Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGR124W (ASN2)3.483ON57257229170.0
Smik_6.2203.483ON57257228370.0
Skud_7.4353.483ON57257228250.0
Suva_7.4103.483ON57257228090.0
YPR145W (ASN1)3.483ON57257126430.0
Suva_16.4743.483ON57257126290.0
Smik_16.3963.483ON57257126290.0
CAGL0I10648g3.483ON57457425930.0
Skud_16.4393.483ON57257125830.0
KLLA0B10868g3.483ON57457125670.0
Kpol_480.193.483ON57457125600.0
NCAS0F035103.483ON57557425420.0
NDAI0B058103.483ON57757725410.0
KAFR0G036703.483ON57257125170.0
SAKL0F02970g3.483ON57357125130.0
TDEL0D055203.483ON57357125020.0
KNAG0A079203.483ON57857524890.0
Kwal_55.211873.483ON57357224810.0
TBLA0C044303.483ON58057824740.0
KLTH0F14630g3.483ON57357124680.0
TPHA0D042003.483ON57457324630.0
AFR303W3.483ON57157224580.0
ZYRO0B04136g3.483ON57257124160.0
Ecym_12443.483ON57357223980.0
ZYRO0A00528g8.875ON5121031341e-07
Skud_7.311singletonON81891122e-06
Kpol_455.78.875ON518941223e-06
ADL350C8.875ON508891215e-06
NDAI0K001808.875ON522941198e-06
KLLA0D10285g8.875ON5151121181e-05
KAFR0L021108.875ON514951181e-05
TDEL0B004408.875ON516941172e-05
NCAS0C001908.875ON5171051162e-05
TPHA0C049508.875ON525991162e-05
Skud_13.468.875ON5191011162e-05
SAKL0D00352g8.875ON515851152e-05
KNAG0J002008.875ON5151021143e-05
Suva_13.528.875ON519991144e-05
YML096W8.875ON525951117e-05
Smik_13.398.875ON521961091e-04
Kwal_27.97058.875ON515871072e-04
TBLA0C063008.875ON518941063e-04
Ecym_81558.875ON513911046e-04
KLTH0E16412g8.875ON51595990.002
CAGL0H06963g8.875ON51778940.008
Kpol_1044.194.29ON69282732.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGR124W
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}  ASN2Aspara...  1128   0.0  
Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W ...  1097   0.0  
Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W ...  1092   0.0  
Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W ...  1086   0.0  
YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}  ASN1Aspar...  1022   0.0  
Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124...  1017   0.0  
Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145...  1017   0.0  
CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]...  1003   0.0  
Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145...   999   0.0  
KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {...   993   0.0  
Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}...   990   0.0  
NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.4...   983   0.0  
NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON} Anc_3...   983   0.0  
KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.4...   974   0.0  
SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {...   972   0.0  
TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.4...   968   0.0  
KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON} Anc_3...   963   0.0  
Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145...   960   0.0  
TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON} Anc_3...   957   0.0  
KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} high...   955   0.0  
TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.4...   953   0.0  
AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic ho...   951   0.0  
ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {...   935   0.0  
Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}...   928   0.0  
ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar ...    56   1e-07
Skud_7.311 Chr7 complement(535445..535513,535517..535621,535625....    48   2e-06
Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON} co...    52   3e-06
ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON} Syn...    51   5e-06
NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.87...    50   8e-06
KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} simila...    50   1e-05
KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {...    50   1e-05
TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}...    50   2e-05
NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}...    49   2e-05
TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa] ...    49   2e-05
Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W (...    49   2e-05
SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar ...    49   2e-05
KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON...    49   3e-05
Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W (...    49   4e-05
YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative pro...    47   7e-05
Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W (...    47   1e-04
Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -...    46   2e-04
TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON} Anc_8...    45   3e-04
Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}...    45   6e-04
KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]...    43   0.002
CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} simila...    41   0.008
Kpol_1044.19 s1044 (41869..43164,43214..43222,43438..43626,43630...    33   2.6  

>YGR124W Chr7 (739944..741662) [1719 bp, 572 aa] {ON}
           ASN2Asparagine synthetase, isozyme of Asn1p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1128 bits (2917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 544/572 (95%), Positives = 544/572 (95%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV
Sbjct: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARET                QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADANEDNNVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA
Sbjct: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572

>Smik_6.220 Chr6 (357844..359562) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1097 bits (2837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/572 (91%), Positives = 538/572 (94%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKH+DIH+FKPKALQLSK+IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITSADGEYMLGVNGEIYNHIQLRE CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           AFC+YD+KKDRIVAARDPIGVVTLYMGRSS+SP+TVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARET                QLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADVNEESSVDEKQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDP +KMIKPKEG+IEKYILRKAFDTT+EPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAER ISD MFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           +TVMRW+PKADWGCAEDPSGRYAKIHEKHV A
Sbjct: 541 NTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA 572

>Skud_7.435 Chr7 (719202..720920) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/572 (91%), Positives = 536/572 (93%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDI++FKPKALQLSK+IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI SADGEYMLGVNGEIYNHIQLRE CS YKFQTFSDCEPIIPLYLEHDIDAPK+LDGMF
Sbjct: 61  PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           AFCLYD+KKDR+VAARDPIGVVTLYMGRSS+SP+TVYFASELKCLTDVCDSIISFPPGHV
Sbjct: 121 AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+WLDEKRIPS PVDYHAIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARET                QLAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETEKANADADGDASVNNKQLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLD+DFLQLCMNIDP +KMI PKEGRIEKYILRKAFDTTDEP+VKPYLPEEILWRQKEQ
Sbjct: 421 PFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGLRDTAER ISD MFANPKADWG+DIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           DTVMRW+PKADWGCAEDPSGRYAKIHEKHVSA
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA 572

>Suva_7.410 Chr7 (709927..711645) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1086 bits (2809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/572 (90%), Positives = 534/572 (93%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHEDI +FKPKALQLSK+IRHRGPDWSGNA+MNSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DG+YMLGVNGEIYNHIQLRE CSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Sbjct: 61  PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           AFCLYDSKKDR++AARDPIGVVTLYMGR S+SP+TVYFASELKCLTDVCDSII+FPPGHV
Sbjct: 121 AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTPDWLDEKR+P+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IAAIAARET                +LAGIDDQGHLHTSGWSRLHSFA+GLPNAPDLQ
Sbjct: 241 SLIAAIAARETETANVEANEEASAEKSKLAGIDDQGHLHTSGWSRLHSFAVGLPNAPDLQ 300

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST+AWGLEARV
Sbjct: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTLAWGLEARV 420

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLDKDFLQLCMNIDP +KMI  KEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ
Sbjct: 421 PFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480

Query: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWID LRDTAER ISDAMFANPKA WGDDIPTTKEAYWYRLKFDAWFPQKTAA
Sbjct: 481 FSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540

Query: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           DTVMRW+PKADWGCAEDPSGRYA+IHEKHV+A
Sbjct: 541 DTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA 572

>YPR145W Chr16 (822620..824338) [1719 bp, 572 aa] {ON}
           ASN1Asparagine synthetase, isozyme of Asn2p; catalyzes
           the synthesis of L-asparagine from L-aspartate in the
           asparagine biosynthetic pathway
          Length = 572

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/571 (85%), Positives = 519/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+H +KPKALQLSK+IRHRGPDWSGNA+ NSTIFVHERLAIVG++SGAQ
Sbjct: 1   MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS+DGEYML VNGEIYNHIQLRE C+DY+F T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+K+DRIVAARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAGIDD G LHT+GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETAKATNDVEPSTYDSKARHLAGIDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAE  ISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>Suva_16.474 Chr16 (819031..820749) [1719 bp, 572 aa] {ON} YGR124W
           (REAL)
          Length = 572

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/571 (84%), Positives = 518/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+H +KPKALQLSK+IRHRGPDWSGNAV NSTIFVHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C DY+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+K+DRI+AARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARET                + LAG+DD+G+LHT+GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETAKATNDVEPSTYDNKARHLAGVDDEGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP+EKMI+PKEGRIEKYILRKAFDTTDEP+ KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE  ISD MFANPKA+WG+DIPTTKEAYWYRLKFD  FPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLKFDGLFPQKTV 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>Smik_16.396 Chr16 (694650..696368) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/571 (84%), Positives = 517/571 (90%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+HN+KPKALQLSK+IRHRGPDWSGNA+ NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C +Y+F+T SDCEPIIP+YL+HDIDAPKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+K+DRIVAARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAG+DD G LHT+GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVDPSTYDSKARHLAGVDDDGKLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLDK+FLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAE  ISD MFA+PKA+WG DIP+TKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           ADTVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 ADTVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>CAGL0I10648g Chr9 complement(1053030..1054754) [1725 bp, 574 aa]
           {ON} highly similar to uniprot|P49090 Saccharomyces
           cerevisiae YGR124w asparagine synthetase or
           uniprot|P49089 Saccharomyces cerevisiae YPR145w ASN1
          Length = 574

 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/574 (83%), Positives = 510/574 (88%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH+D+H FKPKALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+Y L VNGEIYNHIQLRE   DYKF+T SDCEPIIP YLEHDIDAPKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+K+DRIVAARDP+G+ TLYMGR S SP+TV+FASELKCLTD CD I +FPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTPDW+DE RIP+TPV++  IR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXX--XXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARET                  QLAGID+QGHLHT+GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKANEENDAADNDASASKQLAGIDNQGHLHTAGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSA EFH ESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDP +KMI    GRIEKYILRKAFDT+DEPDVKPYLPEEILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYLPEEILWRQK 480

Query: 479 EQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAER ISD MF+NPK +WG+DIPTTKEAYWYRLKFDA FPQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLKFDALFPQKT 540

Query: 539 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           AA TVMRWIPKADWGCAEDPSGRYAKIHE+HV+A
Sbjct: 541 AASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA 574

>Skud_16.439 Chr16 (776317..778035) [1719 bp, 572 aa] {ON} YPR145W
           (REAL)
          Length = 572

 Score =  999 bits (2583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/571 (83%), Positives = 511/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHED+H +K KALQLSK+IRHRGPDWSGNA  NSTIFVHERLAIVGL+SGAQ
Sbjct: 1   MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS D +YML VNGEIYNHIQLRE C DY+F+T SDCEPIIP+YL+HDI+APKYLDGMF
Sbjct: 61  PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+K+DRIVAARDPIG+ TLYMGRSS SP+TVYFASELKCLTD CD+I +FPPGHV
Sbjct: 121 AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDEKRIPSTP+DY AIRHSLEKAVRKRLMAEVP+          
Sbjct: 181 YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAG+DD G+LHT+GW+ LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETANATNDVEPSTYDSKARHLAGVDDDGNLHTAGWTSLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGS HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP EKMI+ KEGRIEKYILRKAFDTT EPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE  ISD MFA+PKA+WG DIPTTKEA+WYRLKFDA FPQKT 
Sbjct: 481 QFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLKFDALFPQKTV 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           ADTVMRW+PKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRYAQIHEKHI 571

>KLLA0B10868g Chr2 complement(951111..952835) [1725 bp, 574 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 574

 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/571 (82%), Positives = 507/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA+F++ D+  +KPKALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG Y L VNGEIYNHI LRE C+ Y F+T SDCEPIIPLY ++DIDAPK+LDGMF
Sbjct: 61  PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYDSKKDRI+AARDPIG+ TLYMGRSS SP++V+F+SELKCLTD CD II+FPPGHV
Sbjct: 121 AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDK+TRYFTPDWLDE RIP+TPVD+ A+R SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXX-XQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARET                 QLAG+D+QGHLH +GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKTNAELDPVVYDSDPHQLAGLDEQGHLHAAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVA FIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFLQLCMNIDPN+KMIKP EG+IEKYILRKAFDTTDEPD+KPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE  ISD  FA PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A TVMRWIPKADWGCAEDPSGRYAKIHE+HV
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHV 571

>Kpol_480.19 s480 complement(42251..43975) [1725 bp, 574 aa] {ON}
           complement(42251..43975) [1725 nt, 575 aa]
          Length = 574

 Score =  990 bits (2560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/571 (82%), Positives = 510/571 (89%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KHE+   FKP+ALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C DYK++T SDCEPIIPLYL+HDIDAPKYLDGMF
Sbjct: 61  PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+KKDRI+AARDPIG+ TLYMGR+S+SP+TV+FASELKCLTD CDSI++FPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF+PDW+DE+RIP+ PV Y AIR SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + L GIDDQG+LHT+GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKAMKEMDTTAYDSEDKHLTGIDDQGNLHTAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTM+WGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMSWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP EKMI   EGRIEKYILRKAFDT+DEPD KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAER ISD +F+ PK  WG DIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>NCAS0F03510 Chr6 (703369..705096) [1728 bp, 575 aa] {ON} Anc_3.483
           YGR124W
          Length = 575

 Score =  983 bits (2542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/574 (81%), Positives = 506/574 (88%), Gaps = 2/574 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+  +KPKALQL+K+IRHRGPDWSGN V N+TI  HERL+IVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE C+DY+F+T SDCEPIIPLYL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+K+DRIVAARDPIG+ TLYMGR S++P+TVYFASELKCLTD CDSI++FPPGHV
Sbjct: 121 AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRYF PDWLDE RIPSTPVD  AIR +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXX--XQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPD 298
             IA+IAARET                   L G+DD+GHLHT GWSRLHSFAIGLPNAPD
Sbjct: 241 SLIASIAARETEKAMQDVDVEDENGEHHKHLTGVDDEGHLHTGGWSRLHSFAIGLPNAPD 300

Query: 299 LQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 358
           LQAARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ
Sbjct: 301 LQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQ 360

Query: 359 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEA 418
           GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEA
Sbjct: 361 GVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEA 420

Query: 419 RVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQK 478
           RVPFLDK+FLQLCMNIDP +KMI    G+IEKYILRKAFDTTD+P+ KPYLP+EILWRQK
Sbjct: 421 RVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYLPQEILWRQK 480

Query: 479 EQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKT 538
           EQFSDGVGYSWIDGL+DTAER ISDAMF NPK  WG+D+PTTKEAYWYRLKFDA +PQKT
Sbjct: 481 EQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLKFDALYPQKT 540

Query: 539 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           AADTVMRWIPKADWGCAEDPSGRYAKIHEKHV  
Sbjct: 541 AADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDG 574

>NDAI0B05810 Chr2 (1412089..1413822) [1734 bp, 577 aa] {ON}
           Anc_3.483 YGR124W
          Length = 577

 Score =  983 bits (2541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/577 (80%), Positives = 504/577 (87%), Gaps = 5/577 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAFKHED+H FKP+ALQLSK+IRHRGPDWSGN + N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQ+RE   DY F+T SDCEPIIPLYL+HDID PK+LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYDSK+DRI+AARDPIG+ TLYMGR+S++P+TV+FASELKCLTD CDSII+FPPGHV
Sbjct: 121 AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYFTPDWLDE+RIP   +D  AIR SLE AVRKRLMAEVP+          
Sbjct: 181 YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-----LAGIDDQGHLHTSGWSRLHSFAIGLPN 295
             IA+IAARET                +     L G+DD+GHLH  GWS+LHSFAIGLPN
Sbjct: 241 SLIASIAARETEKANAQATLDNENANDETSKAHLTGVDDEGHLHNGGWSKLHSFAIGLPN 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RV NLHLADCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475
           LEARVPFLD+DFLQLCMNIDP EKMI   EGRIEKYILRKAFDT+D+P+ KPYLPEEILW
Sbjct: 421 LEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWIDGL+DTAER ISDAMF NPK  WG DIPTTKEAYWYRLKFDA +P
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLKFDALYP 540

Query: 536 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV+A
Sbjct: 541 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA 577

>KAFR0G03670 Chr7 (758115..759833) [1719 bp, 572 aa] {ON} Anc_3.483
           YPR145W
          Length = 572

 Score =  974 bits (2517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/571 (81%), Positives = 501/571 (87%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+HED+ +FK KALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHIQLRE   DYKF+T SDCEPIIPLYL  DIDAPK LDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYDSKKDRI+AARDPIGV TLYMGRSS SP+TV+FASELKCL D CDSI++FPPGH+
Sbjct: 121 AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRYFTP+W+DE +IP+TPVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXX-XXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                  LAGIDD+GHL TSGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEAANRELDASQYAEEGSHLAGIDDEGHLRTSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGSIHHEHTFTLQEG+DALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDPN+K+I  KEGRIEKYILRKAFDT D+P  KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+DTAE+ ISD MFANPK+ WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRWIPKADWGCAEDPSGRYA+IHEKH+
Sbjct: 541 AETVMRWIPKADWGCAEDPSGRYAQIHEKHI 571

>SAKL0F02970g Chr6 complement(252336..254057) [1722 bp, 573 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/571 (81%), Positives = 496/571 (86%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA +KHE +  FKPKALQLSK+IRHRGPDWSGN V N+TI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+Y L VNGEIYNHI+LRE  + Y F+T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+KKDRI+AARDPIG+ TLYMGRSS SP TV+FASELKCL D CD I +FPPGHV
Sbjct: 121 AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TDKITRY+TPDWLDE+RIP TP+DY  IR+SLE AVRKRLMAEVPY          
Sbjct: 181 YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARET                + LAG+DD+G+LH +GWSRLHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKDLDPVAYDDEDKHLAGVDDKGNLHAAGWSRLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFI SIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL +CMNIDP EKMI   EGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE AISD  FA PK +WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TDEL0D05520 Chr4 (996468..998189) [1722 bp, 573 aa] {ON} Anc_3.483
           YPR145W
          Length = 573

 Score =  968 bits (2502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/571 (80%), Positives = 506/571 (88%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA KHED+  +K KALQLSK+IRHRGPDWSGN + N+T+ VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G Y L VNGEIYNHI+LRE  SDYKF T SDCEPIIPLY ++DID PKYLDGMF
Sbjct: 61  PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+K+DRI+AARDP+G+ TLYMGR+S SP+TV+FASELKCLTD CD+I++FPPGH+
Sbjct: 121 AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDKITRYFTPDWLDE RIPS PVDY AIRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAGIDD G+LH++GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKANAEIDAQKYDSEDKHLAGIDDSGNLHSAGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AA KVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 KAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAP+A EFHTE+V+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMNIDP +KMI  +EGR+EKYILRKAFDTTDEPDVKPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAER ISD +FA PK+ WGDD+PTTKEA+WYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           ADTVMRW+PKADWGCAEDPSGR+A+IH++HV
Sbjct: 541 ADTVMRWVPKADWGCAEDPSGRFAQIHDQHV 571

>KNAG0A07920 Chr1 (1262894..1264630) [1737 bp, 578 aa] {ON}
           Anc_3.483 YPR145W
          Length = 578

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/575 (80%), Positives = 504/575 (87%), Gaps = 5/575 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA F+HED+  FKP+ALQLSK+IRHRGPDWSGN + NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G+Y+L VNGEIYNHIQLRE C +Y++++ SDCEPIIP+YL++D+DAPK+LDGMF
Sbjct: 61  PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+KKDRIVAARDPIG+ TLYMGRSS  P+TV+FASELKCLTD CD+II+FPPGHV
Sbjct: 121 AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKITRY+TP+WLDE +IPSTPVD   IRH+LEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-----LAGIDDQGHLHTSGWSRLHSFAIGLPN 295
             IAAIAARET                +     LAGIDD+G+L ++ WSRLHSFAIGLP 
Sbjct: 241 SLIAAIAARETEKANKELDPRKYDEQEEAEGHHLAGIDDEGNLLSATWSRLHSFAIGLPG 300

Query: 296 APDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 355
           APDL AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI
Sbjct: 301 APDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKI 360

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWG
Sbjct: 361 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWG 420

Query: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILW 475
           LEARVPFLDK+FL LCMNIDP +K+I  KEGRIEKYILRKAFDT DEPDVKPYLPEEILW
Sbjct: 421 LEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYLPEEILW 480

Query: 476 RQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFP 535
           RQKEQFSDGVGYSWIDGL+DTAE  ISD MFA PKA WG D+PTTKEA+WYRLKFDA FP
Sbjct: 481 RQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLKFDALFP 540

Query: 536 QKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           Q TAA+TVMRWIPKADWGCAEDPSGR+AKIHE+HV
Sbjct: 541 QPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHV 575

>Kwal_55.21187 s55 (723404..725125) [1722 bp, 573 aa] {ON} YPR145W
           (ASN1) - asparagine synthetase [contig 295] FULL
          Length = 573

 Score =  960 bits (2481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/572 (79%), Positives = 498/572 (87%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+HED+  FKP ALQL+K+IRHRGPDWSGN + NST+  HERLAIVGLD+GAQ
Sbjct: 1   MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P+ S + +Y+L VNGEIYNHIQLRE  SDY F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+KKDR++AARDPIG+ TLYMGR S+SP+TVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRY+TP+WLDE RIPS P+D   IR+SLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARET                + LAG+DD G LH++GWSRLHSFA+GLPNAPDL
Sbjct: 241 SLIAAIAARETEKANTEMNPVEYDSEDKHLAGVDDSGKLHSAGWSRLHSFAVGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           +AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 EAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAE  ISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHVS 571
           A TVMRWIPKADWGCAEDPSGRYAKIH++H+S
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHDQHIS 572

>TBLA0C04430 Chr3 (1072027..1073769) [1743 bp, 580 aa] {ON}
           Anc_3.483 YPR145W
          Length = 580

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/578 (77%), Positives = 498/578 (86%), Gaps = 8/578 (1%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAA+KH +++ FKP+ALQL+K+IRHRGPDWSGN V N+T+F HERLAIVGLDSGAQ
Sbjct: 1   MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS  G YML VNGEIYNHIQLRE  +DYK++T  DCEPIIP+YL++D+DAP +LDGMF
Sbjct: 61  PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           AF LYDS+KDR++AARDP+G+ TLYMGR+S++P+TVYFASELKCL D CDSII+FPPGHV
Sbjct: 121 AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETDKI RYF P+W+DE  IP+TPVD   +R +LE+AVRKRLMAEVPY          
Sbjct: 181 YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXX--------XXXXXXQLAGIDDQGHLHTSGWSRLHSFAIG 292
             IA+IAARET                        +L G+DD G+L T  WS+LHSFAIG
Sbjct: 241 SLIASIAARETEKVMDETNTIDYEKQSDDAADASKKLTGLDDSGNLQTQSWSKLHSFAIG 300

Query: 293 LPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 352
           LP APDL+AARKVA FIGSIHHEH FT+QEGLDALDDVIYHLETYDVTTIRASTPMFLLS
Sbjct: 301 LPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMFLLS 360

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFH ESV+RVKNLHLAD LRANKSTM
Sbjct: 361 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANKSTM 420

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEE 472
           AWGLEARVPFLD+DFL LCMNIDPN+KMIKPKEG+IEKY+LRKAFDT+DEPDVKPYLPEE
Sbjct: 421 AWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYLPEE 480

Query: 473 ILWRQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDA 532
           ILWRQKEQFSDGVGYSWID L+DTAER ISD MFANPK  WG DIPTTKEAYWYRLKFDA
Sbjct: 481 ILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLKFDA 540

Query: 533 WFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
            FPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 LFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHI 578

>KLTH0F14630g Chr6 (1198036..1199757) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P49089 Saccharomyces cerevisiae
           YPR145W ASN1 Asparagine synthetase isozyme of Asn2p
           catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 573

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/571 (79%), Positives = 491/571 (85%), Gaps = 1/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  F+H+ +  FKP AL+L K+IRHRGPDWSGN + NST+  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           P  S D  Y+LGVNGE+YNHIQLRE  S Y F+T SDCEPIIPLY ++ IDAPKYLDGMF
Sbjct: 61  PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+KKDRIVAARDPIG+ TLYMGR S+SP+TVYFASELKCLTD CDSII+FPPGHV
Sbjct: 121 AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDSETD+ITRYF PDW+DE RIPS P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAG+DD G+L ++GWS LHSFAIGLPNAPDL
Sbjct: 241 SLIASIAARETEKANSQMDPVKYDSEDKHLAGVDDAGNLRSAGWSHLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFTLQEGLDAL DVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FLQLCMN+DP EKMI   EGRIEKYILRKAFDT+DEP  KPYLPEEILWRQKE
Sbjct: 421 VPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYLPEEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE AISD  F  PKA+WGDDIPTTKEAYWYRLKFDA FPQKTA
Sbjct: 481 QFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLKFDALFPQKTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A TVMRWIPKADWGCAEDPSGRYAKIHE+H+
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHI 571

>TPHA0D04200 Chr4 (904705..906429) [1725 bp, 574 aa] {ON} Anc_3.483
           YPR145W
          Length = 574

 Score =  953 bits (2463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/573 (78%), Positives = 498/573 (86%), Gaps = 1/573 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIF  +KHE+   FKP+ALQLSK+IRHRGPDWSGN V NSTI  HERLAIVGLDSGAQ
Sbjct: 1   MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PITS DG+++L VNGEIYNHIQ+RE   DY+F+T SDCEPIIPLY+++  +APK+LDGMF
Sbjct: 61  PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+ LYD+K+DRI+AARDPIG+ TLYMGRSS+SP+TVYFASELKCLTD CDSI++FPPGHV
Sbjct: 121 AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS TD+ITRY+TPDW+DE RI + P+D   IRHSLEKAVRKRLMAEVPY          
Sbjct: 181 YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXX-XXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                 QL GIDD G+L +SGWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETEKAMKTASSDSLSSSVNQLTGIDDNGNLRSSGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AA+KVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 IAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESV+RVKNLHL+DCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD++FL LCMNIDP+EKMI  KEGRIEKYILRKAFDTTDEP+ KPYLP+EILWRQKE
Sbjct: 421 VPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYLPDEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+DTAER ISD +F NP+  WG DIPTTKEAYWYRLKFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLKFDALFPQPTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
           A TVMRWIPKADWGCAEDPSGRYAKIHE+H+ A
Sbjct: 541 ASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGA 573

>AFR303W Chr6 (989036..990751) [1716 bp, 571 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR124W (ASN2) and
           YPR145W (ASN1)
          Length = 571

 Score =  951 bits (2458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/572 (78%), Positives = 495/572 (86%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ +DI +FKP AL+LSK++RHRGPDWSGN + N TI VHERLAIVGLDSGAQ
Sbjct: 1   MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG Y+L VNGEIYNHI LRE CSDY+F + SDCEPIIPLYL++D++ P++LDGMF
Sbjct: 61  PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD ++DRIVAARDPIGV TLYMG+SS SP T YFASELKCL D CD I +FPPGHV
Sbjct: 121 AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TDK+TRYF PDW+DE RIPS PVDY A+R +LEKAVRKRLMAEVPY          
Sbjct: 181 YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQLAGIDDQGHLHTSGWSRLHSFAIGLPNAPDLQ 300
             IA+IAARET                 LAG+DD+G LHT GWSRLHSFAIGLPNAPDLQ
Sbjct: 241 SLIASIAARETERANREAGDVYADGK-HLAGMDDRGLLHTGGWSRLHSFAIGLPNAPDLQ 299

Query: 301 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQGV 360
           AARKVAKFIGSIHHEHTFTLQEGLDALDDVI+HLETYDVTTIRASTPMFLLSRKIKAQGV
Sbjct: 300 AARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMFLLSRKIKAQGV 359

Query: 361 KMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           KMVLSGEGSDEIFGGYLYFAQAPS AEFHTE+V+RV NLHLADCLRANKSTMAWGLEARV
Sbjct: 360 KMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANKSTMAWGLEARV 419

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKEQ 480
           PFLD++FLQLCMNIDP EKMI P++GRIEKYILRKAFDT+DEP V PYLPEEILWRQKEQ
Sbjct: 420 PFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYLPEEILWRQKEQ 479

Query: 481 FSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTAA 540
           FSDGVGYSWIDGL+D AERAISD  FANP   WGDDIPTTKEA+WYRLKFDA FPQ TAA
Sbjct: 480 FSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLKFDALFPQPTAA 539

Query: 541 DTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA 572
            TVMRW+PKADWGCAEDPSGRYAKIH++H+S+
Sbjct: 540 ATVMRWVPKADWGCAEDPSGRYAKIHDQHISS 571

>ZYRO0B04136g Chr2 complement(345085..346803) [1719 bp, 572 aa] {ON}
           highly similar to uniprot|P49089 Saccharomyces
           cerevisiae YPR145W ASN1 Asparagine synthetase isozyme of
           Asn2p catalyzes the synthesis of L-asparagine from L-
           aspartate in the asparagine biosynthetic pathway
          Length = 572

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/571 (77%), Positives = 490/571 (85%), Gaps = 2/571 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFAAF+H D+  ++P ALQLSK+IRHRGPDWSGN V NSTI VHERLAIVGL+SG+Q
Sbjct: 1   MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S  G Y L VNGEIYNHIQLRE CSDY FQ+ SDCEPIIPLYL++ +DAPK LDGMF
Sbjct: 61  PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYDSK+DRIVAARDPIG+ TLYMG+SS+SP+T +FASELKCL D CD I++FPPGHV
Sbjct: 121 AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS++D+ITRYF P WLDE  +PSTP+DY  +RHSLEK+VRKRLMAEVPY          
Sbjct: 181 YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IA+IAARET                + LAGID QG+LHT GWSRLHSFAIGLP APDL
Sbjct: 241 SLIASIAARETERANEELDPVNYDSEEKHLAGIDAQGNLHTGGWSRLHSFAIGLPGAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
            AARKVAKFIGS+HHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 LAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           VKMVLSGEGSDEIFGGYLYFAQAPSA EF  E   RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 VKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL LCM +DPNEKMIKP+EGRIEKYILRKAFDTTDEP+VKPYLPE+ILWRQKE
Sbjct: 421 VPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYLPEDILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWIDGL+D AE AISD M A P+ +WGDD PTTKEAYWYRLKFD +FP K+A
Sbjct: 481 QFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLKFDKFFP-KSA 539

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHV 570
           A+TVMRWIPKADWGC  DPSGR+AKIHE+H+
Sbjct: 540 ANTVMRWIPKADWGCHGDPSGRFAKIHEQHI 570

>Ecym_1244 Chr1 complement(501719..503440) [1722 bp, 573 aa] {ON}
           similar to Ashbya gossypii AFR303W
          Length = 573

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/572 (76%), Positives = 487/572 (85%), Gaps = 1/572 (0%)

Query: 1   MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ 60
           MCGIFA ++ + I +FKP ALQLSK+IRHRGPDWSGN V N TIFVHERLAIVGLD+GAQ
Sbjct: 1   MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ 60

Query: 61  PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF 120
           PI S DG Y+L VNGEIYNHI LR++C+DY F T SDCEPIIPL+ ++ ++ P YLDGMF
Sbjct: 61  PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF 120

Query: 121 AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV 180
           A+CLYD+K DRIVAARDPIGV TLYMG+ S+SP T YFASELKCL + CD IISFPPGHV
Sbjct: 121 AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV 180

Query: 181 YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYXXXXXXXXXX 240
           YDS+TD+ITRYF P WL +   P+ PVDY  +R  LEKAVRKRLM EVPY          
Sbjct: 181 YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS 240

Query: 241 XXIAAIAARETXXXXXXXXXXXXXXXXQ-LAGIDDQGHLHTSGWSRLHSFAIGLPNAPDL 299
             IAAIAARET                + L G+DD+ HLH SGWS+LHSFAIGLPNAPDL
Sbjct: 241 SLIAAIAARETEKANKEMDVVKYDSQVRNLVGVDDELHLHASGWSKLHSFAIGLPNAPDL 300

Query: 300 QAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMFLLSRKIKAQG 359
           QAARKVAKFIGSIHHEHTFT+QEGLDALDDVI+HLET+DVTTIRASTPMFLLSRKIKAQG
Sbjct: 301 QAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMFLLSRKIKAQG 360

Query: 360 VKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEAR 419
           +KMVLSGEGSDEIFGGYLYFAQAPSA +FH ESV+RVKNLHLADCLRANKSTMAWGLEAR
Sbjct: 361 IKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANKSTMAWGLEAR 420

Query: 420 VPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYLPEEILWRQKE 479
           VPFLD+DFL+LCMNIDP EKMIKPKEG+IEKYILRKAFDT+DEPDV+PYLP+EILWRQKE
Sbjct: 421 VPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYLPQEILWRQKE 480

Query: 480 QFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLKFDAWFPQKTA 539
           QFSDGVGYSWID L+D AE AISD  FA PK +WGDDIP+TKEAYWYR+KFDA FPQ TA
Sbjct: 481 QFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMKFDALFPQPTA 540

Query: 540 ADTVMRWIPKADWGCAEDPSGRYAKIHEKHVS 571
           A TVMRW+PKA+WGC+EDPSGR+AKIHEKH+S
Sbjct: 541 ASTVMRWVPKAEWGCSEDPSGRFAKIHEKHIS 572

>ZYRO0A00528g Chr1 (35425..36963) [1539 bp, 512 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 512

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/103 (33%), Positives = 56/103 (54%), Gaps = 9/103 (8%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           +K + QG+ ++ SG G+DE++GGY  FA+  S  E   E  +++ N++  +  R +K   
Sbjct: 378 KKYQRQGI-VLFSGLGADELYGGYYKFAR-KSTDELVEELTRQINNIYNRNLNRDDKVIA 435

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
           A G+E R PFLD+  ++  M          P   +I K ILRK
Sbjct: 436 ANGVEVRYPFLDRHVIEFSMQ-------SIPINWKINKLILRK 471

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 73/171 (42%), Gaps = 35/171 (20%)

Query: 69  YMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHD----IDAPKYLDGMFAFCL 124
           Y+L  NGE+YN             +   +    +   LE+D     +   +L+G FA+ +
Sbjct: 88  YILQFNGELYNE------------EILDNDTSFVASLLENDKMSVFEVISFLEGEFAYTI 135

Query: 125 YDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFAS---ELKCLTDVCDSIISFPPGHVY 181
           YD  + ++   RD IG  +L   R  Q+   +Y AS   + +  TD    I+     ++Y
Sbjct: 136 YDMHEHKLYFGRDDIGKRSLSY-RLDQAIGDIYVASVTGQQEGFTDCLAGIV-----YIY 189

Query: 182 DSETDKITRYFTPDWLDEKRIPSTPVD--------YHAIRHSLEKAVRKRL 224
           D E   + +   P  +  + + S  ++         HA+   L+ A+ KR+
Sbjct: 190 DVEDKSLNQQMLP--ILNREVSSEIIEDEDEFQRITHALYEQLKSAIVKRV 238

>Skud_7.311 Chr7
           complement(535445..535513,535517..535621,535625..535693)
           [243 bp, 81 aa] {ON} YGR124W (REAL)
          Length = 81

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 44/89 (49%), Gaps = 14/89 (15%)

Query: 102 IPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASE 161
           +P YLE DIDAPK+L+ MFAF     +K              ++ G S     T +  S+
Sbjct: 1   VPFYLERDIDAPKHLNDMFAFSWKKKEKSCCCC--------KIFYGCSFLMHRTFFQVSK 52

Query: 162 --LKCLTDV----CDSIISFPPGHVYDSE 184
             L C T +    CD+  SF PG V+DSE
Sbjct: 53  DCLLCFTQILTGFCDNNDSFSPGRVFDSE 81

>Kpol_455.7 s455 complement(6566..8122) [1557 bp, 518 aa] {ON}
           complement(6566..8122) [1557 nt, 519 aa]
          Length = 518

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/94 (32%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 391 VLFSGLGADELYGGYHSFANK-SIEELTVELTRQINNIHDRNLNRDDKVIADNGVEVRYP 449

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
           FLD++ +Q  ++         P   ++ K ILRK
Sbjct: 450 FLDEEVIQYSVS-------QIPISYKVNKGILRK 476

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 88/218 (40%), Gaps = 36/218 (16%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V       H       + S  QP T      D  Y+L  NGE+YN  +
Sbjct: 50  IVSRGPNYSSLRVNRE----HGISWFSSILSLRQPFTRQSIVVDERYVLQFNGELYNS-E 104

Query: 83  LREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIVAARDPIGVV 142
           +    + Y       C+  +       +   + LDG FA+ +YD K+  I   RD IG  
Sbjct: 105 ISGNDTQYIVSLLKSCDGDV-------VSLVRKLDGGFAYTIYDLKEGNIYFGRDTIGKR 157

Query: 143 TLYMGRSSQSPETVYFASELK----CLTDVCDSIISFPPGHVYDSET-----DKITR--Y 191
           +L       S E   F S +        D    +I     + YD++T      K+ R  Y
Sbjct: 158 SLCYSIDENSGEL--FISSVTGTRGTFVDCLGGVI-----YTYDTKTHTLDDTKVIRDKY 210

Query: 192 FTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVP 229
              D  DE    S  ++   +  +L ++V+KR+++  P
Sbjct: 211 VVTDMTDELENESQYME--LLYGTLYESVKKRVLSIHP 246

>ADL350C Chr4 complement(90152..91678) [1527 bp, 508 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML096W
          Length = 508

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 49/89 (55%), Gaps = 4/89 (4%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ +G G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K     G+EAR P
Sbjct: 382 VLFNGLGADELYGGYHKFANK-STEELVVELTRQINNIHDRNLNRDDKVLACHGVEARYP 440

Query: 422 FLDKDFLQLCMNID---PNEKMIKPKEGR 447
           FLD+  ++  + +     N+KMI  K  R
Sbjct: 441 FLDEKVIKASVALPISYKNDKMILRKLAR 469

>NDAI0K00180 Chr11 (27899..29467) [1569 bp, 522 aa] {ON} Anc_8.875
           YML096W
          Length = 522

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA   S  E   E  +++ N++  +  R +K     G+E R P
Sbjct: 396 VLFSGLGADELYGGYHKFANK-STEELVKELTKQINNIYDRNLNRDDKVIAHNGVEVRYP 454

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
           FLD D ++        E++  P   +I K ILRK
Sbjct: 455 FLDIDVIKF-----STEEL--PINYKINKLILRK 481

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 92/225 (40%), Gaps = 25/225 (11%)

Query: 15  NFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPITSADGEYMLGVN 74
           N  P    +   I  RGP++S   V            +   +   +        Y++  N
Sbjct: 37  NIDPIFNSMISDIAARGPNYSSFKVSKQYSITWFSSVLSLREPFTKQCVEIKDRYVVQFN 96

Query: 75  GEIYN-HIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIV 133
           GE+YN  IQ  +  + Y  Q   + + II        D  + LDG FA+ +YD +     
Sbjct: 97  GELYNDEIQYND--TQYTIQLLKEGKEII--------DVIRKLDGEFAYTIYDIQNRMFY 146

Query: 134 AARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHVY-------DSETD 186
             RDPIG   L     +++ E +Y +S   C T   D I     G +Y       +  TD
Sbjct: 147 FGRDPIGRRCLSFSIDNETGE-LYISSVTGCKTGFQDCI----AGTIYKYDCQLKELNTD 201

Query: 187 -KITR-YFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVP 229
            KI++ ++  + LD++ +     +   +   L  +V KR+++  P
Sbjct: 202 SKISKPFYVSEELDDENLSHLDDNVEKLYTHLLDSVSKRVVSIHP 246

>KLLA0D10285g Chr4 (869754..871301) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 352 SRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 411
           S+     G+ M  SG G+DE++GGY  F+   S  E   E  +++  +H  +  R +K  
Sbjct: 381 SKPYNRSGIVM-FSGLGADELYGGYHKFSNK-SNEELVIELQKQIAQIHDRNLNRDDKVI 438

Query: 412 MAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEP 463
              G+E R PFLD+  +Q  +++  N K+ K     + K ILR  F  ++EP
Sbjct: 439 SNHGIEVRYPFLDERVVQFSVDLPLNYKVNKHILRVMAKDILRLDF-ISEEP 489

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 18/124 (14%)

Query: 27  IRHRGPDWSGN---AVMNSTIFVHERLAIVGLDS--GAQPITSADGEYMLGVNGEIYNHI 81
           I  RGP+++     + +N+ +F     +++ L +    Q +   D  Y+L  NGE+YN  
Sbjct: 48  IVRRGPNYASLRSLSEINAMLFS----SVLSLRTPFTKQSVMVQD-RYLLQYNGELYNDD 102

Query: 82  QLREMCSDYKFQTFSDCEPIIPLYLEHDID-APKYLDGMFAFCLYDSKKDRIVAARDPIG 140
            + E C        SD E I  L  +H ++   +   G FA+ + D ++ ++   RD IG
Sbjct: 103 TV-ENCE------HSDTEYISSLLEKHSVEEVVRKCYGEFAYAITDLQERKVYFGRDSIG 155

Query: 141 VVTL 144
             +L
Sbjct: 156 KRSL 159

>KAFR0L02110 Chr12 complement(400443..401987) [1545 bp, 514 aa] {ON}
           Anc_8.875 YML096W
          Length = 514

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 49/95 (51%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  F    S  E   E   ++ N+H  +  R +K   + G+E R P
Sbjct: 388 VLFSGLGADELYGGYHKFVNR-SLEELSAELTGQINNIHDRNLNRDDKVIASNGVEVRYP 446

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
           FLD + +Q        +++  P   ++ K ILRK 
Sbjct: 447 FLDHNVVQF-----STQEI--PINYKVNKLILRKV 474

 Score = 35.4 bits (80), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 56/118 (47%), Gaps = 15/118 (12%)

Query: 27  IRHRGPDWSGNAVMNS--TIFVHERLAIVGLDSGAQPITSADGEYMLGVNGEIYNHIQLR 84
           I +RGP++S   +     T +    LA+  L    Q +   D  Y+L  NGE+YN  +++
Sbjct: 46  IANRGPNYSSLRLSEKYHTAWFSSVLAL-RLPFTKQSLCVED-RYVLQFNGELYNK-EIK 102

Query: 85  EMCSDYKF--QTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIVAARDPIG 140
           +  +D +F     S    +I    +        LDG FA+ +YD ++ +I   RD IG
Sbjct: 103 QDQNDTQFIASLLSSSTDVIHTLTQ--------LDGEFAYTIYDLRETKIYFGRDSIG 152

>TDEL0B00440 Chr2 complement(78116..79666) [1551 bp, 516 aa] {ON}
           Anc_8.875 YML096W
          Length = 516

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 50/94 (53%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY   A   S +E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 390 VLFSGLGADELYGGYHKLANK-SPSELKEELTRQINNIHDRNLNRDDKVIADNGVEVRYP 448

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
           FLD D ++        E++  P   ++ K ILR+
Sbjct: 449 FLDHDVIKF-----STEEI--PINYKVNKMILRR 475

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 101/221 (45%), Gaps = 39/221 (17%)

Query: 27  IRHRGPDWSGNAVMN--STIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYNH 80
           I+ RGPD+S   V +  ST +    L++       +P TS        ++L  NGE+YN 
Sbjct: 47  IKSRGPDYSSLRVSSEHSTAWYSSVLSL------REPFTSQSVKVGNRFILQFNGELYNQ 100

Query: 81  IQLREMCSDYKFQTFSDCEPIIPLYLE--HDI-DAPKYLDGMFAFCLYDSKKDRIVAARD 137
            ++    +D +F        I+    E  HD+    + L G FA+ LYD ++ +    RD
Sbjct: 101 -EITAHDNDTQF--------IVSKLQEGYHDVCQIIRQLSGEFAYTLYDLQQRKFYYGRD 151

Query: 138 PIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHVYDSETDKI-------TR 190
            +G  +L    S+ + E +Y +S    +    D I      +VYD+E+  +       ++
Sbjct: 152 NVGKRSLSYHLSAITGE-LYISSVSGAIPGFKDCIAGVV--YVYDTESKTLDDSIKLESQ 208

Query: 191 YFTPDWLDEKR--IPSTPVDYHAIRHSLEKAVRKRLMAEVP 229
           YF    LDE+   + ST    + +   L  AVRKR+++  P
Sbjct: 209 YFITKKLDEELTCLDSTVEQLYGM---LSLAVRKRVLSIHP 246

>NCAS0C00190 Chr3 complement(17177..18730) [1554 bp, 517 aa] {ON}
           Anc_8.875
          Length = 517

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 55/105 (52%), Gaps = 9/105 (8%)

Query: 351 LSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKS 410
           +  K + +G+ ++ SG G+DE++GGY  FA   S  +   E  +++ N++  +  R +K 
Sbjct: 380 IKEKYQRKGI-VLFSGLGADELYGGYHKFANK-SPDDLAIELTRQINNIYDRNLNRDDKV 437

Query: 411 TMAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
               G+E R PFLD++ ++          M  P   ++ K ILRK
Sbjct: 438 IANNGVEVRYPFLDEEVIKFST-------MEIPINYKVNKMILRK 475

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 53/124 (42%), Gaps = 20/124 (16%)

Query: 27  IRHRGPDWSGNAVMNS--TIFVHERLAIVGLDSGAQPITSADGE----YMLGVNGEIYNH 80
           I  RGP++S   V     T +    L++       QP T    E    Y+L  NGE+YNH
Sbjct: 48  ISARGPNYSSLRVSKKYKTAWYSSVLSL------RQPFTCQSIEIEERYVLQFNGELYNH 101

Query: 81  IQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIVAARDPIG 140
            ++    + Y      +  P IP  +       K L+G FA+ +YD +       RD +G
Sbjct: 102 -EIVHNDTQYIVGLLKESAPSIPAII-------KKLNGEFAYSIYDIQNGTFYFGRDTVG 153

Query: 141 VVTL 144
             +L
Sbjct: 154 KRSL 157

>TPHA0C04950 Chr3 complement(1067043..1068620) [1578 bp, 525 aa]
           {ON} Anc_8.875 YML096W
          Length = 525

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 52/99 (52%), Gaps = 9/99 (9%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           K +G+ ++ SG G+DE++GGY  FA   S  E   E  +++ N+H  +  R +K +   G
Sbjct: 388 KRKGI-VLFSGLGADELYGGYHKFANK-SREELVEELTKQINNIHDRNLNRDDKVSADNG 445

Query: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILR 454
           +E R PFLD    +  +N    E    P   +I K ILR
Sbjct: 446 IEVRYPFLD----EYVVNFSTKE---IPINYKINKKILR 477

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLA-IVGLDSGAQPITSADGE----YMLGVNGEIYNHI 81
           I  RGP++    V  S     E+++    + S  +P T    E    Y+L  NGE+YN+ 
Sbjct: 47  IARRGPNYQMFRVFKS-----EQISWYSSILSLRKPFTKQSIEVNDRYILQFNGELYNN- 100

Query: 82  QLREMCSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDSKKDRIVAARDPIG 140
              E+        F +C  +     E DI +  + L+G FA+ ++DSKK  +   RD IG
Sbjct: 101 ---EIHGISDTTYFVNC--LKTALDEKDIINILRTLEGEFAYTIFDSKKKLVYFGRDTIG 155

Query: 141 VVTL 144
             +L
Sbjct: 156 KRSL 159

>Skud_13.46 Chr13 (79277..80836) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 53/101 (52%), Gaps = 9/101 (8%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           + QGV ++LSG G+DE++GGY  FA   +  E   E  +++ N++  +  R +K     G
Sbjct: 388 QRQGV-VLLSGLGADELYGGYHKFANK-AHHELVKELTRQINNIYERNLNRDDKVIAHNG 445

Query: 416 LEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
           +E R PFLD+  + L         +  P   ++ K ILRK 
Sbjct: 446 VEVRYPFLDEYVINLST-------LEIPINYKVNKLILRKV 479

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 14/123 (11%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V+ +    H+      + S  +P T    + D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVIKA----HQTRWFSSVLSLRRPFTKQSINVDDRYHLQFNGELYN--- 99

Query: 83  LREMCSDYKFQTFSDCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDSKKDRIVAARDPIGV 141
             +  SD+   +      +  L    ++ D  + L+G +A+ +YD K       RDPIG 
Sbjct: 100 --KEISDWDNDSLYIASLLRNLEDGRNVVDVIRSLEGEYAYTVYDVKSSIFYFGRDPIGK 157

Query: 142 VTL 144
            +L
Sbjct: 158 RSL 160

>SAKL0D00352g Chr4 (31387..32934) [1548 bp, 515 aa] {ON} similar to
           uniprot|Q04489 Saccharomyces cerevisiae YML096W
           Hypothetical ORF
          Length = 515

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 2/85 (2%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417
           +GV ++ SG G+DE++GGY   A   SA E       ++ N+H  +  R +K   + G+E
Sbjct: 387 KGV-VLFSGLGADELYGGYHKLANK-SAEELANALTLQINNIHDRNLNRDDKVIASNGVE 444

Query: 418 ARVPFLDKDFLQLCMNIDPNEKMIK 442
            R PFLD+  +Q    +  N K+ K
Sbjct: 445 VRYPFLDEKVVQFSTELPINYKVNK 469

>KNAG0J00200 Chr10 complement(24044..25591) [1548 bp, 515 aa] {ON}
           Anc_8.875 YML096W
          Length = 515

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (50%), Gaps = 9/102 (8%)

Query: 354 KIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           KI  Q   +VL SG G+DE++GGY  FA   S  +   E  +++ N+H  +  R +K   
Sbjct: 380 KIAYQRKGIVLFSGLGADELYGGYHKFANK-SFPDLQIELTRQINNIHDRNLNRDDKVIA 438

Query: 413 AWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILR 454
           + G+E R PFLD   ++        E +  P   +I K ILR
Sbjct: 439 SNGVEIRYPFLDSSVVKFS-----TEDL--PINYKINKLILR 473

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 58/126 (46%), Gaps = 24/126 (19%)

Query: 27  IRHRGPD---WSGNAVMNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEIYN 79
           I  RGP+   W G+A  ++  F     +++ L    QP T      DG Y+L  NGE+YN
Sbjct: 47  IAARGPNFASWRGSAEYSTAWFS----SVLSL---RQPFTKQSLVVDGRYVLQFNGELYN 99

Query: 80  -HIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMFAFCLYDSKKDRIVAARDP 138
             I+  +  + Y     +  E  IP       D    LDG FA+ +YD++  +    RD 
Sbjct: 100 DEIEFND--TQYIADMLARGEASIP-------DIIARLDGEFAYTIYDTEDQKYYFGRDA 150

Query: 139 IGVVTL 144
           IG  +L
Sbjct: 151 IGKRSL 156

>Suva_13.52 Chr13 (81009..82568) [1560 bp, 519 aa] {ON} YML096W
           (REAL)
          Length = 519

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 358 QGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLE 417
           QGV ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E
Sbjct: 390 QGV-VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYERNLNRDDKVIAHNGVE 447

Query: 418 ARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
            R PFLD+  ++    +D       P   +I K ILR  
Sbjct: 448 VRYPFLDEHVIKFSA-VDI------PINFKINKLILRNV 479

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 50/168 (29%), Positives = 72/168 (42%), Gaps = 28/168 (16%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S   V  +    ++      + S  QP T    S D  Y L  NGE+YN   
Sbjct: 47  IAARGPNYSSLRVSKA----YQTSWFSSVLSLRQPFTKQSISVDDRYYLQFNGELYN--- 99

Query: 83  LREMCSDYKFQTFSDCEPIIPLY--LEHD---IDAPKYLDGMFAFCLYDSKKDRIVAARD 137
            +E+  D      +D + I  L   L  D   ID  + L+G +A+ +YD K  +    RD
Sbjct: 100 -KEISDD-----DNDSQYIASLLQNLTGDGDVIDVIRMLEGEYAYTVYDVKASKFYFGRD 153

Query: 138 PIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHVYDSET 185
           PIG  +L    S      +Y AS    +    D I     G VY+ +T
Sbjct: 154 PIGRRSL--SYSVTPNNELYVASATGAIEGFQDCI----GGIVYEYDT 195

>YML096W Chr13 (79909..81486) [1578 bp, 525 aa] {ON} Putative
           protein of unknown function with similarity to
           asparagine synthetases; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; YML096W
           is not an essential gene and partially overlaps the
           verified gene RAD10
          Length = 525

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 48/95 (50%), Gaps = 8/95 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  FA  P   E   E  +++ N++  +  R +K     G+E R P
Sbjct: 393 VLFSGLGADELYGGYHKFANKP-PHELVEELTRQINNIYDRNLNRDDKVIAHNGVEVRYP 451

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
           FLD+  ++L            P   ++ K ILRK 
Sbjct: 452 FLDEYVIKLST-------AEIPINFKVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 42/90 (46%), Gaps = 10/90 (11%)

Query: 60  QPIT----SADGEYMLGVNGEIYN-HIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPK 114
           QP T    + D  Y L  NGE+YN  I   +  S Y      + +  + +     ID  K
Sbjct: 76  QPFTKQSINVDDRYFLQFNGELYNKEISQGDNDSLYIASMLQNLKEGMGV-----IDVIK 130

Query: 115 YLDGMFAFCLYDSKKDRIVAARDPIGVVTL 144
            L+G +A+ +YD    ++   RDPIG  +L
Sbjct: 131 SLEGEYAYTIYDVNSSKLYFGRDPIGRRSL 160

>Smik_13.39 Chr13 (77004..78569) [1566 bp, 521 aa] {ON} YML096W
           (REAL)
          Length = 521

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 10/96 (10%)

Query: 362 MVLSGEGSDEIFGGYLYFA-QAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARV 420
           ++LSG G+DE++GGY  FA +AP   E   E  +++ N++  +  R +K     G+E R 
Sbjct: 393 VLLSGLGADELYGGYHKFANKAPH--ELVEELTKQINNIYERNLNRDDKVIAHNGVEVRY 450

Query: 421 PFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
           PFLD+  ++          +  P   ++ K ILRK 
Sbjct: 451 PFLDEYVIKFST-------VEIPINYKVNKLILRKV 479

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 73/174 (41%), Gaps = 32/174 (18%)

Query: 27  IRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPIT----SADGEYMLGVNGEIYNHIQ 82
           I  RGP++S       T+  +       + S  +P T    + D  Y L  NGE+YN  +
Sbjct: 47  IAARGPNYSSL----RTVRAYRTSWFSSVLSLREPFTKQSINVDDRYYLQFNGELYNK-E 101

Query: 83  LREMCSD--YKFQTFSDCEPIIPLYLEHD---IDAPKYLDGMFAFCLYDSKKDRIVAARD 137
           +    +D  Y      D        LE D   ID  K L+G +A+ +YD K  +    RD
Sbjct: 102 VSHWGNDSLYIASLLKD--------LEDDGSVIDVIKSLEGEYAYTVYDVKSAKFYFGRD 153

Query: 138 PIGVVTLYMGRSSQSPETVYFAS---ELKCLTDVCDSIISFPPGHVYDSETDKI 188
           PIG  +L    S  +   +Y AS    ++C  D     +     + YD++T  +
Sbjct: 154 PIGRRSL--SYSVTANNELYVASVTGAVECFHDCIGGTV-----YEYDTQTKSL 200

>Kwal_27.9705 s27 (28837..30384) [1548 bp, 515 aa] {ON} YML096W -
           Hypothetical ORF [contig 336] FULL
          Length = 515

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 356 KAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWG 415
           K +G+ ++ SG G+DE++GGY  F+   +  E   E   ++ N+H  +  R +K   + G
Sbjct: 384 KRRGI-VLFSGLGADELYGGYHKFSN-KTPEELVGELETQINNIHDRNLNRDDKVIASNG 441

Query: 416 LEARVPFLDKDFLQLCMNIDPNEKMIK 442
           +E R PFLD   ++    +  N K+ K
Sbjct: 442 VEVRYPFLDDRVIEFSTQLPINYKVNK 468

>TBLA0C06300 Chr3 (1523556..1525112) [1557 bp, 518 aa] {ON}
           Anc_8.875 YML096W
          Length = 518

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/94 (30%), Positives = 47/94 (50%), Gaps = 8/94 (8%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  F    +  E   E  +++ N+H  +  R +K     G+E R P
Sbjct: 392 VLFSGLGADELYGGYHKFVNK-TPRELVEELTRQINNIHDRNLNRDDKVIANNGVEVRYP 450

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRK 455
           FLD+  ++   +         P   +I K ILRK
Sbjct: 451 FLDEHVIKYSTH-------DIPINYKINKLILRK 477

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 55/133 (41%), Gaps = 25/133 (18%)

Query: 22  QLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQPITS----ADGEYMLGVNGEI 77
            L K I  RGP+++    +      H       + S  +P        +  Y+L  NGE+
Sbjct: 43  NLMKLISARGPNFASLRTLKD----HRISLFSSVLSLREPFCKQSVLVEDRYVLQFNGEL 98

Query: 78  YNHIQLREMCSDYKFQTFSDCEPIIPLYLEHD------IDAPKYLDGMFAFCLYDSKKDR 131
           YN   +            +D + I+ L L  +      I   K LDG FAF +YD K  R
Sbjct: 99  YNDEIIH-----------NDTQFIVKLLLNTEQNSKGIISVIKNLDGEFAFSIYDLKNKR 147

Query: 132 IVAARDPIGVVTL 144
           +   RDPIG  +L
Sbjct: 148 LYFGRDPIGKRSL 160

>Ecym_8155 Chr8 complement(324050..325591) [1542 bp, 513 aa] {ON}
           similar to Ashbya gossypii ADL350C
          Length = 513

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 353 RKIKAQGVKMVL-SGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKST 411
           + I  Q   +VL SG G+DE++GGY  F    S      E  +++ N++  +  R +K  
Sbjct: 376 KTISYQRRSLVLFSGLGADELYGGYHKFNNK-SPELLIKELTKQINNIYDRNLDRDDKCM 434

Query: 412 MAWGLEARVPFLDKDFLQLCMNIDPNEKMIK 442
              G+E R PFLD++ + L  ++  N K  K
Sbjct: 435 ACNGIEIRYPFLDEEVINLSTSLPINYKTNK 465

>KLTH0E16412g Chr5 complement(1455298..1456845) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q04489 Saccharomyces cerevisiae
           YML096W Hypothetical ORF
          Length = 515

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 9/95 (9%)

Query: 362 MVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTMAWGLEARVP 421
           ++ SG G+DE++GGY  F++  +  E   E   ++ N++  +  R +K   + G+E R P
Sbjct: 389 VLFSGLGADELYGGYHKFSKRAN-EELVPELEVQINNIYDRNLNRDDKVISSNGVEIRYP 447

Query: 422 FLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKA 456
           FLD   +     +        P   ++ K ILRK 
Sbjct: 448 FLDDQVVAFSTQL--------PINYKVNKMILRKV 474

>CAGL0H06963g Chr8 (689948..691501) [1554 bp, 517 aa] {ON} similar
           to uniprot|Q04489 Saccharomyces cerevisiae YML096w
          Length = 517

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 2/78 (2%)

Query: 353 RKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANKSTM 412
           ++ K +G+ ++ SG G+DE++GGY Y        E   E   ++ N++  +  R +K   
Sbjct: 384 KEYKRKGL-VLFSGLGADELYGGY-YKLSNKHEDELANELTTQINNIYRRNLNRDDKVIA 441

Query: 413 AWGLEARVPFLDKDFLQL 430
           + G+E R PFL ++ ++ 
Sbjct: 442 SNGVEVRYPFLAEEVVEF 459

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 61/131 (46%), Gaps = 22/131 (16%)

Query: 23  LSKKIRHRGPDWSGNAVMN--STIFVHERLAIVGLDSGAQPITSAD----GEYMLGVNGE 76
           + K +R RGP++     +   ++I++   L++       QP T        +Y+L  NGE
Sbjct: 39  IVKLVRCRGPNYCSMRQIKDVNSIWISSVLSL------RQPFTKQSIVIGNKYVLQFNGE 92

Query: 77  IYNHIQLREMCSDYKFQT--FSDCEPIIPLYLEHDI-DAPKYLDGMFAFCLYDSKKDRIV 133
           +YN  ++ E  +D +F +     C        E DI +    LDG FAF + D + + I 
Sbjct: 93  LYND-EIIESGNDTQFLSGLLKKCIS------EDDIFNILHGLDGEFAFTIQDLENNLIY 145

Query: 134 AARDPIGVVTL 144
             RD IG  +L
Sbjct: 146 FGRDTIGKRSL 156

>Kpol_1044.19 s1044
           (41869..43164,43214..43222,43438..43626,43630..43635,
           43639..43692,43696..44220) [2079 bp, 692 aa] {ON}
           (41869..43164,43214..43222,43438..43626,43630..43635,
           43639..43692,43696..44220) [2079 nt, 693 aa]
          Length = 692

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 38/82 (46%), Gaps = 9/82 (10%)

Query: 434 IDPNEKMIKPKEGRIEKYIL---RKAFDTTDEPDVKPYLPEEILWRQKEQFSDGVGYSWI 490
           ++ NE  +KP    I KYI+   +K   T     V   LPE + WR   +  D V   +I
Sbjct: 324 LEKNEVSVKPY-NEIWKYIVNEAKKMIATNQNDKVTFLLPETVSWRIVNEIKDIVNCKFI 382

Query: 491 D----GLRDTA-ERAISDAMFA 507
           +    GL+    ER I +AM A
Sbjct: 383 ESPIQGLKSIKNEREIENAMIA 404

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,690,880
Number of extensions: 2454711
Number of successful extensions: 5385
Number of sequences better than 10.0: 47
Number of HSP's gapped: 5445
Number of HSP's successfully gapped: 62
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)