Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR125W3.485ON1036103654020.0
Smik_6.2213.485ON1036103650400.0
Skud_7.4363.485ON1036103650190.0
Suva_7.4133.485ON1037103747950.0
NCAS0E009503.485ON1052106433300.0
NDAI0G009903.485ON1054106733230.0
CAGL0I10626g3.485ON1070104131690.0
KNAG0B008603.485ON1088108531330.0
TDEL0D055303.485ON1031104931150.0
KAFR0C019103.485ON1020105331070.0
ZYRO0C07986g3.485ON1024106531000.0
Kpol_480.183.485ON1057106529740.0
SAKL0F02926g3.485ON1050108629590.0
TPHA0D042103.485ON1049105829300.0
TBLA0C044403.485ON115093728120.0
Kwal_55.212013.485ON1011106028060.0
KLTH0F14674g3.485ON1010104528050.0
KLLA0E04731g3.485ON106092625160.0
AFR304W3.485ON1015105924800.0
CAGL0L09207g8.99ON7255231183e-05
Suva_16.3228.99ON7425621149e-05
TDEL0C012808.99ON7275311103e-04
SAKL0B03124g8.99ON7445591085e-04
Smik_16.2418.99ON7445661050.001
Skud_16.2868.99ON7455631020.002
NDAI0B022108.99ON7065531000.004
YPR003C8.99ON754568990.005
Ecym_7084na 1ON689204980.007
NCAS0B048008.99ON724540980.007
Kwal_27.110398.99ON726629960.010
ZYRO0F04796g8.99ON735285960.011
AGR213Cna 1ON689291920.032
SAKL0H08800gna 1ON620463900.061
KLTH0G16764g8.99ON710556830.35
TBLA0C052708.99ON776525830.39
Smik_5.3388.231ON1571156772.1
KNAG0D023908.99ON716370753.6
Kpol_467.118.99ON744285744.5
KLLA0A05368g5.77ON41275734.9
Suva_13.258.850ON50230735.2
YER166W (DNF1)8.231ON1571156736.2
YML118W (NGL3)8.850ON50530726.6
NDAI0D047304.309ON661124727.9
Kwal_23.59567.274ON94072729.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR125W
         (1036 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  2085   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1946   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1937   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1851   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1287   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1284   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1225   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1211   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1204   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1201   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1198   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1150   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1144   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....  1133   0.0  
TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  1087   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...  1085   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...  1085   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   973   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   959   0.0  
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    50   3e-05
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    49   9e-05
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    47   3e-04
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    46   5e-04
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    45   0.001
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    44   0.002
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    43   0.004
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    43   0.005
Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}...    42   0.007
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    42   0.007
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    42   0.010
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    42   0.011
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    40   0.032
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    39   0.061
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    37   0.35 
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    37   0.39 
Smik_5.338 Chr5 (512279..516994) [4716 bp, 1571 aa] {ON} YER166W...    34   2.1  
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    33   3.6  
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    33   4.5  
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    33   4.9  
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...    33   5.2  
YER166W Chr5 (512744..517459) [4716 bp, 1571 aa] {ON}  DNF1Amino...    33   6.2  
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...    32   6.6  
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    32   7.9  
Kwal_23.5956 s23 (1388218..1391040) [2823 bp, 940 aa] {ON} YIL07...    32   9.1  

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 2085 bits (5402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1017/1036 (98%), Positives = 1017/1036 (98%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120
            MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG
Sbjct: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120

Query: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180
            DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ
Sbjct: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180

Query: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300
            HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY 600
            DSPFAGFLLIALTIC                   LIFLLGYELLVEALVDTWNKLNRFEY
Sbjct: 541  DSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660
            LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840
            CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL
Sbjct: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840

Query: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900
            MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV
Sbjct: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1946 bits (5040), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 953/1036 (91%), Positives = 988/1036 (95%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS+NKMHRASVSAMSPPLCRSYMSGFFTGGNSP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSINKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60

Query: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120
            MIN++SDSKLP+SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDII +G
Sbjct: 61   MINSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSG 120

Query: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180
            DRKDDQSMRTIEE+IDEEYSDEYSRLLLSPASSN++DDRNRGLQN    ELED Y GGYQ
Sbjct: 121  DRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRNRGLQNGLTSELEDDYEGGYQ 180

Query: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLR SHNLR RPRN   +CTSFPSKF HYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300
            HLGPTGISMFYISTIISQAVYSGG SSFPSGIGSEMIEITPFYHTMALA+KEALAG+DDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALAGDDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTG VFY LGKL+LGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFF GLFT+YDTLAKWLLPV+LTV+LIGTQRYFKNSLVLPSFYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLD LR AGWIFPIANSDSKWYDHY+LFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY 600
            DS FAGFLLIALTIC                   LIFLLGYELLVEAL+DTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660
            LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA+STVYRDYVQT
Sbjct: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQNLLFFGTI+SIEEKIE+LLQISNKDATKRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFTETK+IKLIISSI+ERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840
            CENEFLFQYKQLR KAKERLEE KQNN+VSAV+AAT+NK I+ +GNGLN+G+N D  RNL
Sbjct: 781  CENEFLFQYKQLRIKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNL 840

Query: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900
            MSLPTNTPRNYQ+LSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE+
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEI 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            QKVREKEIKFWAQLCPYFTRRRLASQS LLHADN+FFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDS+LWVIDSSSL K+KE+NLALYVEVALMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1937 bits (5019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 949/1036 (91%), Positives = 983/1036 (94%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSP 60
            MGRTIRRRRSNSSLSEAISVSLGINQDSS NKMHRASVSAMSPPLCRSYMSGFFTGG+SP
Sbjct: 1    MGRTIRRRRSNSSLSEAISVSLGINQDSSKNKMHRASVSAMSPPLCRSYMSGFFTGGSSP 60

Query: 61   MINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120
            M+ N+SDSKLP SNKQHP VIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDII + 
Sbjct: 61   MVKNMSDSKLPFSNKQHPTVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDSD 120

Query: 121  DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQ 180
            DRKDDQSMRTI ENIDEEYSDEYSRLLLSPASSNVDD+RNR LQ+  + ELED Y GGYQ
Sbjct: 121  DRKDDQSMRTIVENIDEEYSDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQ 180

Query: 181  SLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240
            SLRPSHNLRFRPRN+W  CTSFP KFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS
Sbjct: 181  SLRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFS 240

Query: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDE 300
            HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALA+K+AL GNDDE
Sbjct: 241  HLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGNDDE 300

Query: 301  IITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360
            IITTTIFCYVISSMLTGVVFY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT
Sbjct: 301  IITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTT 360

Query: 361  RVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH 420
            RVAKFEYSWPFFSGLFT+YDTLAKWLLPVLLTV+LIGTQRYFKNSLVLP+FYILTLVLFH
Sbjct: 361  RVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFH 420

Query: 421  FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFF 480
            FIVAIIPTLSLD LR+AGWIFPIANSDSKWYDHY+LFNVHKVHWSLVLQQIPTMMALTFF
Sbjct: 421  FIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFF 480

Query: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540
            GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA
Sbjct: 481  GILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGA 540

Query: 541  DSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY 600
            DS FAGFLLIALTIC                   LIFLLGYELLVEALVDTWNKLNRFEY
Sbjct: 541  DSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEY 600

Query: 601  LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQT 660
            LTVVIIVFTMG+FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA+STVYRDYVQT
Sbjct: 601  LTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQT 660

Query: 661  KFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINAD 720
            KFLDGIGEQIYVLKLQN+LFFGTIISIEEKIE+LLQISNKDA KRRIKYLILDFKNINAD
Sbjct: 661  KFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNINAD 720

Query: 721  NIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780
            NIDYSAAEGFNRIKRFT TKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW
Sbjct: 721  NIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEW 780

Query: 781  CENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL 840
            CENEFLFQYKQLR+KAK+RLEE KQ++V SA++AAT+NKKID +GNGL+ G N D ARNL
Sbjct: 781  CENEFLFQYKQLREKAKKRLEERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNL 840

Query: 841  MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEV 900
            MSLPTNTPRNYQ+LSVAQNVFVNDEQAVKNFK EYK+DEP+LPILLFALKQYRPDIISE+
Sbjct: 841  MSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPDIISEI 900

Query: 901  QKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960
            Q VREKEIKFWAQLCPYFTRRRLASQS LLHADNIFFLVETGMLKATYELPQGTLYEIFS
Sbjct: 901  QTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFS 960

Query: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCI 1020
            NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSL K+KE+NLALYVEV LMVMCI
Sbjct: 961  NGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLMVMCI 1020

Query: 1021 KDTRFKELLGYTLVSA 1036
            KDTRFKELLGYTLVSA
Sbjct: 1021 KDTRFKELLGYTLVSA 1036

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1851 bits (4795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 918/1037 (88%), Positives = 969/1037 (93%), Gaps = 1/1037 (0%)

Query: 1    MGRTIRRRRSNSSLSEAISVSLGIN-QDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNS 59
            MGR IRRRRSNSSLSEAI+VSLGIN QDSS NK+HRAS S MSPPLCRSYMSGFFTGG+S
Sbjct: 1    MGRNIRRRRSNSSLSEAITVSLGINYQDSSKNKIHRASASTMSPPLCRSYMSGFFTGGSS 60

Query: 60   PMINNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGN 119
            PM  N+SD KLP SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDII +
Sbjct: 61   PMNYNMSDPKLPFSNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIDS 120

Query: 120  GDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGY 179
             DRKDDQSMRTIEENIDEEY+DEYSRLLLSPASSNVDD+RNR LQ S   +LEDG+ GGY
Sbjct: 121  DDRKDDQSMRTIEENIDEEYADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGY 180

Query: 180  QSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVF 239
            QS+ PSH+LRF PR++W   TSFPSKFA YLPAAVLGLLLNILDALSYGMIIFPITEPVF
Sbjct: 181  QSVHPSHDLRFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVF 240

Query: 240  SHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDD 299
            SHLGPTGISMFYISTIISQ+VYSGGWSSFPSG+GSEMIEITPFYHTMAL IKEAL G+DD
Sbjct: 241  SHLGPTGISMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSDD 300

Query: 300  EIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 359
            EIITTTIFCYVISSMLTGVVFY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT
Sbjct: 301  EIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVT 360

Query: 360  TRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLF 419
            TRVAKFEYSWPF SGLFT+YDTLAKWLLPVLLTVVLIGTQR FKNSLVLP+FYILTLVLF
Sbjct: 361  TRVAKFEYSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLF 420

Query: 420  HFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTF 479
            HFIVAIIPTLSLD LR +GWIFPIA+SDSKWYDHY+LFN+HKVHW+LVLQQIPTMMALTF
Sbjct: 421  HFIVAIIPTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTF 480

Query: 480  FGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 539
            FGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG
Sbjct: 481  FGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAG 540

Query: 540  ADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFE 599
            ADS FAGFLL+ALT+C                   LIFLLGYELLVEALVDTW+KLNRFE
Sbjct: 541  ADSSFAGFLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFE 600

Query: 600  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQ 659
            YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQT+NGEYNGNVA+STVYRDYVQ
Sbjct: 601  YLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQ 660

Query: 660  TKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINA 719
            TKFLDGIGEQIYVLKLQN+LFFGTIISIEEKIERLL+ISNKD+TKRRIKYLILDFKNINA
Sbjct: 661  TKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINA 720

Query: 720  DNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALE 779
            DNIDYSAAEGFNRIKRFTETKRIKLIISSIKERD IYNAFNNVGLLNDVELFADLN ALE
Sbjct: 721  DNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALE 780

Query: 780  WCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARN 839
            WCENEFLFQYKQLR+KAK+RLEE KQNNVVSA++AAT+NKKID  G  LN+G N D AR+
Sbjct: 781  WCENEFLFQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARH 840

Query: 840  LMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISE 899
            LMSLPTNTPRN+Q+LSVAQNVF NDEQAVKN KKEYK+DEPVLPILLFALKQYRPDI+SE
Sbjct: 841  LMSLPTNTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSE 900

Query: 900  VQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIF 959
            VQKVREKEIKFWAQLCPYF+RRRLASQS LLHADN+FFL+ETGMLKA YELPQG+LYEI 
Sbjct: 901  VQKVREKEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIM 960

Query: 960  SNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMC 1019
            SNGTCFGKIIAPGN MPREQKLTIETETDS+LWVIDSSSL K+KE+NLALYVEV LM+MC
Sbjct: 961  SNGTCFGKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMC 1020

Query: 1020 IKDTRFKELLGYTLVSA 1036
            IKDTRFKELLGYTLVSA
Sbjct: 1021 IKDTRFKELLGYTLVSA 1037

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1287 bits (3330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 681/1064 (64%), Positives = 803/1064 (75%), Gaps = 54/1064 (5%)

Query: 6    RRRRSNSSLSEAISVSLGINQ----------DSSVNKMHRASVSAMSPPLCRSYMSGFFT 55
            +++    S+S +ISVSLG+ Q          D +VN  +          + RSY+SGF +
Sbjct: 10   KKKNKQQSISGSISVSLGLQQEEEPRDDYFDDENVNNNNY---------MGRSYVSGFLS 60

Query: 56   GGNSPMINNLSDSK-LPIS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTI 110
               + M +   D + LP++     +   + IH SE LH+QTA +S +F     +     I
Sbjct: 61   VSPALMGSMKQDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDEDDTR---I 117

Query: 111  KDYMDII---GNG---DRKDDQSMRT---IEENIDEEY---------SDEYSRLLLSPAS 152
            KDY+ +     NG   D+ D    R     +E  +E++          DE SRLL+SP S
Sbjct: 118  KDYITLFQGEDNGLMADKNDSLDQRLGLGQDEEAEEDFIEPVAEAADVDESSRLLISPLS 177

Query: 153  SNVDDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPA 212
            SN++ + +  L   +  ++   Y   Y++  PS  L      +W     FP +F HYLPA
Sbjct: 178  SNINPNIDDLLPTVTGEDVS-SYQSIYRTATPS--LSRNSETIWQNIADFPYQFIHYLPA 234

Query: 213  AVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGI 272
            AVLGLLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFYISTIISQ +YS GWSSFPSGI
Sbjct: 235  AVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGI 294

Query: 273  GSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIV 332
            GSEMIE+TPF+HTMALAIKE L G DDEIITTTIFCYVISSMLTG+ FY+LGKL LGKIV
Sbjct: 295  GSEMIEVTPFFHTMALAIKETLPGRDDEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIV 354

Query: 333  GFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLT 392
            GFFPRHILIGCIGGVGYFL++TGIEVTTRVAKFEYS PF + LF+D+ TL KWLLPVLLT
Sbjct: 355  GFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLT 414

Query: 393  VVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYD 452
            V+LI TQR FKNSLVLPSFYILTL+LFHFIVAIIP+L+L+ LR +GWIFPIA S+SKWYD
Sbjct: 415  VILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYD 474

Query: 453  HYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGY 512
            HY+LF+  KVHW+LV +QIPTM+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHG 
Sbjct: 475  HYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGL 534

Query: 513  SNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXX 572
            SNF SG +GS+QNYLVYTNSVLFIRAGADS  AG++LI LT                   
Sbjct: 535  SNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIV 594

Query: 573  XXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLV 632
              LIFLLGYELLVEAL D W K++ FEY+T+VIIV TMGIFDFVLGIIVGILIACFSFL+
Sbjct: 595  GSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLI 654

Query: 633  DSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIE 692
            DSTKLQTINGEY+G VA+STVYRD +QTKFL+GIGEQIYVLKLQNLLFFGTIISIEEKI+
Sbjct: 655  DSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKID 714

Query: 693  RLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKER 752
             LL+I +KD+++ RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TK+I+L+ISSIKER
Sbjct: 715  ELLEICHKDSSRLRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKER 774

Query: 753  DRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAV 812
            D IY AF+NVGLL  VELF DLNSALEWCENEFLF+YKQLR KAK RL   KQ   ++A 
Sbjct: 775  DHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYKQLRDKAKSRLHR-KQIIDINAS 833

Query: 813  IAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFK 872
            I + K +   T GN  ++ SN D  RNLMSLP NTPRN+QILSVAQNVF N+EQ VKN K
Sbjct: 834  IGSQKYQF--TAGN--DKKSNLDIPRNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLK 889

Query: 873  KEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHA 932
             E KD  P LP+LLF LKQYRP IIS  + V+E EIKFW+QLCPYF +  LASQS L+H 
Sbjct: 890  TELKDQAPFLPLLLFTLKQYRPGIISTDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHN 949

Query: 933  DNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLW 992
            +NIFF+VETG+LKAT+ LPQG +YE  SN TC+GKI    N     + LTI  E DS+LW
Sbjct: 950  NNIFFIVETGILKATFNLPQGNIYETMSNRTCYGKITGQHNE-STLKTLTIRAEIDSILW 1008

Query: 993  VIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            VIDS SL K++ +N  L+ E+ L++M +KD RFKELLGYTLVSA
Sbjct: 1009 VIDSGSLIKMRAENAELFTELTLLIMAVKDNRFKELLGYTLVSA 1052

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1284 bits (3323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1067 (62%), Positives = 808/1067 (75%), Gaps = 48/1067 (4%)

Query: 5    IRRRRSN-SSLSEAISVSLGI-NQDSSVNKMHRA-------SVSAMSPPLCRSYMSGFFT 55
            +RR+++N  S+S+ ISVSLG+ NQD  + +           ++S  S  L RSY+SGF +
Sbjct: 1    MRRQKNNRHSISDTISVSLGLQNQDPQILQQPNGGPTVTLGNMSDTSNYLGRSYVSGFLS 60

Query: 56   GGNSPMIN-NLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYM 114
               SP IN + +++ LPI+N+   K IH S+NLHRQTA +S +F +    E+   +K+Y+
Sbjct: 61   A--SPAINHDNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNNDPTFEDDINMKEYI 118

Query: 115  -----DIIGNG------------DRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDD 157
                 D  GN             DR D+      E   D    DE SRLLLSP  S+   
Sbjct: 119  SNLEDDATGNNGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLL 178

Query: 158  DRNRGLQNSSLPELEDGY---AGGYQSLRP--SHNLRFRPRNLWHMCTSFPSKFAHYLPA 212
                 L + S  E E         YQS+R   S +  +     W    + PS+   YLPA
Sbjct: 179  AGENLLPSISEQEQETAQRRRTSAYQSIRHRNSESTEYSSIPTWRKYIATPSEIIQYLPA 238

Query: 213  AVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGI 272
            ++LGLLL ILDALSYGMIIFPITEP+FSHLGPTGISMFYISTIISQ+++SGGWSSFP GI
Sbjct: 239  SILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFPCGI 298

Query: 273  GSEMIEITPFYHTMALAIKEALA-GNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKI 331
            GSEMIE+TPF+HTMA AIK+AL  G++D+IITTT+FCYVISSMLTG+ FY+LGKL LGKI
Sbjct: 299  GSEMIEVTPFFHTMAFAIKDALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHLGKI 358

Query: 332  VGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLL 391
            VGFFPRHILIGCIGGVGYFLIITGIEV+TRVAKF+Y+ PF + LFTD  TL +WLLP LL
Sbjct: 359  VGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLPTLL 418

Query: 392  TVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWY 451
            TV+LI  Q+  +NSLVLPSFYILTL+LFHF+VAIIP+LSL+ LR +GWIFP A +DSKWY
Sbjct: 419  TVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDSKWY 478

Query: 452  DHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHG 511
            DHY+LFN+HKVHW+L+L+QIPTM+ALTFFGILHVPINVPALAMSLQMD+YDVD+ELIAHG
Sbjct: 479  DHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELIAHG 538

Query: 512  YSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXX 571
             SNF SG+ GS+QNYLVYTNSVLFIRAGADS  AG +LI LTI                 
Sbjct: 539  VSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIPICI 598

Query: 572  XXXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFL 631
               LIFLLGYELLVEALVD   K+++FEY+T+VIIVFTMGIFDFVLG+IVGILIACFSFL
Sbjct: 599  VGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACFSFL 658

Query: 632  VDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKI 691
            +DSTKLQTINGE++G VA+STVYRD +QTKFL+GIGEQIYVLKLQNLLFFGTIISIEEKI
Sbjct: 659  IDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKI 718

Query: 692  ERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKE 751
            ++LL+IS+ D++K RIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRI+LIISSI+E
Sbjct: 719  DKLLEISDMDSSKHRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSIRE 778

Query: 752  RDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSA 811
            RD IYNAFNNVGLL  VELF DLNSALEWCENEFLF+YK LR+K ++     K+ N +  
Sbjct: 779  RDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYKTLREKTRQ-----KRKNKIDI 833

Query: 812  VIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNF 871
             +A T     +       R  + +  RN+MSLP NTPRN Q+LSVAQNVF N+EQA K  
Sbjct: 834  NLAITNGNPTE------ERNMHLEIPRNIMSLPMNTPRNNQMLSVAQNVFRNEEQAAKAL 887

Query: 872  KKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLH 931
            K+++K++  VLP+LLF LKQYRP I+S  + + EKEIKFW+QLCPY + R L +QS L H
Sbjct: 888  KQQFKNEPSVLPLLLFVLKQYRPRIVSNDKSIEEKEIKFWSQLCPYLSERFLVAQSTLKH 947

Query: 932  ADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGN--AMPREQKLTIETETDS 989
             +N FF+VE+G+LKAT+ LP GTLYE  SN TC+GKI+   N   +  EQ LTI+TETD 
Sbjct: 948  NNNFFFIVESGILKATFTLPSGTLYETMSNRTCYGKILGSNNETTVLNEQDLTIKTETDC 1007

Query: 990  VLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
             LWVID  +L +++ +NL LY+E+ L++M I+DTRFKELLGYTLVSA
Sbjct: 1008 NLWVIDMDALTRMRAENLELYIELVLLIMSIRDTRFKELLGYTLVSA 1054

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1225 bits (3169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1041 (59%), Positives = 759/1041 (72%), Gaps = 37/1041 (3%)

Query: 24   INQDSSVNKMHRASVSAMSPP-------LCRSYMSGFFTGGNSPMINNLSDSKLPISNKQ 76
            +N+ +S+N   R +   +  P       L RSY+SG      S +      + LP+SNK 
Sbjct: 39   LNESNSLNVNARPNTKNVGIPNNDTNTFLGRSYVSGIL---GSSLPQGGERNTLPVSNKF 95

Query: 77   HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG--------DRKD-DQS 127
              + IH    LHRQTA ++ EF   ++ E+  ++K+Y++++           +R+D D  
Sbjct: 96   GSRAIHEQNKLHRQTAAIAEEFDDGTIGESPSSLKEYLNLLDEAQEEELDLRNRRDLDND 155

Query: 128  MRT---------IEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELED-GYAG 177
            + T         ++   D E  ++ +  LL+P+SSN D+  +   + + L    +     
Sbjct: 156  LITDNKTPVSINLKRATDPEL-EQQTVALLTPSSSNNDNYGSVSPEENFLSATSNYEQES 214

Query: 178  GYQSLR--PSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPIT 235
             YQS+   PS   R  P +          +  +Y+PAA+LGLLLNILDALSYGMIIFPIT
Sbjct: 215  TYQSITVVPSAGFRQMPTSTTAKAWMTLKRVTNYMPAAILGLLLNILDALSYGMIIFPIT 274

Query: 236  EPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALA 295
            EP+F+ LGPTGISMFYISTIISQ +YS GWSSFPSGIGSEMIEITPFYHTMALAI +AL 
Sbjct: 275  EPIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP 334

Query: 296  GNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 355
            G DDEIITTTIFCYVISS++TG+ FY LGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG
Sbjct: 335  GRDDEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394

Query: 356  IEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILT 415
            +EVTTR+AKFEYS PF + LF D   L KWLLP +LT++LI TQ+ FKNSLVLPSFYI+T
Sbjct: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIIT 454

Query: 416  LVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMM 475
            L+LFHF+VAI P LSL  LR+ GWIFP     SKWYDHYR F++ K HWSLV++QIPTM+
Sbjct: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514

Query: 476  ALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLF 535
            ALTFFGILHVPINVPALAMSLQMDKYDVD+ELIAHGYSNFFSGL GSVQNYLVYTNSVLF
Sbjct: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574

Query: 536  IRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKL 595
            IRAGADS  AG++LI LTI                    LIFLLGYELLVEA++D + K+
Sbjct: 575  IRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634

Query: 596  NRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYR 655
              FEY T+ IIV TMGIFDFVLGI+VGILIACFSFLVDSTKLQT+NGE++G VA+STVYR
Sbjct: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694

Query: 656  DYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFK 715
            D+ QT+FL  IGEQIYVLKLQN+LFFGTIISIEEKIERLL+IS+ D +K RIK+LILDFK
Sbjct: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754

Query: 716  NINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLN 775
            NINADNIDYSAAEGFNRIKR+TE KRIKLIIS+I+E DRIY+ FN VGLL D+ELF DLN
Sbjct: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814

Query: 776  SALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGD 835
            SALEWCENEFL+QYK+LR+KA+ +L+   +N     + AA  N+         N+G    
Sbjct: 815  SALEWCENEFLYQYKELREKARNKLQRRSKN-----INAAIGNQLRRYDQTNKNQGPTSS 869

Query: 836  TARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPD 895
              +NLMSL  NTPRNYQ++S AQ  F N++Q       + K  +P+L +LLFALK YRP+
Sbjct: 870  LMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLYRPN 929

Query: 896  IISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTL 955
            I+S   + R  E++FW QLCPYFTR+   + +  LH +N FFLV+ G+LK  Y LP G++
Sbjct: 930  IVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSV 989

Query: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVAL 1015
            YE  SNGTC+GKI++  +     Q L ++ ETD++LW+ID  S+  +K DN+ LY E+ L
Sbjct: 990  YETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVL 1049

Query: 1016 MVMCIKDTRFKELLGYTLVSA 1036
            +++ I+DTRFKELLGYTLVSA
Sbjct: 1050 LILAIRDTRFKELLGYTLVSA 1070

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1211 bits (3133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/1085 (58%), Positives = 785/1085 (72%), Gaps = 61/1085 (5%)

Query: 7    RRRSNSSLSEAISVSLGI-NQDS--SVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMIN 63
            +R +  S+SE+ISVSLG+ N D+  S N+     +   S  L RSY+SG ++       N
Sbjct: 10   KRPARQSISESISVSLGLQNNDARQSDNENPLQVLPGESSYLGRSYVSGLWSPTQR---N 66

Query: 64   NLSDSKL-PISNKQ-HPKVIHGSENLHRQTAQLSNEFCSSSVEENSPT--IKDYMDIIGN 119
            N S   L P SN+Q + K IH S+ LHRQT  +   F  S+ +E S    + +Y+D++ +
Sbjct: 67   NKSGYDLLPTSNEQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSENKDLNEYIDLVEH 126

Query: 120  GDRKD------DQ---------------SMRTIEENIDEEYS--DEYSRLLLSP------ 150
             +RK       DQ                   +   + +EY   DE SRLLL+P      
Sbjct: 127  NERKTANIDNVDQIGGLATGPQTTVPGNKTHPVTSPLSDEYGIPDENSRLLLTPVSSLSV 186

Query: 151  ----ASSNVDDDRNRGLQNSSLPELEDGYAGGYQSLRP--SHNLRFRP--RNLWHMCTSF 202
                ASS   +D N G   S L  +   Y     +L    S  ++  P   + W   ++ 
Sbjct: 187  AISDASSLTPEDYN-GRARSPLNGINSTYGSQIPTLSSYSSAGMKIGPPITSKWDYISAL 245

Query: 203  PSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYS 262
                 HYLPA++LGLLLNILDALSYGMIIFPITEP+FS LGP+G+SMFYIST+ISQ  YS
Sbjct: 246  SHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYISTVISQFTYS 305

Query: 263  GGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGN-DDEIITTTIFCYVISSMLTGVVFY 321
             GWSSFP GIGSEMIE+TPF+HTMAL I + L     +EIITTTIFCYVISSM TG+ F+
Sbjct: 306  SGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTIFCYVISSMFTGLTFF 365

Query: 322  ALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDT 381
             LGKL+LGK+VGFFPRHILIGCIGGVGYFL+ITGIEV TR+AKFEYS PF   LFTD  T
Sbjct: 366  TLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPFLLNLFTDEKT 425

Query: 382  LAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIF 441
            L +WLLP +LT++LI TQ  F+NSLVLPSFYILTL+LFHFIVAI+P LSL  LR +GWIF
Sbjct: 426  LFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSLTKLRNSGWIF 485

Query: 442  PIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKY 501
            P+A S+  WYDHY+ FN   VHW+LV++QIPTMMALTFFGILHVPINVPALAMSLQMDKY
Sbjct: 486  PVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPALAMSLQMDKY 545

Query: 502  DVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXX 561
            DVDRELIAHGYSNFFSGL GS++NYLVYTNSVLFIRAGADS  AG++LI LTI       
Sbjct: 546  DVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIVLTIIVMLIGP 605

Query: 562  XXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIV 621
                         LIFLLGYELL+EALVDTW KLN FEY+TV II+ TMGIFDFVLGIIV
Sbjct: 606  VIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMGIFDFVLGIIV 665

Query: 622  GILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFF 681
            GILIACF FL+DST LQT+NGE++G VA+STVYRD +QT FLDG+GEQIYVLKLQNLLFF
Sbjct: 666  GILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIYVLKLQNLLFF 725

Query: 682  GTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKR 741
            GTIISIEEKI++LL+ISN D++KRRIKYLILDFKNIN DNIDYSAAEGFNRI+RFT+TK 
Sbjct: 726  GTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSAAEGFNRIRRFTQTKG 785

Query: 742  IKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLE 801
            I+LIISSI+E+D IY AFNNVGLL DVELF DLNS+LEWCENE L  Y +LR KAK RL 
Sbjct: 786  IQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYNELRTKAKARLR 845

Query: 802  EGKQNNVVSAVIA---ATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQ 858
              K NN  ++V++    + +K++D+        S      NLMSLPTNTPRN+Q+L+VAQ
Sbjct: 846  --KLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAISNLMSLPTNTPRNHQMLTVAQ 903

Query: 859  NVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYF 918
            +VF NDEQ V + +K+ K  +P+LP+LL  LKQYRPDI S  +  R+KEI  W++LCPYF
Sbjct: 904  DVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLARDKEIAIWSRLCPYF 963

Query: 919  TRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAM--- 975
             ++ + +Q+ L H + IFFLV+TG+LKA ++LPQG +YE  +N TC+GKII  G  +   
Sbjct: 964  AKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCYGKIIDSGTTVDDA 1023

Query: 976  ----PREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGY 1031
                P   KL I TETDS LWVID++++ +L+ ++  L++++AL+VM IKD RFK+LLG+
Sbjct: 1024 DTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLVMLIKDKRFKDLLGH 1083

Query: 1032 TLVSA 1036
             L+SA
Sbjct: 1084 ALISA 1088

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 638/1049 (60%), Positives = 783/1049 (74%), Gaps = 47/1049 (4%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSVNKMHRASVSA---------MSPP---LCRSYMSGFF 54
            R R   S+SEAISVSLG+   ++    H  + S          MSP    L RSY+SGF 
Sbjct: 11   RNRGRHSISEAISVSLGLQNTNTPRDHHDGNHSNPYDSQNDQFMSPRNNYLGRSYVSGFL 70

Query: 55   TGGNSPM-INNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDY 113
            +   SP   N+L   +LPI+ +   K IH ++NLHRQTA+L  +F   +VE+N+  I+DY
Sbjct: 71   SC--SPYGSNSLESDRLPIA-RMRTKSIHAAKNLHRQTAKLCEDFNEPNVEDNN--IQDY 125

Query: 114  MDIIGNGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPE-LE 172
               +   +      +   E   D+E  DE    L +P   N +D   RG     + E L 
Sbjct: 126  ---VSATEEPRPMEISDAERMYDQE--DE----LRNPVHVNTED---RGDDIEDVYESLV 173

Query: 173  DGYAGGYQSL--RPSHNLRFRPRN-LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGM 229
             G  GGY+++   P   LR   R+ LW    S  SK  HYLPA +LGLLLN+LD LSYGM
Sbjct: 174  TGAHGGYRAIPTSPGGGLRTSSRSALWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGM 233

Query: 230  IIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALA 289
            IIFPITEP+FSHLGP+G+SMFY+STIISQ +YS G+S+FP+G+GSEMIE+TPF+H+MALA
Sbjct: 234  IIFPITEPIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALA 293

Query: 290  IKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGY 349
            IK+AL G DDEI+TTTIFCYVISS++TG+ FY LGK++LGKIVGFFPRHILIGCIGGVGY
Sbjct: 294  IKDALPGRDDEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGY 353

Query: 350  FLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLP 409
            FL++TG+EVTTRVAK EY+WPF S +FTD  TL KW+LPVLLTV+LI TQR+F+NSLVLP
Sbjct: 354  FLVVTGLEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLP 413

Query: 410  SFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQ 469
            +FYI TLV FHF+VAIIP +SL  LR  GWIFP+A S  +WYDHY+LF  H+VHW L+ +
Sbjct: 414  TFYIATLVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAK 473

Query: 470  QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVY 529
            Q PTM+AL+FFGILHVPINVPALA+SLQMDKYDVD+ELIAHGYSN  SG LGS+QNYLVY
Sbjct: 474  QAPTMLALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVY 533

Query: 530  TNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALV 589
            TNS+LFIRAGADS  AG+LL  LT                     LIFLLGYELL EAL+
Sbjct: 534  TNSLLFIRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALI 593

Query: 590  DTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA 649
            +T  K+  FEY+T+ IIV TMGIFDFVLG+IVGILIACFSFLVDSTKLQTINGEY+G +A
Sbjct: 594  ETRGKVTNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIA 653

Query: 650  RSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQIS-NKDATKRRIK 708
            +STVYRDYVQ++FLDGIGEQIYVLKLQ+LLFFGTIISIEEKI +LL+IS ++  +KRRIK
Sbjct: 654  KSTVYRDYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIK 713

Query: 709  YLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDV 768
             LILD KNINADNIDYSAAEGFNRIKRFT++K I+LIISSI E D IY AF+ V LL+DV
Sbjct: 714  CLILDLKNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDV 773

Query: 769  ELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKN-KKIDTIGNG 827
            ELF DLN ALEWCENE LF+YK+LR KA++RL    QN +  A +AA  + K ID +   
Sbjct: 774  ELFGDLNGALEWCENELLFKYKELRAKARDRL----QNKMQMANLAANNDTKAIDGV--- 826

Query: 828  LNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLF 887
                      +NLMSLP NTPRN Q+LSVAQ VF N+++ V + K  YK+  PVLP+LLF
Sbjct: 827  ----PKSHHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLF 882

Query: 888  ALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKAT 947
            ALK YRP I+SE   V+  E++ W++LCPYFTRRRLASQS LLH  +IFF++ETG+LK  
Sbjct: 883  ALKPYRPGILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIV 942

Query: 948  YELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNL 1007
            Y+LPQG +YE  SN TC+G ++ PG     E K+TI+TET+ VLWVIDSS L +LK++NL
Sbjct: 943  YDLPQGIVYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENL 1002

Query: 1008 ALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            +LY E+ L++  +K+ R++++LGYTLVSA
Sbjct: 1003 SLYTELILLIATVKEQRYRQILGYTLVSA 1031

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1201 bits (3107), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/1053 (60%), Positives = 766/1053 (72%), Gaps = 66/1053 (6%)

Query: 7    RRRSNSSLSEAISVSLGI-NQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNL 65
            R     SLS++IS SLG+ +Q+S++        ++ S  L RSYM G         +  L
Sbjct: 11   RASKRLSLSDSISRSLGLQDQESNIAGTDNELSNSKSNYLSRSYMYGLLPSATP--VEEL 68

Query: 66   SDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDD 125
              + LP+SN    K IH S  LH+QTA +  +F     E +  ++KDY+D I N DR + 
Sbjct: 69   ETNTLPLSNDLRNKSIHQSRILHKQTAAICEDFN----ESDEGSMKDYLDFIENTDRDNI 124

Query: 126  QSMR-------TIEENIDE-EYSDEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAG 177
               +        +    DE E  DE SRLLL+P+SSN +           +  + +G   
Sbjct: 125  NEHKESLPVTVVLSTPADEVEEQDESSRLLLTPSSSNAE-----------VSSIAEGLRH 173

Query: 178  GYQSLRPS--HNLRFRPRN---LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIF 232
             Y S+  +  +N+    +    +    ++F      Y PA+VLGLLLNILDALSYGMIIF
Sbjct: 174  HYSSIESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIF 233

Query: 233  PITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKE 292
            PI+EP+FSHLGPTG+SMFYISTII Q +YS GWSSFPS IGSEMIEITPF+HTMA AI  
Sbjct: 234  PISEPIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMR 293

Query: 293  ALAG--NDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYF 350
            +L G  N D IITTTIFCYVISSM TG+ F  LGKLRLGKIVGFFPRHILIGCIGGVGYF
Sbjct: 294  SLPGEENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYF 353

Query: 351  LIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPS 410
            L+ITGIEVTTR+AKFEYS P    LFTD   L KWL P LLTVVLI TQ+ FK SLVLPS
Sbjct: 354  LLITGIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPS 413

Query: 411  FYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQ 470
            FYI TL+LFHFIVAIIP LSL  LR+AGWIF     +S WYDHY+LF+ HKVHW LV +Q
Sbjct: 414  FYIATLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQ 473

Query: 471  IPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYT 530
            IPTM+ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHG SN  SG+ GS+QNYLVYT
Sbjct: 474  IPTMLALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYT 533

Query: 531  NSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVD 590
            NSVLFIRAGADSPFAG+LLI LTI                    LIFLLGYELLVEAL+D
Sbjct: 534  NSVLFIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLD 593

Query: 591  TWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAR 650
            TW+KL  FEY+TVV+IV TMGI DFVLGIIVGILIACF FL+DS+KLQTINGE++G VA+
Sbjct: 594  TWDKLTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAK 653

Query: 651  STVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYL 710
            STV RD +Q+KFL+GIG+QIYVLKLQNLLFFGTIISIEEKI++LL++S+++++KR+IKYL
Sbjct: 654  STVNRDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYL 713

Query: 711  ILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVEL 770
            ILDF+NINADNIDYSAAEGFNRIKR TE+K I+LIISSIK RDRIYN+FN VGLL  VEL
Sbjct: 714  ILDFRNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVEL 773

Query: 771  FADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNR 830
            F DLN ALEWCENEFL+QYK +R++ K                   KN K  T       
Sbjct: 774  FNDLNGALEWCENEFLYQYKMIRERIK------------------IKNVKTAT------H 809

Query: 831  GSNGDTAR-NLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFAL 889
             S+G+ ++ + M+L  NTPRNYQI SVAQN+F N+EQ V   K  ++D  PVLP+LLFAL
Sbjct: 810  SSDGNLSKPSAMTLSINTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFAL 869

Query: 890  KQYRPDIISEVQKVRE-KEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATY 948
            KQYRPDI+S V KV++ KEI+FW+QL PYF+++R+ASQS L H +NIFFLVE G+LK T+
Sbjct: 870  KQYRPDIVS-VDKVKKGKEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTF 928

Query: 949  ELPQGTLYEIFSNGTCFGKI-----IAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLK 1003
            +LPQG +YE  S   C+GKI     ++  +A P  Q + I+TE D+V+W+IDSS+L K+K
Sbjct: 929  DLPQGKVYETMSKRACYGKIMGKIPVSEADA-PSSQAMIIKTEADTVIWIIDSSALKKMK 987

Query: 1004 EDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            ++N+ LY+E+ L+VM IKD RFK LLG+ LVS 
Sbjct: 988  DENIELYLELVLLVMTIKDIRFKSLLGHALVST 1020

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1198 bits (3100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/1065 (58%), Positives = 759/1065 (71%), Gaps = 81/1065 (7%)

Query: 6    RRRRSNSSLSEAISVSLGINQD-------------------SSVNKMHRASVSAMSPPL- 45
            R  R+  S+S AISVSLG+N+                      +N+   +S+  +SPP  
Sbjct: 7    RPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPFY 66

Query: 46   ------CRSYMSGFFTGGNSPMIN----NLSDSKLPISNKQHPKVIHGSENLHRQTAQLS 95
                   RSY+ G F    SP +N    N   S LPI ++   K IHGS+ +HRQTA+LS
Sbjct: 67   NSNNYAGRSYLGGGFLSA-SPKMNLQQRNDDSSVLPI-DRSRSKSIHGSQIIHRQTAELS 124

Query: 96   NEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNV 155
            N F                         D   M        EE  + Y  +         
Sbjct: 125  NNFSD-----------------------DTTGM--------EEVRNRYDAM--------- 144

Query: 156  DDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVL 215
             +D N  L +    +      GG      ++N     R        F     HY P+AVL
Sbjct: 145  -EDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSSIVQFGQDVLHYFPSAVL 203

Query: 216  GLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSE 275
            GLLLNILD LSYGMIIFPITEP+FSHLG TG+SMFYISTIISQ +YSGG SSF SGIGSE
Sbjct: 204  GLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQCLYSGGLSSFTSGIGSE 263

Query: 276  MIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFF 335
            MIE+TPF+HTMA AI++A+ G DD+IITTTIFCY ISS++TG+ FY LGKLRLGKIVGFF
Sbjct: 264  MIEVTPFFHTMAFAIRDAIPGQDDDIITTTIFCYAISSVVTGITFYLLGKLRLGKIVGFF 323

Query: 336  PRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVL 395
            PRHILIGCIGGVGYFL+ITG+ VTTR+AK EY+W F   LF D D L KWLLPV+LT++L
Sbjct: 324  PRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFLDTDILWKWLLPVVLTILL 383

Query: 396  IGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYR 455
            + TQ+ F+NSLVLPSFYI+TL+LFHF+VAI+P++SLD LR  GWIFP A S  +W+DHY+
Sbjct: 384  VNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDLGWIFPAATSKDRWFDHYK 443

Query: 456  LFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNF 515
            LF+ HKVHW+LVL QIPTM+ALTFFGILHVPINVPALA+SL MDK+DVD+ELIAHGYSNF
Sbjct: 444  LFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLHMDKFDVDKELIAHGYSNF 503

Query: 516  FSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXL 575
             SG++GS+QNYLVYTNSVLFIRAGADSPFAG++L  LT                     L
Sbjct: 504  ISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVMVIGPVIVSFIPICIVGSL 563

Query: 576  IFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDST 635
            IFLLGYELLVEAL+DT  K+  FEY+T+VIIV TMGI+DFVLG+IVGILIACFSFLVDST
Sbjct: 564  IFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVLGVIVGILIACFSFLVDST 623

Query: 636  KLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLL 695
            KLQTINGE++G VARSTV RDYVQ+ FL+G+GEQIYVLKLQN+LFFGTIISIEEKI++LL
Sbjct: 624  KLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQNVLFFGTIISIEEKIDKLL 683

Query: 696  QISN-KDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDR 754
            +I++ K ++KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+TKRIKLIISSIKERD 
Sbjct: 684  EITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQTKRIKLIISSIKERDH 743

Query: 755  IYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIA 814
            IYN F+NVGLL+DVELF DLN ALEWCENEFL +YK+LR +A+E+++     NV SA+ A
Sbjct: 744  IYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRAREKMQHSY--NVTSAIEA 801

Query: 815  ATKNKKIDTIGNGLNRGS-NGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKK 873
            A   KK+ T  N +++ + +    RNL SLP NTPRN+Q+LSVAQN+F NDE+ V   + 
Sbjct: 802  AAA-KKVPTDNNQISKKNLSLLNFRNLSSLPMNTPRNHQMLSVAQNMF-NDEEDVDALED 859

Query: 874  EYKDD--EPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLH 931
            E  +D  +PVLP+LLFALK YR +I S    +RE+E + W+QL PYF +RRL +QS LLH
Sbjct: 860  ESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLVPYFVKRRLTTQSILLH 919

Query: 932  ADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVL 991
              + FF+VE+G+LK   +LPQG +YE  SN TC G I+        E K+TI TETD+ L
Sbjct: 920  NQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKSSEEHKVTIVTETDTCL 979

Query: 992  WVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            W+ID   L KL+ +NL LY E+ L+ + IK  RF++LLGYTLVSA
Sbjct: 980  WLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVSA 1024

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/1065 (57%), Positives = 773/1065 (72%), Gaps = 46/1065 (4%)

Query: 2    GRTIRRRRSNSSLSEAISVSLGINQD----------------SSVNKMHRASVSAMS-PP 44
            G+    RR   S SEA+SVSLG+++                 S  N    +SVS      
Sbjct: 9    GQDSSNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTSSVSNREFGR 68

Query: 45   LCRSYMSGFFTGGNSPMIN-NLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSV 103
            + RSY     +   S  +N + +D  LPI  K   K I G + LHRQTA++SN+F  +S+
Sbjct: 69   IGRSYAGSISSNSPSLYLNTSRTDELLPI-RKMPSKSILGPDALHRQTAEISNDFNDTSM 127

Query: 104  EENSPTIKDYMDIIGNGDRKDDQSMRTIEENIDEEYSDEY--SRLLLSP---ASSNVDDD 158
            +E    IK Y++++   +RK  ++    EE+        +   +  LSP   ++S +D  
Sbjct: 128  DE--AKIKRYIELL---NRKQIEAEEEGEESAVHLRPHTFIEGKSFLSPIGSSASQLDGL 182

Query: 159  RNRGL--QNSSLPELEDGYAGGYQSLRPSHN--LRFRPRNLWHMCTSFPSK---FAHYLP 211
              R L   +SS+   E      Y  +   +N  LR + R L    +SF +K     +YLP
Sbjct: 183  EQRALLTPSSSIVGNEFDLESTYDEINNDYNSILRIQSREL--TSSSFATKGLELLNYLP 240

Query: 212  AAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSG 271
            AA+LGLLLNILDALSYGMIIFPITEP+FS LGPTGISMFYISTI+ Q V SGG+SSFP G
Sbjct: 241  AAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVLSGGFSSFPCG 300

Query: 272  IGSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKI 331
            IGSEMIEITPFYHTMA AIK+AL   D+E+ITTTIFCYVISS++TG+VF+ LGKL++GKI
Sbjct: 301  IGSEMIEITPFYHTMAFAIKDALPNQDNEVITTTIFCYVISSVVTGLVFFMLGKLKMGKI 360

Query: 332  VGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLL 391
            VGFFPRHILIGCIGGVGYFLIITGIEV+TR+ KFEY+W F   L T+ DTL KWLLP LL
Sbjct: 361  VGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLDTLGKWLLPTLL 420

Query: 392  TVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWY 451
            T+ LI  QR  +NSLVLPSFYILT++LFHFIVAI+P LSLD LR+ GWIFP+ +S + WY
Sbjct: 421  TLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWIFPVTDSKNSWY 480

Query: 452  DHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHG 511
            DHY+ FN+H +HW LVL+QIPTM+ALTFFGILHVPINVPALAMSL MDKYDVDRELIAHG
Sbjct: 481  DHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDKYDVDRELIAHG 540

Query: 512  YSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXX 571
            YSN  SGLLGSVQNYLVYTNSVLFIRAGADS  AGFLL+ALT+                 
Sbjct: 541  YSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAGSVIVSFIPVCI 600

Query: 572  XXXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFL 631
               LIFLLGYEL+VEALVDT   +  FEY+T++IIVF MGI+DFVLGIIVGILIAC SF+
Sbjct: 601  VGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGIIVGILIACLSFM 660

Query: 632  VDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKI 691
            VD TKL+TINGEY+G VA+STVYRDY+QTKFL+GI +QIY+LKLQN+LFFGTIISIEEKI
Sbjct: 661  VDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLFFGTIISIEEKI 720

Query: 692  ERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKE 751
            ++LL+IS+KD +KRRIKYLILDFKNINADNIDYSAAEGFNRIKRFT+ KRI+LIISSIKE
Sbjct: 721  DKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGKRIQLIISSIKE 780

Query: 752  RDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSA 811
            +D+IY+ FN V LL DVELF DLNSALEWCENEFL+QY QL +KAK+R+ +    +  S 
Sbjct: 781  KDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRIHKRISISKDSG 840

Query: 812  VIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNF 871
                ++N+         + G +    + LMSLP NTPRN Q+LSVA+ VF N+ Q    F
Sbjct: 841  STYFSRNRS--------DSGLSAADQQMLMSLPINTPRNNQVLSVARKVFKNEAQTASKF 892

Query: 872  KKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLH 931
            K   + D+PVL +LL++++ +RPD+ SE   +REKEI FW QL PYF R    + S L++
Sbjct: 893  KTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGSTLVN 952

Query: 932  ADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVL 991
            + N FF+VE+G+++ T++LPQG + E  SN TC+GK++     +    K+  +TET+S++
Sbjct: 953  SSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETESII 1012

Query: 992  WVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            W+ID  +++++K++NL LY E+ L+VM I++ R+K L+GYTLVSA
Sbjct: 1013 WMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1086 (56%), Positives = 768/1086 (70%), Gaps = 96/1086 (8%)

Query: 8    RRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPP------LCRSYMSGFFTGGNSPM 61
            +++  S+SEAI++SLG++ D+          S+M+P       L RSY+ G F+  +   
Sbjct: 4    KKNRKSISEAITISLGLHSDNIKQPSQANRRSSMNPENSSNYYLGRSYV-GSFSSPSFLQ 62

Query: 62   INNLSDSKLPIS-NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG 120
              + +D+   +S +K   K IH S  LHRQTA LSN F     +++S    D +D+  + 
Sbjct: 63   RESSADTGHILSLHKDASKSIHESVKLHRQTAALSNNF-----DDSSDGKSDEIDVAASQ 117

Query: 121  DRKDDQSMRTI-----------------------EENIDEEYS--DEYSRLL-------- 147
            + +++   R +                       E+ I +E +  +E +RLL        
Sbjct: 118  EFQNEALQRELSLENGSYSNSNNNNNNNNQIAYSEDAITQENNGLNECTRLLSPTSAAAT 177

Query: 148  ----------LSPASSNVDDDRNRGLQNSSLPE---LEDGYAGGYQSLRPSHNLRFRP-- 192
                      LSP SS  + ++   L     P     +     G  +    H+LR +P  
Sbjct: 178  DLEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLR-QPVV 236

Query: 193  RNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYI 252
            R+ +     +  K  +Y+PA +LGLLLN+LDALSYGMIIFPITEPVFSHLGPTG+SMFY+
Sbjct: 237  RSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYV 296

Query: 253  STIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEIITTTIFCYVIS 312
            STI+SQ VYS G+S+F +GIGSEMIEITPF+HTMAL+I  +L G+DDEII+TTI CY +S
Sbjct: 297  STILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHDDEIISTTIVCYALS 356

Query: 313  SMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFF 372
            S+ TG+ F+ LGKLRLGKIVGFFPRHILIGC+GGVGYFL+ITGIEV TRV+KFEYSWPF 
Sbjct: 357  SIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPFL 416

Query: 373  SGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLD 432
              LF + + L KW+LP++LT+ LI TQ YF NSLVLPSFYI+TL LFHF+VAI+P LSL+
Sbjct: 417  RELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSLN 476

Query: 433  ALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPAL 492
            +LR++GWIFP+A S + WYD Y+L++   VHW+LVL+Q+PTM+ALTFFGILHVPINVPAL
Sbjct: 477  SLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPAL 536

Query: 493  AMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIAL 552
            AMS+ MDK+DVD+ELIAHGYSN  SG  GS+QNYLVYTNS LFIRAG+DS +AGFLL   
Sbjct: 537  AMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLALG 596

Query: 553  TICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGI 612
            T                     LIFLLGYEL+ EAL DTW KLNRFEY+T+VIIVFTMG+
Sbjct: 597  TFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMGV 656

Query: 613  FDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYV 672
            FDFVLGIIVGILIACFSFLVDSTKLQTINGE+NG VARSTVYRDY+QTKFL+ +GEQI+V
Sbjct: 657  FDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIHV 716

Query: 673  LKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNR 732
            LKLQNLLFFGTIISIEEKI+ LL+IS+KD++++RIKYLILDFKNINADNIDYSAAEGFNR
Sbjct: 717  LKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINADNIDYSAAEGFNR 776

Query: 733  IKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQL 792
            IKRFTETKRI+LIISSI E+DRIYNAFN VGLL DVELFADLNSALEWCENEFL QYKQ+
Sbjct: 777  IKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYKQI 836

Query: 793  RKKAKERLE-EGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNY 851
            R + K +L+ + KQ   +S  +                             LP NTPRN 
Sbjct: 837  RTRTKAKLQAQKKQEKHLSKSL-----------------------------LPINTPRNN 867

Query: 852  QILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKFW 911
            QI++VAQ +F  DEQ V + + +Y+  EPVLP+LL ALK++RP I+S  + V++ E  FW
Sbjct: 868  QIVTVAQKIF-PDEQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDFW 926

Query: 912  AQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAP 971
            ++LCPYF R+R A  S LLH +N+FFLVE+GMLK TY+L QG  YE  S+ TC+G+I   
Sbjct: 927  SKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRI--S 984

Query: 972  GNA-MPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLG 1030
            GNA       + I+TETD  +W+ID+++L  LKE NLALY E+ L+VM I   R KELLG
Sbjct: 985  GNAEFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLG 1044

Query: 1031 YTLVSA 1036
            Y+LVS+
Sbjct: 1045 YSLVSS 1050

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 583/1058 (55%), Positives = 756/1058 (71%), Gaps = 41/1058 (3%)

Query: 6    RRRRSNSSLSEAISVSLGINQDSSVNKMHRASV--------------SAMSPPLCRSYMS 51
            + RR +SS SEA+SVSLG+ +  ++    RA+V              ++++ P   S  +
Sbjct: 6    KERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLESTNSLTLPDSMSMKN 65

Query: 52   GFFTGGNSPMINN------LSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE 105
                  +  + +N       +DS  P  NK   K I  ++ LHRQTA+LS  F  S+  +
Sbjct: 66   NTVNINDKLVPDNSKNRTFYNDSIYPPENKTSMKSITVADILHRQTAELSKTFYDSNFTD 125

Query: 106  NSPTIKDYMDIIGN--GDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNV-DDDRNRG 162
                +KDY+DII N      +  S  T E  + +EY D++   + +  S N+ DD+++R 
Sbjct: 126  KD--VKDYIDIIDNDVATSNESDSNSTPEPYLGDEY-DQHRLAIRTQKSPNIADDEQSRL 182

Query: 163  LQ-NSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFA---HYLPAAVLGLL 218
            L  +SS+   E      Y    P   +R    ++     S    F+   HY PAAVLGLL
Sbjct: 183  LTPSSSIIGAELDLEAHYDEFEP---VRMDASSINRQNESKLIDFSQILHYFPAAVLGLL 239

Query: 219  LNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIE 278
            LNILDALSYGMIIFPITEP+F+++G  GISMFYIS+II Q + SGG+SSFP+GIGSEMIE
Sbjct: 240  LNILDALSYGMIIFPITEPIFANMGTAGISMFYISSIICQYILSGGFSSFPTGIGSEMIE 299

Query: 279  ITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRH 338
            ITPFYHTMALAIK +L   + EII+TTIFCYVISS++TG+VFY+LGKL+LGKIV FFPRH
Sbjct: 300  ITPFYHTMALAIKNSLDVQE-EIISTTIFCYVISSLVTGLVFYSLGKLKLGKIVAFFPRH 358

Query: 339  ILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGT 398
            ILIGCIGGVGYFL++TG+EVTTRVAK EYSW F S L +D++ + KWL P+LLT +LI T
Sbjct: 359  ILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFLSYLLSDFNIIGKWLTPILLTTILIFT 418

Query: 399  QRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFN 458
            Q +F+NSLVLPSFYI+T++LFHFIVA++P LSL+ LR +GWIFP+ NS+ KW+DHY+ FN
Sbjct: 419  QHHFQNSLVLPSFYIITIILFHFIVALVPMLSLNKLRDSGWIFPLTNSNDKWFDHYKYFN 478

Query: 459  VHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSG 518
            V+ V W L+L+Q+PTM+ALTFFGILHVPINVPALAMSL +DK+DVDRE IAHGYSNF SG
Sbjct: 479  VYNVSWVLILKQMPTMLALTFFGILHVPINVPALAMSLNIDKFDVDREFIAHGYSNFLSG 538

Query: 519  LLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFL 578
            L GSVQNYLVYTNSVLFIRAGADSP AG+LLI LT                     LIFL
Sbjct: 539  LFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVLTAIVMLIGPVIISFIPICIVGSLIFL 598

Query: 579  LGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQ 638
            LGYELL+EAL+DT  K+  FEY T++IIVFTMGI+DFVLGIIVGIL+AC  F+VD TKLQ
Sbjct: 599  LGYELLIEALLDTVGKVTFFEYTTIIIIVFTMGIYDFVLGIIVGILLACIKFMVDGTKLQ 658

Query: 639  TINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQIS 698
            TIN EY+G +A+STVYRD++Q+KFLDGIGEQIY++KLQN+LFFGTIISIEEKI+ LLQ+S
Sbjct: 659  TINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYLIKLQNVLFFGTIISIEEKIDTLLQLS 718

Query: 699  NKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNA 758
            + D++K RI+YLILDFKNIN DNIDYSAAEGFNRIKRFT  + IKLIISSI   D+IY A
Sbjct: 719  DSDSSKHRIRYLILDFKNINDDNIDYSAAEGFNRIKRFTHGRHIKLIISSITHTDKIYKA 778

Query: 759  FNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKN 818
            FN +GLL D+ELF+DLN+ LEWCEN++L +Y++L +KAK+RL            I   KN
Sbjct: 779  FNKIGLLQDIELFSDLNNGLEWCENKYLEKYRELHEKAKKRLHSRMS-------ILQDKN 831

Query: 819  KKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDD 878
                 I +  + G+   +++ LMSLP NTPRN+Q+LSVA+NVF N+ QAV  FK     +
Sbjct: 832  ISSRQINSTSSDGNEYQSSQRLMSLPLNTPRNHQLLSVARNVFKNETQAVSRFKNLDNGE 891

Query: 879  EPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFL 938
            +    +LL +++++RPD+ SE + +R +EIKFW QL PYF +  + + S  L+ +N FFL
Sbjct: 892  DAFTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFNKIFVETNSTFLNENNFFFL 951

Query: 939  VETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSS 998
            +++G++K T++L  G L E   + T +G + +  N   +  K+T   ET SV+W+IDS  
Sbjct: 952  LDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTHKVTFIPETKSVIWLIDSEG 1011

Query: 999  LNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            L K++++NL LY E+ L++M I D RFK LLGYTLV+A
Sbjct: 1012 LKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 1087 bits (2812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/937 (58%), Positives = 696/937 (74%), Gaps = 47/937 (5%)

Query: 119  NGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDD----------------RNRG 162
            NG   +   ++ ++E+I +  +DEYSRLL +P+ S  DD+                 N  
Sbjct: 242  NGGIVNRLPIQELDEDIID--NDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNN 299

Query: 163  LQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNIL 222
              +SS+P   D        +  S +L F+      M T    +  H +PA +LGLLLNIL
Sbjct: 300  YISSSIPTTTD--------VTQSTSLSFK-----DMLTKHSLQILHDIPACILGLLLNIL 346

Query: 223  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPF 282
            DALSYGMI+FPIT+ VF HLGPTG+SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF
Sbjct: 347  DALSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPF 406

Query: 283  YHTMALAIKEALAGND-DEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILI 341
            +HTMAL +K ++   D +EIITTTIFCYVIS + TG+VF+ LGK +LGK+VGFFPRHILI
Sbjct: 407  FHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILI 466

Query: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRY 401
            GCIGGVGYFLI+TGIEVTTRV K EYS  F   + T+  TL K +LP+ L+V+L   Q+ 
Sbjct: 467  GCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKI 526

Query: 402  FKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHK 461
            + +SL+LPSFYI+T + FHFIVA++P LSLD+LR  GWIFP+A S   WY HY+ FN   
Sbjct: 527  YSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFN 586

Query: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
             HW LV +QIPTM ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHGYSN  SGL G
Sbjct: 587  CHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFG 646

Query: 522  SVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGY 581
            SVQNYLVYTNSVLFIRAG ++  AG +L   T                     LIFLLG+
Sbjct: 647  SVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGW 706

Query: 582  ELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTIN 641
            EL+VEAL+DTW K+ +FEY+T++IIVFTMGI+DFVLGI+VGILIACFSFLVDSTKLQT+N
Sbjct: 707  ELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVN 766

Query: 642  GEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKD 701
            GE+NG VA+STVYRDYVQ++FL GI EQIYVLKLQN+LFFGTIISIEEKI+ LL+IS+ D
Sbjct: 767  GEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDND 826

Query: 702  ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNN 761
            ++KRRIKYLILD KN+N+DNIDYSAAEGFNRIKRFT++KRI+LIISSIK+ D+IY  FNN
Sbjct: 827  SSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNN 886

Query: 762  VGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQN-NVVSAVIAATKNKK 820
            V LL +VELF+DLN ALEWCENEFL+QY+Q++ KA+ R +    + +VV     +T    
Sbjct: 887  VNLLENVELFSDLNGALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLST---- 942

Query: 821  IDTIGNGLN-RGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDE 879
              ++ N LN R S+G+       LP NTPRN+Q++SVA+N+F N EQ V++F        
Sbjct: 943  --SVSNTLNDRKSSGN-------LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSI 993

Query: 880  PVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLV 939
            PVL +L+FALKQYR DI S+  KVR+KE++FW+QLCPYFT++ LA+++ LLH +N+FF+V
Sbjct: 994  PVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIV 1053

Query: 940  ETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSL 999
            E+G+LK  + LPQG++YE  SN TC+G+I+  G        L I+ ETD ++W+I+S  L
Sbjct: 1054 ESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGL 1113

Query: 1000 NKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            +K+K +NL LY E+ L+VM +KD RF  LLGY L+SA
Sbjct: 1114 DKMKAENLELYTELTLLVMSVKDDRFNNLLGYALISA 1150

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 59/148 (39%), Gaps = 53/148 (35%)

Query: 9   RSNSSLSEAISVSLGINQDSSV------------------NKMHRASVSAMSPPLCRSYM 50
           R  + LSEAIS+SLG+ +                      ++  R    ++ P L R+  
Sbjct: 14  RERNKLSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKPSISLDPTLSRNIG 73

Query: 51  SGFFTGG---------NSP---MIN-----------------NLSDSKLPISNKQHPKVI 81
           +  F  G         N P   M N                 N ++  LP+ N      I
Sbjct: 74  ARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNNDHLPVINPFPKSSI 133

Query: 82  HGSENLHRQTAQLSNEFCSSSVEENSPT 109
           HGS+NLH++TA++SNEF       NSPT
Sbjct: 134 HGSDNLHKRTAEISNEF------NNSPT 155

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score = 1085 bits (2806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/1060 (55%), Positives = 728/1060 (68%), Gaps = 83/1060 (7%)

Query: 7    RRRSNSSLSEAISVSLGINQDSS-------VNKMHRASVSAMSPP---LCRSYMSGFFTG 56
            R ++  S+SEAISVSLG+   S+       + + +  S +    P   L RSY++     
Sbjct: 5    RPKNKPSISEAISVSLGLQSQSNSDQDSSYIPRANPFSHTGDGSPHYYLGRSYVANL--- 61

Query: 57   GNSPMINNLSDS---KLPISNK-QHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKD 112
             + P +  L      +LP+S + +  + IH S +L RQTA LSNEF      E++   +D
Sbjct: 62   -SPPPLARLPGGLPGELPLSYRPEQSQSIHQSVSLRRQTAALSNEF------EDTFEFED 114

Query: 113  YMDIIGNGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASS------NVDDDRNRGLQNS 166
             +     G  +DD    T EE          +  L+SP SS      ++++  N  L  +
Sbjct: 115  QL----AGVSEDDGHSTTAEE-------PSMNGTLISPVSSVPDTPIDINEPSNALLPPN 163

Query: 167  SLPELE----DGYAGGYQSLRP------SHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLG 216
            +  +LE    DGY   Y SL+       +HN+     +L         +  +Y+PA +LG
Sbjct: 164  AEHDLEYGSIDGYEHQYVSLQSRRSGANTHNIG-PDASLREKMMFTARRMVNYMPAVILG 222

Query: 217  LLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEM 276
            LLLNILDALSYGMIIFPITEP+FSHLGPTG+SMFY+S+IISQ +YSGG+S+F + +GSEM
Sbjct: 223  LLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEM 282

Query: 277  IEITPFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFP 336
            IEITPFYH MA +I   L G  D +++TTI CY +SS++TG+VF+ LG+LRLGKIVGFFP
Sbjct: 283  IEITPFYHAMAASIVAGLPGEKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFP 342

Query: 337  RHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLI 396
            RHILIGCIGGVGYFL+ITG+EVTTRVAKFEYS+ F S LFT+ + L KW LP L+ V+L+
Sbjct: 343  RHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLV 402

Query: 397  GTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRL 456
              Q  F NSLVLP+FYI  L+LFHFIVA+IP+LSLD LR +GWIFP  +S   W+D Y L
Sbjct: 403  VVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTL 462

Query: 457  FNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFF 516
            +N   V W ++L+QIPTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF 
Sbjct: 463  YNFKLVSWPMILKQIPTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFL 522

Query: 517  SGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLI 576
            SG++GSVQNYLVYTNSVLFIRAG D   AG +L A T                     LI
Sbjct: 523  SGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLI 582

Query: 577  FLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK 636
            FLLGYELL EAL DTW KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTK
Sbjct: 583  FLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTK 642

Query: 637  LQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQ 696
            LQT+NGE++G VARSTV RDY+QT+FL+ IGEQI+VLKLQNLLFFGTI+SIEEKI++LL+
Sbjct: 643  LQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLE 702

Query: 697  ISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIY 756
            +S+KD++K+RIKYLILDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY
Sbjct: 703  LSDKDSSKKRIKYLILDFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIY 762

Query: 757  NAFNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAAT 816
             AFN VG+L  VELF DLNSALEWCENEFL Q+K LR K K                   
Sbjct: 763  RAFNKVGMLEGVELFDDLNSALEWCENEFLIQFKDLRNKTK------------------- 803

Query: 817  KNKKIDTIGNGLNRGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYK 876
                       L  G   D   + + LP NTPRN Q +SVAQ +F  DEQ++ + K  Y+
Sbjct: 804  -----------LKAGKKQDRRMSKVPLPFNTPRNNQFVSVAQKLF-TDEQSMTHLKSSYR 851

Query: 877  DDEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIF 936
            +  PVLP+LL AL+++RP I+S  + V+E E + W+ LC YF ++RLA+ S LLH DNIF
Sbjct: 852  ERPPVLPLLLSALQRFRPQIMSSDKSVKEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIF 911

Query: 937  FLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDS 996
            F++ETGM+K TY L QG LYE  S  TC+G++  P N       + +E ETD  LW+ID 
Sbjct: 912  FVIETGMVKVTYNLRQGQLYETMSGKTCYGRMSIPNNNNNPISCVEVEMETDCSLWIIDD 971

Query: 997  SSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
            + L KLK +NL LY EV L+ +CI   R KELLG+ LVS+
Sbjct: 972  AGLAKLKRENLNLYTEVLLVTLCINQDRLKELLGHCLVSS 1011

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/1045 (55%), Positives = 720/1045 (68%), Gaps = 54/1045 (5%)

Query: 7    RRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLS 66
            R R+  SLSEAISVSLG+ Q    ++    SV   +P    +  S  +  G S  + NLS
Sbjct: 5    RPRNKHSLSEAISVSLGL-QSQPGSETDTLSVPRGNPFSNGADGSPHYYLGRS-YVANLS 62

Query: 67   DSKLPI-----------SNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMD 115
               L I           S  +  + IH S +L RQTA LSNEF  +   E+        D
Sbjct: 63   PPPLAIKERFSGDPTSSSRPEQSQSIHQSLSLRRQTAALSNEFDGTFEFED-----QLED 117

Query: 116  IIGNGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNV--DDDRNRGLQNSSLPELED 173
            +  NG+             I    S     +L +   SN+    +  R L+  S+ E + 
Sbjct: 118  LAENGNTAVPDESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDH 177

Query: 174  GYAGGYQSLRPSHNLR-FRPRNLWHMCTSFP-SKFAHYLPAAVLGLLLNILDALSYGMII 231
             Y    QS R   N R   P       T F   +  +Y+PA +LGLLLNILDALSYGMII
Sbjct: 178  QYVS-LQSQRAGSNSRAIDPNASMRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMII 236

Query: 232  FPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIK 291
            FPITEP+FSHLGP+G+SMFY+S+++SQ VYS G+S+F + +GSEMIEITPFYH+MA +I 
Sbjct: 237  FPITEPLFSHLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIM 296

Query: 292  EALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFL 351
             ++ G  D ++TTTI CY +SS++TG+VF+ LG+L+LGKIVGFFPRHILIGCIGGVGYFL
Sbjct: 297  ASMPGEKDRVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFL 356

Query: 352  IITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSF 411
            +ITG EVTTR +KFEYS+ F S L TD + L KW LP L+ V+L+  QR  KNSLVLP+F
Sbjct: 357  VITGFEVTTRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTF 416

Query: 412  YILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQI 471
            YI  L+LFHFIVA+IP+LSL +LR +GW+FP   +   W+D Y+L+N   V W LVL+Q+
Sbjct: 417  YIAALLLFHFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQV 476

Query: 472  PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531
            PTM+ALTFFGILHVPINVPALAMS+ +DK DVD+ELIAHGYSNF SG++GSVQNYLVYTN
Sbjct: 477  PTMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTN 536

Query: 532  SVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT 591
            S+LFI+AGAD   AG +L A T                     LIFLLGYELL EALVDT
Sbjct: 537  SLLFIKAGADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDT 596

Query: 592  WNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARS 651
            W KLN FEY TVV IVFTMG FDFVLGIIVGILIACFSFLVDSTKLQTINGE++G VARS
Sbjct: 597  WGKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARS 656

Query: 652  TVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKYLI 711
            TV RDY+QT+FL+ IGEQI+VLKLQNLLFFGTIISIEEKI++LL++S+KDA+K+RIKYLI
Sbjct: 657  TVRRDYIQTQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLI 716

Query: 712  LDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELF 771
            LDFKNINADNIDYSAAEGFNRIKRFT +KRI LIISSIK  DRIY AFN VG L+ VELF
Sbjct: 717  LDFKNINADNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELF 776

Query: 772  ADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRG 831
             DLNSALEWCENEFL Q++ LR K                    TK K +      L++G
Sbjct: 777  DDLNSALEWCENEFLRQFRDLRNK--------------------TKLKAVRKQERQLSKG 816

Query: 832  SNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQ 891
            +          LP NTPRN   +SVAQ +F  DEQ++ + K  YK+  PVL +LL AL++
Sbjct: 817  A----------LPFNTPRNNHFVSVAQKLF-TDEQSMPHLKTHYKEKTPVLHLLLSALQR 865

Query: 892  YRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELP 951
            YRP+I+S  + V+E E K W++L  +F +RRLA+QS L H +NIF +VE+GM+K TY L 
Sbjct: 866  YRPEIMSPEKPVKETEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLR 925

Query: 952  QGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYV 1011
            QG LYEI S  TC+G+I AP ++      + I+ ETD  LW++D ++L KLK++NLALY 
Sbjct: 926  QGQLYEILSGKTCYGRITAPNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYT 985

Query: 1012 EVALMVMCIKDTRFKELLGYTLVSA 1036
            E+ L+ +C+   R KELLG+ LVS+
Sbjct: 986  ELLLVTLCMNQDRLKELLGHCLVSS 1010

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  973 bits (2516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/926 (55%), Positives = 643/926 (69%), Gaps = 63/926 (6%)

Query: 123  KDDQSMRTIEENIDEEYSDEYSRLLLSPASSN---------VDDDRNRGLQNSSLPELED 173
            KDD S   +        SD    L L P +S+          D++     Q  SL  L D
Sbjct: 184  KDDSSFLDV--------SDSTENLALLPTNSHNSMYVEYGTFDEENQPATQYISL--LPD 233

Query: 174  GYA-GGY--QSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMI 230
            G + GG+  Q  R S +   + R+L  M   F      Y PA  LGLLLNILDALSYGMI
Sbjct: 234  GASSGGFTSQGFRSSMSHYDKARDL--MLRIF-----QYTPAVGLGLLLNILDALSYGMI 286

Query: 231  IFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAI 290
            IFPITEP+FSHLGPTG+SMFY+ST+I Q  +S G SSFPS IGSEMIEITPF+HTMAL+I
Sbjct: 287  IFPITEPLFSHLGPTGLSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSI 346

Query: 291  KEALA-GNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGY 349
              ++  GND+++I+TTI CY +SS++TG+ F+ LGK+RLGKIVGFFPRHILIGCIGGVGY
Sbjct: 347  MNSIPEGNDNKVISTTIVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGY 406

Query: 350  FLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLP 409
            FLIITG+EV TRV +F+YSW F S LFTD+D L KWL PV+LT++LI  Q    NSLVLP
Sbjct: 407  FLIITGLEVCTRVPEFKYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLP 466

Query: 410  SFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQ 469
            SFYI+TL+LFHF+VA++P+LSLD LR  GWIF   N+   WYD Y+L++   V WSL+ +
Sbjct: 467  SFYIITLLLFHFVVALVPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPK 526

Query: 470  QIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVY 529
            Q+PTM+ALTFFGILHVPINVPALAMSL +DKYDVD+ELIAHGYSN  SG LGS+QNYLVY
Sbjct: 527  QVPTMLALTFFGILHVPINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVY 586

Query: 530  TNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALV 589
            TNSVLFIRAGADSP AG +L   T                     LIFLLGYEL+ EA++
Sbjct: 587  TNSVLFIRAGADSPIAGIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVI 646

Query: 590  DTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVA 649
            DTW KL  FEYLT+ IIV TMG+ DFV+GIIVGIL+ACFSFLV+ST+LQTINGEY+G VA
Sbjct: 647  DTWGKLQPFEYLTIWIIVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVA 706

Query: 650  RSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKDATKRRIKY 709
            +STVYRDY+Q+KFL  IGEQIYVLKLQN+LFFGTIISIEEK+  LL+I   D++K+RIKY
Sbjct: 707  KSTVYRDYIQSKFLRNIGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKY 766

Query: 710  LILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769
            LILDFKNI A +IDYSAAEGFNRIKRF E +RI LIISSI + D+IY AF+ V L  +VE
Sbjct: 767  LILDFKNIRAKSIDYSAAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVE 826

Query: 770  LFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLN 829
            LF+DLN ALEWCENEFL +YK++R K                    T+ +K+  +    N
Sbjct: 827  LFSDLNGALEWCENEFLMRYKRIRTK--------------------TRARKLAQLKKSQN 866

Query: 830  RGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFAL 889
            R S          LP NTPRN+Q +S  +N++  +E  ++    E K+ +  LPI L ++
Sbjct: 867  RMSK---------LPVNTPRNHQFVSEVRNIY-TEEMEIQKLSNELKERQQFLPIFLMSI 916

Query: 890  KQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYE 949
            +++R  I S  +  R  E+  W +L  YF +++    + + H +N+F +VE+G+L  T+ 
Sbjct: 917  RKFRNAIQSPNELKRTNELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHH 976

Query: 950  LPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLAL 1009
            L QG  YE  S  T +G +I+  N+ P    ++I T+T+ VL  ID+ SL  LK  +  L
Sbjct: 977  LIQGEFYETMSPKTAYG-VISNVNSDPL--AVSITTDTECVLRYIDAESLADLKLTDPEL 1033

Query: 1010 YVEVALMVMCIKDTRFKELLGYTLVS 1035
            + E+ ++VM I   RF+ELLGY+L+S
Sbjct: 1034 FTELLILVMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1059 (49%), Positives = 664/1059 (62%), Gaps = 93/1059 (8%)

Query: 13   SLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCR-------SYMSGFFTGGN----SPM 61
            S+SEA+++ L I    S        VS   P L R       SY+  F   G+       
Sbjct: 15   SISEALNIQLNIPDSPSGGANAGGPVSERIPTLMRPEAYLGRSYVGSFSNSGSLMSREAG 74

Query: 62   INNLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNG- 120
                    LP    Q    +H   +LHRQTA L ++   S   +  P  ++ +   GN  
Sbjct: 75   AAGPDSPPLPRFRDQASSYVHNGSHLHRQTAALCDD---SRAYDGGPEEEEALVFEGNMI 131

Query: 121  -------------------DRKDDQSMRTIEENIDEEYSDEY--SRLLLSPASSNVDDDR 159
                               D    + +  ++E +D+  SD+   +RL LSP +++     
Sbjct: 132  LQEGAPPRFGVGPYNLCKVDSNISEVLLNVDEAVDDSDSDQEAGTRLFLSPITTDYIHSY 191

Query: 160  NRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLL 219
                +  S  E       G   LR           LW       ++   Y+PA +LGLLL
Sbjct: 192  GAINEEQSASETASRAETGPSPLR-----------LWG------TRTVRYIPAVILGLLL 234

Query: 220  NILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEI 279
            NILDALSYGMIIFPI EP+FSHLGP G+SMFY+STIISQ VYSGG+SSF  G GSEMIE+
Sbjct: 235  NILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFGYGTGSEMIEV 294

Query: 280  TPFYHTMALAIKEAL-AGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRH 338
            TPF+HTMAL+IK +L A   D+IITTTI CY +S+++TG VF  LGKLRLGK+V FFP H
Sbjct: 295  TPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRLGKLVSFFPLH 354

Query: 339  ILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGT 398
            ILIGCIGGV YFLIITGIEV+TRV KFEYS  F   LF D D LAKWL+P LL V +I  
Sbjct: 355  ILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIPALLAVSIILL 414

Query: 399  QRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFN 458
            QR   NS++LP FY+    LFHFIVA+IP+LSLD LR  GWIFP+  S  +WYD+  L+N
Sbjct: 415  QRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGGRWYDYLELYN 474

Query: 459  VHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSG 518
              ++HW LVL +IPTM+ALTFFGILHVPINVPALA+S  +DK DVD+ELIAHGYSN FSG
Sbjct: 475  PQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELIAHGYSNIFSG 534

Query: 519  LLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFL 578
              GS+QNYLVYTNSVLFIRAGADS +AGFLL   T                     LIFL
Sbjct: 535  CAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIPVCIVSSLIFL 594

Query: 579  LGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQ 638
            LGYELL E L D++N+L+ FEY+TVVII+ TMGIFDFVLGIIVG+L+ACFSFLV+ST+ +
Sbjct: 595  LGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACFSFLVESTRAK 654

Query: 639  TINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQIS 698
            TI+ E++G VA+S  +RDY+Q+ FL+ + EQIYVLKLQN LFFGTIISIEEKI  LL+  
Sbjct: 655  TISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIEEKIGNLLE-P 713

Query: 699  NKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNA 758
            N    K+ IKYLILDFK+IN DNIDYSAAEGFNRIKR  E KRIKLI+SSI E D+IY  
Sbjct: 714  NGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSSISECDKIYTI 773

Query: 759  FNNVGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKN 818
            F+ +GLL DVELF DLNSALEWCENE L +Y+ L  +A       +  ++V         
Sbjct: 774  FSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLSRAHRVKVRRRSKDIVPKA------ 827

Query: 819  KKIDTIGNGLNRGSNGDTARNLMSLP-TNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKD 877
                                    +P  NTPRN QI++ AQ V+  ++Q  K   K YK 
Sbjct: 828  -----------------------QIPLENTPRNAQIMTAAQAVYSGEQQLNKTLSK-YKA 863

Query: 878  DEPVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFF 937
              P L +LL ALK YR    S       KEI+ W  LCPYF R+  + Q+ +    ++FF
Sbjct: 864  SHPALALLLVALKTYR----SGHAYKETKEIRLWKHLCPYFVRKSFSPQTSISDEGDMFF 919

Query: 938  LVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSS 997
            +VE+G+LK TY LPQG+L E  ++ TC+G I  PG+         + TET+ VLW+ID+ 
Sbjct: 920  VVESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSL---SYSSVVRTETECVLWMIDAP 976

Query: 998  SLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036
             L KL+E+NL LY E+ ++ + +   RFKELLG++L++ 
Sbjct: 977  GLQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 110/523 (21%), Positives = 207/523 (39%), Gaps = 67/523 (12%)

Query: 292 EALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFL 351
           E  + +D EI T TI   +  + ++GVV + LG +RLG +     + +L G I  VG  +
Sbjct: 158 EKFSAHDSEISTVTITMMI--TFISGVVLFFLGSVRLGFLGNILSKALLRGFISSVGLVM 215

Query: 352 IITGIEVTTRV------AKFEYSWPFFSGLF-----TDYDTLAKWLLPVLLTVVLIGTQR 400
           II  + +  ++          Y  P    +F     ++Y      +L ++  +VLI T R
Sbjct: 216 IINSLIIELKLNHKLADVAGHYHTPVGKIMFLFRYASEYYHKPTAILSLICFLVLIST-R 274

Query: 401 YFKNSLVLPSFYILTLVLFHFIVAIIPTLSLD-ALRQAGWIFPIA--NSDSKWYDHYRLF 457
             K  L+    +++ +     +V++   LSL    + +  I  I   N+D        L 
Sbjct: 275 IAKKKLMNRYRFLIFVPEILLVVSVTILLSLKYDFKHSYGISTIGEFNADGFGSIGNPLS 334

Query: 458 NVHKVHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMD---KYDVDRELIAHGYSN 514
           N ++  +S +  +   +  L FF            + SL  D    Y  +RELIA G+ N
Sbjct: 335 NENRALYSSLWNEGLAVAMLGFF-------ESTTASKSLGSDYNLTYSSNRELIALGFMN 387

Query: 515 FFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXX 574
               L G++ ++  Y  S + + +G  +  +G ++  +T+                    
Sbjct: 388 IVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLLLPMIHYTPTCVLSV 447

Query: 575 LIFLLGYELLVEALVDTWNKLNRFEY--LTVVIIVFTMGIFDFV-LGIIVG-----ILIA 626
           +  ++G  LL E   D    ++   Y  LTV  + F   +   V LG+ VG     ILI 
Sbjct: 448 ITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVELGVTVGCIYSLILIV 507

Query: 627 CFSFLVDSTKLQTINGE------------YNGNVARSTVYRDYVQTKFLDGIGEQIYVLK 674
             S L     L  + G             YNG    +     +          E  Y++K
Sbjct: 508 KHSALSRIQILAKLEGSDEFVNVDDYIKNYNGRDFENITLEQF----------EHCYIVK 557

Query: 675 LQNLLFFGTIISIEEKIERLLQISNKD--------ATKRRIKYLILDFKNINADNIDYSA 726
           +   L F     +  ++ RL +  + +         ++  ++Y+I D + + +  +D  +
Sbjct: 558 IPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS--MDSGS 615

Query: 727 AEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769
           A+    I R    + +++ ++ +     I     + G+L+ VE
Sbjct: 616 AQILLEIIRSYVHRDVRVYLTRVSLDREIRIRLKSAGILDLVE 658

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 111/562 (19%), Positives = 218/562 (38%), Gaps = 64/562 (11%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  ++ + + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 305 TIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I   ++ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLVSELKLDK 249

Query: 365 F------EYSWPFFSGLF-TDYDTLAKWLLPVLL----TVVLIGTQRYFKNSLVL--PSF 411
           F       Y  PF   LF  DY   A++  P  +      +++   R  K  L+    S 
Sbjct: 250 FLVSLPQHYHTPFEKVLFLIDYAP-AQYHKPTAIFSGCCFIILIVMRLLKKKLMKRHKSA 308

Query: 412 YILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQI 471
                +L   IV I+ ++ L +L+Q   I  + +     +D  +    H     L+    
Sbjct: 309 VFFPDILLVVIVTILISMKL-SLKQRYGISIVGDFSMDNFDKLKNPLTHS-RRKLMPDLF 366

Query: 472 PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531
              + +   G         +L  +  +     +REL+A G  N F  L G++ ++  Y  
Sbjct: 367 SASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGCINMFISLFGALPSFGGYGR 425

Query: 532 SVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT 591
           S +   +GA S  +G  +  +T+                    +  ++G  LL E   D 
Sbjct: 426 SKINALSGAQSVMSGVFVGIITLITMKLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDI 485

Query: 592 WNKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTK-----LQTINGE 643
              L    Y  + +   T G+   +    GI +G + +  + +  S K     L  I G 
Sbjct: 486 KFHLQCGGYSELFVFAVTFGVTIFYSIESGICIGCVYSILNIIKHSAKSRIQILARIAGT 545

Query: 644 YNGNVARSTVYRDYVQTK-----FLDGIGEQI---YVLKLQNLLFFGTIISIEEKIERLL 695
            N      T   DY++T       ++G  E+I    ++++   L F     ++++++R+ 
Sbjct: 546 SN-----FTNLDDYLRTTKKNPPAVEGRIEEIEGCMIVRIPEPLTFTNSEDLKQRLDRIE 600

Query: 696 QISNKDA--------TKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIIS 747
           +  +           +K  IKY+I D   + +  ID SAA+  + I    + + + + ++
Sbjct: 601 RFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIISCYKRRNVFIYLA 658

Query: 748 SIKERDRIYNAFNNVGLLNDVE 769
           ++   D+I       G+  +VE
Sbjct: 659 NVSINDKIRTRLLKAGVTPNVE 680

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 106/531 (19%), Positives = 197/531 (37%), Gaps = 84/531 (15%)

Query: 292 EALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFL 351
           E L  ++ EI T +I   V+ + ++G+  +  G  R G +     R +L G I  VG  +
Sbjct: 166 EKLRAHNHEISTMSI--SVLVTFISGMFLFVFGICRFGFLGNVLSRALLRGFISSVGVVM 223

Query: 352 IITGI------EVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPV----LLTVVLIGTQRY 401
           I+  +             K  +  PF    F      A + +P     L   +++ T R 
Sbjct: 224 IVNSLISELKLHKLLLETKGHFHTPFQKIRFIIKYAPANYHIPTAVLSLTCFIILVTARV 283

Query: 402 FKNSLV--------LPSFYILTLVLF----------HFIVAIIPTLSLDALRQAGWIFPI 443
            K  L+        +P   IL +             H+ ++I+     D L    +  PI
Sbjct: 284 IKKKLMRRRRWPVFVPEILILIITTIILSHKFKFKKHYEISIVGDFDTDGL--VNFYNPI 341

Query: 444 ANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTF----FGILHVPINVPALAMSLQMD 499
           + S+ +                      P +M   F     G         +L  + +  
Sbjct: 342 SKSNREL--------------------APNLMNAGFIVAILGFFESTTAAKSLGSAYEF- 380

Query: 500 KYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXX 559
               +REL+A G  N  + +LG++  +  Y  S +   +GA +  +G  +  + +     
Sbjct: 381 AISSNRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKF 440

Query: 560 XXXXXXXXXXXXXXXLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMGIFDFV 616
                          +  ++G  LL EA  D    +N     E L   + V T   +   
Sbjct: 441 FLSQIRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLE 500

Query: 617 LGIIVGILIACFSFLVDSTK--LQTI-NGEYNGNVARSTVY-------RDYVQTKFLDGI 666
           +G+ +G   +  S +  S K  +Q +   E  G    S  Y        D    + L+G 
Sbjct: 501 MGVCIGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEG- 559

Query: 667 GEQIYVLKLQNLLFFGTIISIEEKIERLLQISN-------KDATKRR-IKYLILDFKNIN 718
                V+K+   L F  +  ++E++ RL +  +       K + +R  IKYL+ D   + 
Sbjct: 560 ---CLVVKIPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMT 616

Query: 719 ADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769
              +D SAA+    I +    +R+K+ ++ +   +++ +      +LN VE
Sbjct: 617 F--MDSSAAQIMLEIVKSYNRRRVKVFLARVPLDEQVRSRLETSNILNYVE 665

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 115/559 (20%), Positives = 215/559 (38%), Gaps = 66/559 (11%)

Query: 273 GSEMIEITPFYHTMALAIKEALAGNDDEI-----------------ITTTIFCYVISSML 315
           G   +  TPF++ +  ++ + + G +  I                 +++   C +I+  +
Sbjct: 144 GLYALAFTPFFYAIFGSVPQMIVGPESAISLVVGQAIEPMIRHDPSLSSLDLCVIIT-FI 202

Query: 316 TGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSW 369
           +GVV +  G  R G +     R  L G I  VG  ++I  + V  ++ K        Y  
Sbjct: 203 SGVVLFTFGVFRFGFLDNVLSRAFLRGFISAVGVIMVINSLIVELKLKKVFDDAPSHYHS 262

Query: 370 PFFSGLFTDYDTLAKWLLPV-LLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPT 428
           PF   LF      A + LP  LL++         +           +LV F  I+ ++ T
Sbjct: 263 PFEKVLFLIKYAPANYHLPTSLLSLCCFLILMSLRLIKKKLLKRFRSLVFFPEILLVVVT 322

Query: 429 LSLDA----LRQAGWIFPIANSDSKWYDHYR-LFNVHKVHWSLVLQQIPTMMALTFFGIL 483
           +   +    L+    I  + + ++  +D  R   + +K  +   L     M+A+   G  
Sbjct: 323 VIFFSYNFDLKHRYNIEVVGDIEASVFDKLRNPLSKNKRPFYGDLFSAGFMVAM--LGFF 380

Query: 484 HVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSP 543
                  +L  +  +     +REL+A G  N    L G++ ++  Y  S +   +GA + 
Sbjct: 381 ESTTASKSLGTAYDL-AVSSNRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTV 439

Query: 544 FAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY--- 600
            +G  +  +T+                    +  ++G  LL EA  D    +    Y   
Sbjct: 440 VSGACMGTITMFTIKFLLKFIRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNEL 499

Query: 601 LTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK-----LQTING--------EYNGN 647
           ++ +I V T   +    GI VG   +    +  STK     L  + G        EY G 
Sbjct: 500 ISFIITVLTTFFYSVEAGITVGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGK 559

Query: 648 VARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERL-LQISNKD---AT 703
            + S   R   Q + ++G      ++++   L F     ++ ++ RL L  S K    A 
Sbjct: 560 NSTSE-RRVNPQLEEIEG----CLIVRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAP 614

Query: 704 KRR----IKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAF 759
           + R     KY+I D   +    ID SA +    I    + + + + +  +    ++ N F
Sbjct: 615 RSRDQEMTKYVIFDLHGMT--TIDSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRF 672

Query: 760 NNVGLLNDVELFADLNSAL 778
            N G+L  VE  +D++ +L
Sbjct: 673 VNSGILEMVE--SDIHRSL 689

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 103/566 (18%), Positives = 215/566 (37%), Gaps = 73/566 (12%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  ++ + + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGVFGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 305 TIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I   ++ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISIVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 249

Query: 365 F------EYSWPFFSGLF-TDYDTLAKWLLPVLLTVVLIGT---------------QRYF 402
           F       Y  PF   LF  DY   A++ +P   T +  G                 +Y 
Sbjct: 250 FLVSLPQHYHTPFEKILFLIDYAP-AQYHMP---TAIFSGCCLIILFLMRLLKRKLLKYH 305

Query: 403 KNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFN-VHK 461
           K ++  P       +L   IV I+ ++  D L+    I  + +     +D  +L N + +
Sbjct: 306 KGAIFFPD------ILLVVIVTILISMKFD-LKHRYGITIVGDFSMDNFD--KLKNPLTR 356

Query: 462 VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
               L+       + +   G         +L  +  +     +REL+A G+ N    L G
Sbjct: 357 SRRKLIPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFG 415

Query: 522 SVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGY 581
           ++ ++  Y  S +   +GA S  +G  +  +T+                    +  ++G 
Sbjct: 416 ALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQFVHYIPNCVLSVITTVIGI 475

Query: 582 ELLVEALVDTWNKLNRFEYLTVVIIVFTMGI---FDFVLGIIVGILIACFSFLVDSTKLQ 638
            LL E   D    L    Y  + +   T G+   +    GI +G + +  + +  S K +
Sbjct: 476 SLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGICIGCVYSILNIIKHSAKSR 535

Query: 639 TINGEYNGNVARSTVYRDYVQTKFLDGIG-------EQIYVLKLQNLLFFGTIISIEEKI 691
                     +  T   DY+     + +        E   ++++   L F     +++++
Sbjct: 536 IQILARVAGTSNFTNLDDYLMNMKRNPLSIENTEEIEGCMIVRIPEPLTFTNSEDLKQRL 595

Query: 692 ERLLQISNKDA--------TKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIK 743
           +R+ +  +           +K  IKY+I D   + +  +D SAA+  + I    + + + 
Sbjct: 596 DRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDSSAAQVLDEIITSYKRRNVF 653

Query: 744 LIISSIKERDRIYNAFNNVGLLNDVE 769
           + ++++   D+I    +  G++ +VE
Sbjct: 654 IYLANVSINDKIRTRLSKAGVIPNVE 679

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 109/563 (19%), Positives = 210/563 (37%), Gaps = 66/563 (11%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  ++ + + G +  I          IT      +
Sbjct: 130 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKDNVS 189

Query: 305 TIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I   V+ + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 190 LIDISVVITFVSGAILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINALISELKLDK 249

Query: 365 F------EYSWPFFSGLF-TDYDTLAKWLLP------VLLTVVLIGTQRYFKNSLVLPSF 411
           F       Y  PF   LF  DY   A++  P        L V+        K      S 
Sbjct: 250 FLLSLPQHYHTPFEKVLFLIDYAP-AQYHKPTAIFSGCCLIVLFSMRLLKKKLVKHHKSA 308

Query: 412 YILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQI 471
                +L   IVAI  ++   +L+    I  I +     +D  +    H     L+    
Sbjct: 309 IFFPDILLVVIVAIFISMKF-SLKHRYGITIIGDFSMDNFDKLKNPFTHS-RRKLIPDLF 366

Query: 472 PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531
              + +   G         +L  +  +     +REL+A G+ N    L G++ ++  Y  
Sbjct: 367 SASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPSFGGYGR 425

Query: 532 SVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT 591
           S +   +GA S  +G  +  +T+                    +  ++G  LL E   D 
Sbjct: 426 SKINALSGAQSVMSGVFVGIITLITMNLLLQFVHYIPNCVLSVITTVIGISLLEEVPGDI 485

Query: 592 WNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK---------LQTING 642
              L    Y  + +   T G+   +  I  GI I C   +++  K         L  + G
Sbjct: 486 KFHLRCGGYSELFVFAVTFGV-TILCSIEAGICIGCVYSILNIIKHSAKSRIQILARVAG 544

Query: 643 EYNGNVARSTVYRDYVQTKFLDGIG--------EQIYVLKLQNLLFFGTIISIEEKIERL 694
             N      T   DY++T   + +G        E   ++++   L F     ++++++R+
Sbjct: 545 TSN-----FTNLDDYLRTMKKNPLGGENRLEEVEGCMIVRIPEPLTFTNSEDLKQRLDRI 599

Query: 695 LQISNKDA--------TKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLII 746
            +  +           +K  IKY+I D   + +  ID SAA+  + I    + + + + +
Sbjct: 600 ERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDSSAAQVLDEIITSYKRRNVFIYV 657

Query: 747 SSIKERDRIYNAFNNVGLLNDVE 769
           +++   D+I       G++ ++E
Sbjct: 658 ANVSINDKIRTRLLKAGVIPNLE 680

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 112/553 (20%), Positives = 209/553 (37%), Gaps = 84/553 (15%)

Query: 277 IEITPFYHTMALAIKEALAG-----------------NDDEIITTTIFCYVISSMLTGVV 319
           + ITPF + +  ++ + + G                 N DE I+T I   ++ + ++G  
Sbjct: 111 LAITPFIYAIFGSVPQMIVGPESAISLVVGQAVEPMVNHDERIST-ISISIVVTFISGSF 169

Query: 320 FYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF------EYSWPFFS 373
              LG  RLG +     R +L G I  VG+ +II  +    ++ K        Y  PF  
Sbjct: 170 LLFLGIFRLGFLGNILSRALLRGFICSVGFVMIINSLISELKLDKVLATSPEHYHTPFEK 229

Query: 374 GLF------------TDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTL--VLF 419
            LF            T   +L  +++ +L+ V+     + FK  + +P   I+ +  ++F
Sbjct: 230 ILFLIKYGQHNYHAPTAILSLYSFIILMLMKVMKKRLMKRFKWVIFVPEILIVIVGTIMF 289

Query: 420 HFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFN-VHKVHWSLVLQQIPTMMALT 478
            F   I     +  +      F +   DS       L N + K +  L+   +   +   
Sbjct: 290 SFHFDIKHKFDISIIGD----FKVNGFDS-------LHNPLDKTNRLLLKPLLDAGIVCA 338

Query: 479 FFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRA 538
             G         AL  +  +     +REL+A G  N    L G++  +  Y  S +   +
Sbjct: 339 VLGFFESTTASKALGTTYDL-TVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINALS 397

Query: 539 GADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT--WNKLN 596
           G  +  +G  L ++T+                    +  ++G  LL EA  D   + + +
Sbjct: 398 GGQTVMSGVCLGSVTLFTIKFFLPVVHNTPTCVLSVVTSVVGLTLLEEAPTDLKFYFQSH 457

Query: 597 RFEYLTVVIIVFTMGIFDFV-LGIIVGILIACFSFLVDS--TKLQTIN------------ 641
            +  L V+ + F   IF  V +GI VG   +  S +  S  +++Q +             
Sbjct: 458 GYNELIVLGLTFITTIFYSVEVGICVGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNAD 517

Query: 642 --GEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERL----- 694
             G ++G    +  + +      L+ + E   V+K+   L F     ++E++ RL     
Sbjct: 518 ELGIFDGENNNNNTFFE----PLLEDLDEDRLVVKIPEPLTFTNTEDLKERLSRLERFGS 573

Query: 695 --LQISNKDATKR-RIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKE 751
             +    +D   R + KY+I D   +    ID SAA+    I      +++ +    +  
Sbjct: 574 VRVHPGRRDLRSRDKTKYIIFDLHGMTY--IDASAAQILLEIILAYNRRQVFVFFVRVPM 631

Query: 752 RDRIYNAFNNVGL 764
           R  +   F   GL
Sbjct: 632 RREVRQRFERSGL 644

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 109/568 (19%), Positives = 218/568 (38%), Gaps = 77/568 (13%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGNDDEI----------IT------T 304
           Y+   +  P   G   + I+PF + +  ++ + + G +  I          IT      +
Sbjct: 140 YTTSIAHVPPLCGLYSLAISPFVYGILGSVPQMIVGPESAISLVVGQAVESITLHKENVS 199

Query: 305 TIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAK 364
            I    + + ++G +    G  R G +     + +L G I  VG  +II  +    ++ K
Sbjct: 200 LIDISTVITFVSGTILLFSGISRFGFLGNVLSKALLRGFISSVGLVMIINSLISELKLDK 259

Query: 365 F------EYSWPFFSGLF-TDYDTLAKWLLPVLL-----TVVLIGTQ-------RYFKNS 405
           F       Y  PF   LF  DY   A++ +P  +      +VL  T+       +Y K++
Sbjct: 260 FLVSLPQHYHTPFEKILFLIDYAP-AQYHIPTAIFSGCCLIVLFLTRLLKRKLMKYHKSA 318

Query: 406 LVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWS 465
           +  P       +L   IV I+ ++  + L+    I  I +     +D  +   + +    
Sbjct: 319 IFFPD------ILLVVIVTILISMKFN-LKHRYGISIIGDFSMDNFDELK-NPLTRPRRK 370

Query: 466 LVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQN 525
           L+       + +   G         +L  +  +     +REL+A G+ N    L G++  
Sbjct: 371 LIPDLFSASLIVAMLGFFESTTASKSLGTTYNL-TVSSNRELVALGFMNIVISLFGALPA 429

Query: 526 YLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLV 585
           +  Y  S +   +GA S  +G  +  +T+                    +  ++G  LL 
Sbjct: 430 FGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQFVHYIPNCVLSVITTIIGISLLE 489

Query: 586 EALVDTWNKL--NRFEYLTVVIIVFTMGIF-DFVLGIIVGILIACFSFLVDSTK-----L 637
           E   D    L    F  L V  + F   IF     GI +G + +  + +  S K     L
Sbjct: 490 EVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGICIGCVYSIINIIKHSAKSRIQIL 549

Query: 638 QTING--------EYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEE 689
             + G        +Y  N+ R+++  D   T+ ++G      ++++   L F     +++
Sbjct: 550 ARVAGTSNFTNLDDYMMNMKRNSL--DVEGTEEIEG----CMIVRIPEPLTFTNSEDLKQ 603

Query: 690 KIERLLQISNKD--------ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKR 741
           +++R+ +  +           +K  IKY+I D   + +  ID SAA+    I    + + 
Sbjct: 604 RLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSSAAQVLEEIITSYKRRN 661

Query: 742 IKLIISSIKERDRIYNAFNNVGLLNDVE 769
           + + + ++   D++       G+   VE
Sbjct: 662 VFIYLVNVSINDKVRRRLFKAGVAASVE 689

>Ecym_7084 Chr7 complement(167032..169101) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGR213C
          Length = 689

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 85/204 (41%), Gaps = 9/204 (4%)

Query: 499 DKYDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTI 554
           +K+D+D    REL++ G  N  S +  ++  +  Y  S L I   A +P AG ++    I
Sbjct: 341 EKFDIDISSNRELVSLGLINVVSSVFSALPAFGGYGRSKLNILCSAQTPMAGIVVSVAAI 400

Query: 555 CXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMG 611
                               +I  + Y LL E   D    W+     E LT V +V T  
Sbjct: 401 FCMNYMMGAFHYLPLCVLAVIISYIAYNLLEEIPSDLFFYWSVGGYQELLTFVAVVVTTL 460

Query: 612 IFDFVLGIIVGILIACFSFLVDSTKLQT-INGEYNGNVARSTVYRDYVQTKFLDGIGEQI 670
           ++    G+ +G+ +     L  +T+ +  I G          +Y +  +   L+ I E+ 
Sbjct: 461 VWSPQFGVSIGVGLTMIRLLKHTTQSRVQILGRDPVTKKFQNIYAEQSEQIPLEEI-EKT 519

Query: 671 YVLKLQNLLFFGTIISIEEKIERL 694
            V+K+   L F  +  +++++ RL
Sbjct: 520 MVIKIPEPLIFSNVSDLKKRLSRL 543

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 104/540 (19%), Positives = 219/540 (40%), Gaps = 69/540 (12%)

Query: 277 IEITPFYHTMALAIKEALAGND-----------DEIIT-----TTIFCYVISSMLTGVVF 320
           + ITPF + +  ++ + + G +           ++++T      TI   V+ + L+G + 
Sbjct: 132 LAITPFVYCVFGSVPQMIVGPESAISLVVGQAVEKLVTHNEKVGTINISVVVTFLSGAIL 191

Query: 321 YALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWP-FFSGLFTDY 379
              G  RLG +     R +L G I  VG  ++I  +    ++ K   + P  +   F   
Sbjct: 192 LIFGITRLGFLGNILSRALLRGFISSVGLVMVINSLITELKLTKLLATVPEHYHTPFEKV 251

Query: 380 DTLAKW---------LLPVLLTVVLIGTQRYFKNSLV--LPSFYILTLVLFHFIVAIIPT 428
             L K+          +  L + +++ T R+ K  L+    S      +L   I ++I +
Sbjct: 252 QFLFKYGPENLHKPTAILSLCSFIILMTLRFLKKKLMKRYKSVIFFPEILLIVISSLIIS 311

Query: 429 LSLDALRQAGWIFPIANSDSKWYDHYRLFN-VHKVHWSLVLQQIPTMMALTFFGILHVPI 487
           ++ + L++   I  + +  +  +D  +L N + K + SL  + +   +     G      
Sbjct: 312 VNFN-LKKDFDISMLGDFSTSGFD--KLNNPLGKDNRSLCHELLSVGLMCAILGFFESTT 368

Query: 488 NVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGF 547
              +L     +     +REL+A G  N    L G++ ++  Y  S +   +GA +  +G 
Sbjct: 369 ASKSLGTIYDL-TISSNRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGA 427

Query: 548 LLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY--LTVVI 605
            +  +T+                    +  ++G  LL EA  D    +    Y  L +  
Sbjct: 428 CMGLITLFTIKFLLPVIHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFT 487

Query: 606 IVFTMGIFDFV-LGIIVGIL--------------IACFSFLVDSTKLQTINGEYNGNVAR 650
           ++F   I   V  GI VG +              I   + ++ + +   ++G Y G    
Sbjct: 488 LIFVTTIIHSVEAGISVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPG---L 544

Query: 651 STVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQI-SNKDATKRR--- 706
            T+  D  ++  L+ + +   ++K+   L F     ++E++ RL +  S +    RR   
Sbjct: 545 KTI--DLRESSALEELDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLH 602

Query: 707 ----IKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKL----IISSIKERDRIYNA 758
               IKY+I +   + +  +D SAA+    I +  + + + +    + S+++ R R+++A
Sbjct: 603 NRENIKYVIFELGGMTS--MDSSAAQILKEIIKTYKKRSVNVYFCKVSSNLQIRTRLHDA 660

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 123/629 (19%), Positives = 224/629 (35%), Gaps = 111/629 (17%)

Query: 237 PVFSHLGPTGISMFYISTIISQAV-----------YSGGWSSFPSGIGSEMIEITPFYHT 285
           P FS L PT  +  +I  +I+ A            YS   +  P   G   +  TP  + 
Sbjct: 86  PCFSWL-PTYDATKFIGDLIAGASLASFQIPLAMSYSTSVAHVPPICGLNALAFTPLVYA 144

Query: 286 MALAIKEALAGNDDEI-----------------ITTTIFCYVISSMLTGVVFYALGKLRL 328
           +  ++   + G +  I                 +  T  C V++  ++G + ++ G +R 
Sbjct: 145 VFGSVPHMIVGPESAISLVVGQAIEKLTKHDASLNVTNLCVVLT-FISGSILFSFGLMRF 203

Query: 329 GKIVGFFPRHILIGCIGGVGYFLIITGI------EVTTRVAKFEYSWPFFSGLFTDYDTL 382
           G +     R +L G I  VG  ++I  +      + T + A   Y  PF   +F  +   
Sbjct: 204 GFLDSVLSRALLRGFISAVGLIMVINSLISELKLKDTFKNAPGHYHAPFQKVVFLVHYAP 263

Query: 383 AKWLLPV----LLTVVLIGTQR--------------YFKNSLVLPSFYILTLVLFHF--- 421
           A + LP     L+    +G  +              +F + LV+ +F  L    + F   
Sbjct: 264 ANYHLPTALVSLVCFAALGALKVIKKKLVKRFKKVIFFPDILVVVAFATLVSYCYDFKVR 323

Query: 422 ----IVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMAL 477
               IV  I T S + ++      PI+       D+ +LFN    H   ++         
Sbjct: 324 YNIDIVGDIETGSSNTIKN-----PISK------DNLKLFN-DLFHAGFLV--------- 362

Query: 478 TFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIR 537
              G         +L  +  +     +REL+A G  N    L G++ ++  Y  S +   
Sbjct: 363 ALLGFFESTTASKSLGTNYDL-AISSNRELVALGSLNLVGSLFGALPSFGGYGRSKINAY 421

Query: 538 AGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT---WNK 594
           +GA +  +G  +  +T+                    +  ++G  L  EA  D    +  
Sbjct: 422 SGAATVMSGVFMGLITLITSKFLLNAIRHIPICVLSVITTMVGISLFEEAPADLKFHFRC 481

Query: 595 LNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK-----LQTINGE---YNG 646
               E LT  I V T   +    GI +G   +    + +ST+     L  I+G     N 
Sbjct: 482 RGYNELLTFAITVLTTFFYSVEAGITLGCGYSIIRAIKNSTQSGIQILGRISGTNRFVNA 541

Query: 647 NVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQ--------IS 698
           +   S    D      LD + E   V ++   L F     ++ ++ RL           S
Sbjct: 542 DEFYSASSLDSEFGPRLDHM-EGCLVARIAEPLTFTNTEDLKSRLNRLENHGSVKTHPAS 600

Query: 699 NKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNA 758
            +   K   + +I D + +    ID SA++    I +    +++++ ++ +     +   
Sbjct: 601 PRSRDKDLTRNMIFDLEGMT--QIDSSASQILCEIVKSLTKRKVRVYLARVPRALHVRER 658

Query: 759 FNNVGLLNDVELFADLNSAL------EWC 781
               G+   VE    LN+A        WC
Sbjct: 659 LVASGVAGMVENNIPLNTASMGQPGDSWC 687

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/285 (20%), Positives = 110/285 (38%), Gaps = 21/285 (7%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXX 563
           +REL+A G  N FS +LGS+  +  Y  S +   +GA +  +G  +  L +         
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLPM 452

Query: 564 XXXXXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEY---LTVVIIVFTMGIFDFVLGII 620
                      +  ++G  LL EA  D       F Y   L   + V T   +   +GI 
Sbjct: 453 IHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGIC 512

Query: 621 VGILIACFSFLVDSTK-----LQTINGE---YNGNVARSTVYRDYVQTKFLDGIGEQIYV 672
           +G   +  S +  S K     L  + G     N +       R++          E   +
Sbjct: 513 IGCGYSVISIIKHSAKSRIQILARVQGTSRFVNSDDYLKQTNREHANENLELEELEGCLI 572

Query: 673 LKLQNLLFFGTIISIEEKIERLLQISNKDA--------TKRRIKYLILDFKNINADNIDY 724
           +K+   L F     ++E++ RL +  +           ++   +Y+I+D   +   ++D 
Sbjct: 573 VKIPEPLTFTNTEDLKERLNRLEKFGSTRVHPGARGRRSRSSTRYVIIDLHGMT--HMDS 630

Query: 725 SAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVE 769
           SAA+    I      + +++ ++ +    R+       G+++ VE
Sbjct: 631 SAAQILLEIVSSYRKRDVRVFLARVTIDARVRERLEKSGVVDLVE 675

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 32/291 (10%)

Query: 501 YDVD----RELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICX 556
           +D+D    REL++ G  N    +  S+  +  Y  S L I  GA +P AG  +    I  
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 557 XXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT---WNKLNRFEYLTVVIIVFTMGIF 613
                             +I  + Y LL E   D    W+     E +T   +V +  I+
Sbjct: 403 MRFLMGVFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTLIW 462

Query: 614 DFVLGIIVGILIACFSFLVDST--KLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIY 671
               G+++G+ +     L  +T  ++Q +  +      R+ +Y ++ +   L+ I E+  
Sbjct: 463 SPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRN-IYSEHNEEIPLEEI-EKTM 520

Query: 672 VLKLQNLLFFGTIISIEEKIERL-----LQISNKDATKRR-------------IKYLILD 713
           V+K+   L F  +  + +K++RL     L +     T  R             +KY+I+D
Sbjct: 521 VIKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIMD 580

Query: 714 FKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGL 764
              +    ID SA +    +      + I +I      RD + N F+  G+
Sbjct: 581 L--LGMTYIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD-LKNKFDKSGI 628

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 92/463 (19%), Positives = 171/463 (36%), Gaps = 59/463 (12%)

Query: 315 LTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIIT------------------GI 356
           ++G + +A+G  R+G I     +  L G +  +   ++IT                  G 
Sbjct: 72  VSGGILFAMGVFRMGFIDNALSKAFLRGFVSSLALVMLITELLPELKLEELYAHYVAQGY 131

Query: 357 EVTTRVAKFEY---SWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYI 413
             TT   KF +     P  S  FT       W L  L T +L+ T RY K  L     + 
Sbjct: 132 IGTTTWEKFRFILEKAPENSDTFT-------WNLS-LFTFILLMTIRYLKRHLAEKCGWK 183

Query: 414 LTLVLFHFIVAIIPTLSLDALRQAGWI--FPIANSDSKWYDHYRLFNVHKVHWSLVLQQI 471
             +     ++ ++ +++L   ++   +    I        DH +   V    +S   +  
Sbjct: 184 KCIFFPEILIVVVGSITLSNTQKWSELKGIKIIGDIPPNSDHIK---VPVQTFSEFKELF 240

Query: 472 PTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTN 531
            T   +   G+    I   ++  +  +D    +REL++ G  N  S +  ++  +  Y  
Sbjct: 241 GTSALIAMLGLFESTIVFKSVCSNSNVDASS-NRELVSLGVVNLVSSIFSALPAFGGYGR 299

Query: 532 SVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLVEALVDT 591
           S + I  GA + F+G  +  L I                    +I  + + LL EA  D 
Sbjct: 300 SKMNISCGAQTQFSGVFVSLLAIICMNFLMNAFHHLPICILAVIISTVAFSLLEEAPADL 359

Query: 592 ---WNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQT-INGEYNGN 647
              W+     E    +IIV T  ++    G+ +G+ +     L  ST+ +  I G     
Sbjct: 360 MFYWSVGGYQELFIFIIIVVTTLVWSPQFGVTMGMCLTMIRLLKHSTRSRVQILGRDPIT 419

Query: 648 VARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQ----------- 696
                +  D      L+ I E++ V+K+   L F  +  +   ++R+ +           
Sbjct: 420 YTFKNIDDDENSDIPLEEI-EKVMVVKIPEPLIFSNVSDLRTSLKRMEKYGSLKVHPSYP 478

Query: 697 ------ISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRI 733
                 +S   + +  +KYL++D   +    ID SA +    I
Sbjct: 479 LPLRQMLSPTTSGQVSLKYLVIDLFGMT--YIDISALQALREI 519

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 100/556 (17%), Positives = 200/556 (35%), Gaps = 81/556 (14%)

Query: 261 YSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALAGND-----------------DEIIT 303
           YS   +  P   G   +  TPF + +  ++   + G +                 D+ + 
Sbjct: 105 YSTSVAHVPPICGLNALAFTPFVYAVFGSVPHMIVGPESAISLVVGQAIEKQMKHDKSLD 164

Query: 304 TTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVA 363
               C +++  ++G + +  G +R G +     R +L G I  VG  +++  +    ++ 
Sbjct: 165 VVNLCLILT-FISGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLK 223

Query: 364 KF------EYSWPFFSGLFTDYDTLAKWLLPVLLT------------VVLIGTQRYFKNS 405
           K        Y  PF   +F  +     + +P  L             +V     R +K  
Sbjct: 224 KVFNDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKV 283

Query: 406 LVLPSFYIL----TLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHK 461
           + +P   I+    TL  +HF   +   + +    + G         SK+ +      + K
Sbjct: 284 IFVPEILIVVALVTLGSYHFSFKLRYNIDIVGDIEVG-------DTSKFRN-----PLSK 331

Query: 462 VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521
            + SL  +       +   G         +L  S ++     +REL+A G  N    + G
Sbjct: 332 KNLSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIFG 390

Query: 522 SVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGY 581
           ++ ++  Y  S +   +GA +  +G  +  +T                     +  ++G 
Sbjct: 391 ALPSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGI 450

Query: 582 ELLVEALVDT---WNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTK-- 636
            L  EA  D    +      E L   + V T   +    GI +G   +    + +STK  
Sbjct: 451 TLFEEAPADLRYHFRCRGYNELLIFALTVLTTFFYSVEAGITLGCGYSVIRVIKNSTKSK 510

Query: 637 ---LQTINGE---YNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEK 690
              L+ ++G     N +   S+     V    LD I E   ++K+   L F     ++ +
Sbjct: 511 IQILRRVSGTDQFVNADDFNSSTNTCVVIPPRLDDI-EGSLIVKIPERLTFMNTEDLKTR 569

Query: 691 IERLLQ--------ISNKDATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRI 742
           + RL +         S K   + + K++I D   +    ID SA++    I      + +
Sbjct: 570 LYRLEKYGSVKTHPASPKPRNRNQTKHMIFDMNGMT--EIDSSASQILQEIVLSLRKRGV 627

Query: 743 KL------IISSIKER 752
           ++      +I+ ++ER
Sbjct: 628 RVYLARVPLIAGVRER 643

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 102/525 (19%), Positives = 192/525 (36%), Gaps = 74/525 (14%)

Query: 306 IFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKF 365
           I   +  ++++G +    G  RLG +     + +L G IG VG+ +II  +    ++   
Sbjct: 206 ILIVIAVTLISGTILLISGIFRLGYLGNILNKALLHGFIGSVGFVMIIDSLINELKLGDI 265

Query: 366 ------EYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQ----RYFKNSLV-------- 407
                  Y+ PF   +F        + +P  L   +        R FK  L+        
Sbjct: 266 LADTPEHYNTPFLKIVFLWKYAFQNFHVPTTLISFISIIILLIVRAFKKVLMHRHRWLIF 325

Query: 408 LPSFYIL--TLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWS 465
           +P   I+  T+++  + +    T  +D L         +N +S +++     N   +H  
Sbjct: 326 IPEILIVLTTVLILSYKLDFADTYDIDILGDFK-----SNENSIFHNPLSNKNRGLIH-- 378

Query: 466 LVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQN 525
            V+  I  + A+  FG         AL  S +      +REL+A G SN     LG++ +
Sbjct: 379 -VVFNIGIITAI--FGFFESTTASKALGASSER-SVSSNRELVALGLSNIVISTLGALPS 434

Query: 526 YLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXXXXXXXXXXLIFLLGYELLV 585
           +  Y  S +   +G  +  +G  +   TI                    +  ++G+ LL 
Sbjct: 435 FGGYGRSKINALSGGKTLLSGVFMGLTTILAILFLMPVIHYIPVCILSVITTVIGFTLLE 494

Query: 586 EALVDT---WNKLNRFEYLTVVIIVFTMGIF-----DFVLGIIVGIL-------IACFSF 630
           E   +    W +   +  L ++++ F   IF        +G +  IL        +    
Sbjct: 495 EIPKEVSFHW-RCRGYNELFLIVLTFMTSIFYSVETSMYIGCVYSILNIIKHSAKSRIQI 553

Query: 631 LVDSTKLQTINGE-----------YNGNVARSTVYRDYVQTKFLDGI------GEQIYVL 673
             D+  + +I+              N    RS+ YR   +    D         EQ  ++
Sbjct: 554 YTDAPLITSISNPPSIDNSNINSNNNIKSTRSSDYRPESRRNSADECFRCSLTNEQTLIV 613

Query: 674 KLQNLLFFGTIISIEEKIERLLQISNKDATKRRI--------KYLILDFKNINADNIDYS 725
           K+   L F     ++EK+ R  ++    A   +I        KY+I D + +    +D S
Sbjct: 614 KIPEPLTFTNCEDLKEKLNRFERLGTHTAHPGKILKDTLFQPKYIIFDLQGMTL--MDSS 671

Query: 726 AAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVEL 770
           A E    I          +   ++  R+ I N     G+++ +EL
Sbjct: 672 ATEILKEIVLSYRRSGSHIFFVNVSFRENIRNRIQASGIIDLIEL 716

>Smik_5.338 Chr5 (512279..516994) [4716 bp, 1571 aa] {ON} YER166W
            (REAL)
          Length = 1571

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 64/156 (41%), Gaps = 23/156 (14%)

Query: 319  VFYALGKLRLGKIVGFFPRHI----LIGCIGGVG---------YFLIITGIEVTTRVAKF 365
            ++Y L  L    I  FFP  +    ++    G+G         Y   I  I   T V   
Sbjct: 1271 LWYMLDGLYQSIICFFFPYLVYHKNMVVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLH 1330

Query: 366  EYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVL---PSFYILTLVLFHFI 422
            +Y W +FSGLF     L  +    + +   IG++ +FK +  +   PSF+ +  V   F 
Sbjct: 1331 QYRWDWFSGLFIALSCLVVFAWTGIWSSA-IGSREFFKAAARIYGAPSFWAVFFVAVLF- 1388

Query: 423  VAIIPTLSLDALRQAGWIFPIANSDSKW----YDHY 454
              ++P  + D+ ++  +   +      W    +DHY
Sbjct: 1389 -CLLPRFTYDSFQKFFYPTDVEIIREMWQHGHFDHY 1423

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 78/370 (21%), Positives = 142/370 (38%), Gaps = 44/370 (11%)

Query: 292 EALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFL 351
           E L  +D  + T  I   +  S ++G+     G  RLG +     + +L G I  +G+ +
Sbjct: 156 ETLTSHDLSLETVDIATMI--SFMSGLTLLFGGIFRLGFLGNILSKALLRGFISSIGFVM 213

Query: 352 IITGIEVTTRVAKF------EYSWPFFSGLFTDYDTLAKWLLPV----LLTVVLIGTQRY 401
           I+  +    ++ K        Y  PF   LF      + + LP     L     + T R 
Sbjct: 214 IVNSLITELKLNKLMLTIPEHYHTPFEKILFLVRYGPSNYHLPTSFLSLAVFTTLMTIRI 273

Query: 402 FKNSLV--------LPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDH 453
           FK  ++        +P   IL++V+F  +++      +  L++   I  I + ++  +D 
Sbjct: 274 FKKKMMRRIKWIVFIPE--ILSVVIFSIVLSY-----MCDLKKKYDISVIGDFNTDGFDD 326

Query: 454 YRLFNVHKVHWSLV--LQQIPTMMALTFFGILHVPINVPALAMSLQMDKY-----DVDRE 506
           +R   + K +  L+  L+ +  + AL  F        + ++  S  +  Y       +RE
Sbjct: 327 FR-NPLSKCNRGLIPALRDVSLVSALLGF--------LESITASKSLGGYGNTVASSNRE 377

Query: 507 LIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXXXXX 566
           L+A G  N      G +  +  Y  S +   +GA +  AG  + ++T+            
Sbjct: 378 LVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPVIHY 437

Query: 567 XXXXXXXXLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIA 626
                   +   +G  LL EA  D    +    Y  +++ V T     F   I  GIL  
Sbjct: 438 IPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCF-YSIEFGILAG 496

Query: 627 CFSFLVDSTK 636
           C   L+   K
Sbjct: 497 CTYSLISIVK 506

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 56/285 (19%), Positives = 112/285 (39%), Gaps = 22/285 (7%)

Query: 504 DRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICXXXXXXXX 563
           +REL+A G  N  + L G++ ++  Y  S +   +G+ +  +G  + ++T+         
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLPL 451

Query: 564 XXXXXXXXXXXLIFLLGYELLVEA---LVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGII 620
                      +  ++G  LL EA   L   +      E     I V    ++   +GI 
Sbjct: 452 IHYIPLCILSVITSIVGISLLEEAPSELKFHFRCKGYDELFVFAITVLATLLYSVEMGIC 511

Query: 621 VGILIACFSFLVDSTKLQ-TINGEYNGNVARSTVYR--------DYVQTKFLDGIGEQIY 671
           +G   +  S +  S K +  I G   G    + +          D    KF+    E   
Sbjct: 512 IGCGYSIISIVKHSAKSRIQILGRVQGTREFANIDEYLDSDPIGDIETNKFVLEEIEGCL 571

Query: 672 VLKLQNLLFFGTIISIEEKIERLLQISNKDA--------TKRRIKYLILDFKNINADNID 723
           ++K+   L F     ++E++ RL +  +  A        +K   K +I D   + +  ID
Sbjct: 572 IVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHGMTS--ID 629

Query: 724 YSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDV 768
            SA + F  I    + +++K+ ++ + +  +I       G+ + V
Sbjct: 630 SSATQIFFDIVATYKKRKVKVFLARVLQSKQIRERLEKSGVTSMV 674

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 32.7 bits (73), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 37/75 (49%), Gaps = 5/75 (6%)

Query: 779 EWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNG-----LNRGSN 833
           ++C++    Q K++ +K+    ++GK+ NV+S V  +      D   N      L+R S+
Sbjct: 112 DFCKSASEAQLKRIHRKSNNLGKDGKRRNVLSPVCVSYLGSSQDPTANANLPAELSRKSS 171

Query: 834 GDTARNLMSLPTNTP 848
           G      MS  +N+P
Sbjct: 172 GPVQPTHMSQTSNSP 186

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 884 ILLFALKQYRPDIISEVQKVREKEIKFWAQ 913
           +L+  LK Y+PDI+S +Q+V   E+KFW +
Sbjct: 140 VLVHELKTYKPDIVS-LQEVDYNELKFWQE 168

>YER166W Chr5 (512744..517459) [4716 bp, 1571 aa] {ON}
            DNF1Aminophospholipid translocase (flippase) that
            localizes primarily to the plasma membrane; contributes
            to endocytosis, protein transport and cell polarity; type
            4 P-type ATPase
          Length = 1571

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 63/156 (40%), Gaps = 23/156 (14%)

Query: 319  VFYALGKLRLGKIVGFFPRHI----LIGCIGGVG---------YFLIITGIEVTTRVAKF 365
            ++Y L  L    I  FFP  +    +I    G+G         Y   I  I   T V   
Sbjct: 1271 LWYMLDGLYQSIICFFFPYLVYHKNMIVTSNGLGLDHRYFVGVYVTTIAVISCNTYVLLH 1330

Query: 366  EYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVL---PSFYILTLVLFHFI 422
            +Y W +FSGLF     L  +    + +   I ++ +FK +  +   PSF+ +  V   F 
Sbjct: 1331 QYRWDWFSGLFIALSCLVVFAWTGIWSSA-IASREFFKAAARIYGAPSFWAVFFVAVLF- 1388

Query: 423  VAIIPTLSLDALRQAGWIFPIANSDSKW----YDHY 454
              ++P  + D+ ++  +   +      W    +DHY
Sbjct: 1389 -CLLPRFTYDSFQKFFYPTDVEIVREMWQHGHFDHY 1423

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 884 ILLFALKQYRPDIISEVQKVREKEIKFWAQ 913
           +L+  LK+YRPD++S +Q+V   E+ FW +
Sbjct: 142 VLVHELKKYRPDVVS-LQEVDYNELNFWQE 170

>NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON}
           Anc_4.309 YLR429W
          Length = 661

 Score = 32.3 bits (72), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 33/124 (26%)

Query: 13  SLSEAISVSLGINQDSS-------VNKMHRASVSAMSPPLCRSYMSGF-----------F 54
           S+++A S    IN+DS+       ++K+ R       PPL RSY+               
Sbjct: 432 SVTDAFSPPTSINEDSNISIPSLRISKLRRRE----EPPLARSYLRSISSEEEKRTRRRI 487

Query: 55  TGGNSPMINNLSDSKLPISNKQH---PKVIHGSENL----HRQTAQLSNEFCSSSVEENS 107
           T   + +I+ LSDS  PI   +    P+    S NL     R+ A+++ +  ++S EE  
Sbjct: 488 TSQKNRLISGLSDS--PIKKGEEILRPEEESSSVNLTEAEDRKVAKITPQVAATSTEE-- 543

Query: 108 PTIK 111
           P+IK
Sbjct: 544 PSIK 547

>Kwal_23.5956 s23 (1388218..1391040) [2823 bp, 940 aa] {ON} YIL075C
           (RPN2) - RPN2p is a component of the 26S proteosome
           [contig 12] FULL
          Length = 940

 Score = 32.3 bits (72), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 11/72 (15%)

Query: 836 TARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPD 895
           +ARN  +    TP + Q+ SV + +    E+ VK   +EY+        L  AL+ YR D
Sbjct: 113 SARNFENASAQTPIDPQLASVFERML---EKCVKC--EEYR------LALGIALESYRLD 161

Query: 896 IISEVQKVREKE 907
           +I E+ K R KE
Sbjct: 162 VIEEILKTRVKE 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.139    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 107,658,953
Number of extensions: 4944055
Number of successful extensions: 17177
Number of sequences better than 10.0: 101
Number of HSP's gapped: 17730
Number of HSP's successfully gapped: 108
Length of query: 1036
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 916
Effective length of database: 39,721,479
Effective search space: 36384874764
Effective search space used: 36384874764
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)