTMETPTGLVPVVTLQSIGRNS 107

Query: 161 SRVSSTKKEHI 171
           S +S T+   I
Sbjct: 108 SAISRTRTRQI 118

>YGR138C Chr7 complement(763762..765606) [1845 bp, 614 aa] {ON}
           TPO2Polyamine transport protein specific for spermine;
           localizes to the plasma membrane; transcription of TPO2
           is regulated by Haa1p; member of the major facilitator
           superfamily
          Length = 614

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  +   +PDI AP   +A +  FPEEY +ET +GLV + TL+S+ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTKKEHIN 172
           S +S T+ + +N
Sbjct: 102 SALSRTRTKQLN 113

>Suva_7.425 Chr7 complement(733993..735834) [1842 bp, 613 aa] {ON}
           YGR138C (REAL)
          Length = 613

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 46/72 (63%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  +   +PDI AP   +A +  FPEEY +ET +GLV + TL+S+ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTKKEHIN 172
           S +S T+   +N
Sbjct: 102 SALSRTRTRQLN 113

>Skud_7.448 Chr7 complement(742873..744708) [1836 bp, 611 aa] {ON}
           YGR138C (REAL)
          Length = 611

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  +   +PDI AP   +A +  FPEEY +ET +GLV + TL+S+ R  
Sbjct: 45  TETVKSLQDLGVT-SAAPVPDINAP--KTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTKKEHIN 172
           S +S T+ + +N
Sbjct: 102 SALSRTRTKQLN 113

>Suva_16.484 Chr16 complement(834235..836103) [1869 bp, 622 aa] {ON}
           YPR156C (REAL)
          Length = 622

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 47/73 (64%), Gaps = 3/73 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G++ ++  +PD+ AP   S+ +  FPEEY +ET TGLV + TL S+ R  
Sbjct: 50  TETVKSLQDMGVS-SRAPVPDVNAP--QSSKNKIFPEEYTIETPTGLVPVATLHSIGRTS 106

Query: 161 SRVSSTKKEHIND 173
           + +S T+   I+ 
Sbjct: 107 TAISRTRTRQIDG 119

>Smik_6.233 Chr6 complement(381679..383523) [1845 bp, 614 aa] {ON}
           YGR138C (REAL)
          Length = 614

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 47/72 (65%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  N   +PDI AP   +A +  FPEEY +ET +GLV + TL+S+ R  
Sbjct: 45  TETVKSLQDLGVTSNAP-VPDINAP--QTAKNNIFPEEYTMETPSGLVPVATLQSMGRTA 101

Query: 161 SRVSSTKKEHIN 172
           + +S T+ + +N
Sbjct: 102 TALSRTRTKQMN 113

>NCAS0E00750 Chr5 (137737..139599) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 2/73 (2%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV +L++ G+  +   +PDI AP  +S  +A FPEEY +ET TGLV + TL+S+ R  
Sbjct: 46  TETVKTLQDLGVT-SHVPVPDINAP-QSSKKNAIFPEEYTMETTTGLVPVATLQSMGRTA 103

Query: 161 SRVSSTKKEHIND 173
           S +S T+   +  
Sbjct: 104 SAISRTRTRQMQG 116

>TPHA0D03310 Chr4 complement(680299..682140) [1842 bp, 613 aa] {ON}
           Anc_3.503 YPR156C
          Length = 613

 Score = 54.7 bits (130), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 4/78 (5%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ GL  +   +PD+ AP +N    + FPEEY +ET TGLV + TL SL R  
Sbjct: 45  TETVKSLQDMGLT-SDAPIPDVNAPTSN--KHSIFPEEYTMETPTGLVPVATLHSLGRNS 101

Query: 161 SRVSSTKKEHINDHTDMH 178
           + ++ T+ + + D +  H
Sbjct: 102 TTITRTRTKQM-DRSQTH 118

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 53.9 bits (128), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 35/88 (39%), Positives = 47/88 (53%), Gaps = 3/88 (3%)

Query: 83  PTSNSIEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLE 142
           PT+ S             +ETV SL + G++ +    P I AP T+    A FPEEY LE
Sbjct: 53  PTNRSSNASTNQRLKLVKTETVKSLIDMGVS-SYIPNPAINAPKTSK--KAIFPEEYTLE 109

Query: 143 TETGLVKLKTLESLKREDSRVSSTKKEH 170
           TETGLV + TL SL R ++ +S  +  H
Sbjct: 110 TETGLVPVSTLHSLGRTNTNLSRQRTRH 137

>SAKL0F02442g Chr6 (211990..213822) [1833 bp, 610 aa] {ON} highly
           similar to uniprot|P53283 Saccharomyces cerevisiae
           YGR138C TPO2 Polyamine transport protein
          Length = 610

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ET  SL+E G++ ++  +PDI AP   +     FPEEY +ET TGLV + TL S+ R  
Sbjct: 44  TETAKSLQEMGVS-SEAPIPDINAP--QNVKSPIFPEEYTMETPTGLVPVATLHSIGRTT 100

Query: 161 SRVSSTKKEHIN 172
           S VS T+   ++
Sbjct: 101 SAVSRTRTRQLD 112

>Kpol_1017.3 s1017 (12526..14391) [1866 bp, 621 aa] {ON}
           (12526..14391) [1866 nt, 622 aa]
          Length = 621

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 49/82 (59%), Gaps = 3/82 (3%)

Query: 101 SETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKRED 160
           +ETV SL++ G+  ++  +P + AP T+      FPEEY +ET TGLV + TL+SL R  
Sbjct: 48  TETVKSLQDMGMT-SEAPIPGVNAPQTSRVQ--IFPEEYTMETPTGLVPVATLQSLGRSS 104

Query: 161 SRVSSTKKEHINDHTDMHSTRS 182
             V+ T+   ++  +  +++ S
Sbjct: 105 LAVTRTRTRQMDRQSQTNASIS 126

>ZYRO0G19646g Chr7 (1631114..1632898) [1785 bp, 594 aa] {ON} similar
           to uniprot|P53283 Saccharomyces cerevisiae YGR138C TPO2
           Polyamine transport protein
          Length = 594

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 4/82 (4%)

Query: 88  IEKMVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGL 147
           +E+ VT  AL    ET ++L+  G+      LPD+ AP   +A    FPEEY +ET +G+
Sbjct: 28  LEQDVTSRALS-RHETAETLQTMGMA-RGTPLPDVVAPTYAAA--PVFPEEYTMETPSGI 83

Query: 148 VKLKTLESLKREDSRVSSTKKE 169
           V L  LESL R  + VS   +E
Sbjct: 84  VPLAQLESLGRTVTTVSKKGEE 105

>ZYRO0D08998g Chr4 (771821..774349) [2529 bp, 842 aa] {ON} similar
           to uniprot|P27514 Saccharomyces cerevisiae YNR013C PHO91
           Low-affinity phosphate transporter deletion of pho84
           pho87 pho89 pho90 and pho91 causes synthetic lethality
           transcription independent of Pi and Pho4p activity
           overexpression results in vigorous growth
          Length = 842

 Score = 35.8 bits (81), Expect = 0.088,   Method: Composition-based stats.
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 13/122 (10%)

Query: 91  MVTHNALEGNSETVDSLKEDGLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKL 150
           M  +  LE   + V  L++D LN    +L D+  P   SA  A +     LE   G   +
Sbjct: 84  MANYRELE---DDVRDLEQDLLNNRVDSLEDVY-PRRRSAGSARYSSASSLEAGGGDDDI 139

Query: 151 KTLESLKREDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNMAVEKN---KK 207
            +  S +      S +  E+ N  +D++  RS+ T N+ GSS + + ++ A+E+    KK
Sbjct: 140 HSGFSTR------SQSHLENDNVGSDIYQARSRTTNNTWGSSSQAHFISPAMERRIILKK 193

Query: 208 RI 209
           RI
Sbjct: 194 RI 195

>ZYRO0F14036g Chr6 (1153919..1154761) [843 bp, 280 aa] {ON}
           conserved hypothetical protein
          Length = 280

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 151 KTLESLK-----REDSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNMAVEKN 205
           KTL SL      R D     T KEHI D+  +  T +KV  NS     EP KL +   KN
Sbjct: 46  KTLRSLNMLEEGRYDLVDDCTFKEHIADYPGVTRTFAKVDPNSCKIEYEPPKLGLQERKN 105

Query: 206 KK 207
            K
Sbjct: 106 SK 107

>Kpol_1025.2 s1025 complement(4571..9094) [4524 bp, 1507 aa] {ON}
            complement(4571..9094) [4524 nt, 1508 aa]
          Length = 1507

 Score = 32.7 bits (73), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 9/73 (12%)

Query: 124  APVTNSAHDAAFPEEYRLETETGLVKLKT-LESLKR--------EDSRVSSTKKEHINDH 174
            +P + S H+  +PE    E    + K++T L  L++        E +++  T+   I DH
Sbjct: 1396 SPASTSEHEKEYPEMDEDECRQVMSKMRTSLMRLRKGGKGLDRKEWAKILKTELTAIGDH 1455

Query: 175  TDMHSTRSKVTTN 187
             D H T SK TTN
Sbjct: 1456 IDSHKTESKKTTN 1468

>KAFR0L01100 Chr12 (206906..208762) [1857 bp, 618 aa] {ON} Anc_7.271
           YER080W
          Length = 618

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 9/74 (12%)

Query: 89  EKMVTHNALEGNSETVDSLKEDGLNL----NKKAL--PDITAPVTNSAHDAAFPEEYRLE 142
           EK  T  ++EG S  V+ L +D +N     +KK +  P+ T  + ++A  A      RL 
Sbjct: 76  EKRTTRFSIEGLSSVVNDLYKDVMNFKTDASKKLIFKPNSTVTLADNASAALLD---RLN 132

Query: 143 TETGLVKLKTLESL 156
            + GLV++KT+ S+
Sbjct: 133 AKEGLVQIKTIASI 146

>Suva_4.470 Chr4 (818188..820179) [1992 bp, 663 aa] {ON} YBR212W
           (REAL)
          Length = 663

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 111 GLNLNKKALPDITAPVTNSAHDAAFPEEYRLETETG 146
            L+LN   LP+  +P TNS  ++ F   +RL   +G
Sbjct: 143 ALSLNATPLPNFYSPTTNSQTNSTFKRTFRLNWASG 178

>Skud_10.362 Chr10 (643130..647875) [4746 bp, 1581 aa] {ON} YJR138W
            (REAL)
          Length = 1581

 Score = 29.6 bits (65), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 44/111 (39%), Gaps = 6/111 (5%)

Query: 96   ALEGNSETVDSLKEDGLNLNKKALPDITAP-----VTNSAHDAAFPEEYRLETETGLVKL 150
             L G  + +   K  G       LP    P     V N  ++   PEE R+E    L+  
Sbjct: 1057 VLAGYGDYLIDRKWHGFRAKYVVLPTDIPPNTYSMVINGKNETLNPEEIRVEGLRRLIGS 1116

Query: 151  KTLESLKRE-DSRVSSTKKEHINDHTDMHSTRSKVTTNSQGSSLEPNKLNM 200
             T   L+ E + R+  +K+E I      ++       N Q +SLE + +N 
Sbjct: 1117 ITRARLRTEKEKRIKKSKREEIQPEVIFYTGPLYNFINEQQTSLESSAINF 1167

>SAKL0A03740g Chr1 complement(345988..347982) [1995 bp, 664 aa] {ON}
           some similarities with uniprot|Q03213 Saccharomyces
           cerevisiae YMR172W HOT1 Transcription factor required
           for the transient induction of glycerol biosynthetic
           genes GPD1 and GPP2 in response to high osmolarity
          Length = 664

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 114 LNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKTLESLKREDSRVSSTKKEH 170
           LN+ AL   T+ + NS  ++AF   Y  E+   +    +L+ L ++ SR + T ++H
Sbjct: 311 LNRGALQSSTSSLKNSHQNSAFTSNYSTESLPNI----SLDHLAKQSSRTAFTPQQH 363

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,405,050
Number of extensions: 1116865
Number of successful extensions: 4226
Number of sequences better than 10.0: 166
Number of HSP's gapped: 4192
Number of HSP's successfully gapped: 167
Length of query: 230
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 124
Effective length of database: 41,326,803
Effective search space: 5124523572
Effective search space used: 5124523572
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 64 (29.3 bits)