Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YGL243W (TAD1)3.566ON40040021320.0
Smik_7.183.566ON38538515950.0
Skud_7.243.566ON39139015630.0
Suva_7.183.566ON38538514230.0
Kpol_380.73.566ON3853889821e-131
ZYRO0E09504g3.566ON3773809631e-128
KAFR0J028703.566ON3843839311e-123
TDEL0D063403.566ON4023879301e-123
NDAI0I032303.566ON3863879211e-121
NCAS0E002703.566ON3883879201e-121
SAKL0F00836g3.566ON3833868951e-118
TPHA0G036403.566ON3964008731e-114
Kwal_47.192633.566ON3833838301e-108
TBLA0E002303.566ON3943938221e-106
KNAG0I002403.566ON3913868211e-106
KLTH0G00748g3.566ON3853908181e-106
Ecym_25963.566ON3873908001e-103
CAGL0H07733g3.566ON3853917941e-102
KLLA0A00759g3.566ON3803847697e-99
AFR267W3.566ON3853837272e-92
Smik_1.108singletonON61621101e-06
CAGL0I00968g5.634ON997160830.11
YDR173C (ARG82)8.371ON355190722.2
Skud_2.1983.297ON354190694.1
ZYRO0A06226g8.730ON37780686.2
Suva_7.3603.134ON20044667.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YGL243W
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   825   0.0  
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   619   0.0  
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   606   0.0  
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   552   0.0  
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   382   e-131
ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   375   e-128
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   363   e-123
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   362   e-123
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   359   e-121
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   358   e-121
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   349   e-118
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   340   e-114
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   324   e-108
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   321   e-106
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   320   e-106
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   319   e-106
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   312   e-103
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   310   e-102
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   300   7e-99
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   284   2e-92
Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 b...    47   1e-06
CAGL0I00968g Chr9 (78375..81368) [2994 bp, 997 aa] {ON} similar ...    37   0.11 
YDR173C Chr4 complement(810565..811632) [1068 bp, 355 aa] {ON}  ...    32   2.2  
Skud_2.198 Chr2 (358218..359282) [1065 bp, 354 aa] {ON} YBR076W ...    31   4.1  
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    31   6.2  
Suva_7.360 Chr7 complement(616179..616781) [603 bp, 200 aa] {ON}...    30   7.9  

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  825 bits (2132), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/400 (100%), Positives = 400/400 (100%)

Query: 1   MVSCQGTRPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGV 60
           MVSCQGTRPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGV
Sbjct: 1   MVSCQGTRPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGV 60

Query: 61  AAINRDGGANKIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQN 120
           AAINRDGGANKIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQN
Sbjct: 61  AAINRDGGANKIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQN 120

Query: 121 YNPSSGDKFIQHNDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDS 180
           YNPSSGDKFIQHNDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDS
Sbjct: 121 YNPSSGDKFIQHNDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDS 180

Query: 181 DEFQYVDRSVKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLN 240
           DEFQYVDRSVKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLN
Sbjct: 181 DEFQYVDRSVKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLN 240

Query: 241 YELFEKPVFLKYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDV 300
           YELFEKPVFLKYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDV
Sbjct: 241 YELFEKPVFLKYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDV 300

Query: 301 PGLMCSVKLFMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEY 360
           PGLMCSVKLFMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEY
Sbjct: 301 PGLMCSVKLFMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEY 360

Query: 361 EGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDVK 400
           EGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDVK
Sbjct: 361 EGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDVK 400

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/385 (76%), Positives = 337/385 (87%), Gaps = 1/385 (0%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76
           M SED+LG+ ISTRVINEYSKLK  CRP+ RP+G++EWT+LAG+ AINR    N I++LS
Sbjct: 1   MLSEDELGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLS 60

Query: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136
           +ATGVKA+PDSEL+RS GKILHDCHAEILALRG NTVLLN I+ YNP++G  FIQ NDE 
Sbjct: 61  MATGVKAMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIKEYNPANGSDFIQSNDET 120

Query: 137 PARFNLKENWELALYISRLPCGDASMSFLNDNCKND-DFIKIEDSDEFQYVDRSVKTILR 195
           P RF LK+NWELALYIS+LPCGDAS+ FLNDNCKND DF KIED DEFQYV+ SVKTILR
Sbjct: 121 PPRFKLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILR 180

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           G LNFNR+NVVRTKPGRYDSNITLSKSCSDKLLMK+ SS+LN LNYELF +PVFLKY+VI
Sbjct: 181 GNLNFNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVI 240

Query: 256 PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFS 315
           P LE+E KH L+QSFH RLPN ++E  F++C   FYDDK  EEDVP LMCS+KLFM+D +
Sbjct: 241 PGLENEVKHVLKQSFHDRLPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMNDHT 300

Query: 316 TEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375
            EEAILNGV+NGFYTKSSKPLRKHCQS VSRFAQWELFK+IRPEYEG+SYL+FKS QK+R
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360

Query: 376 SQLIIAIKNILSPDGWIPTRTDDVK 400
           ++LIIAIK+ILSPDGWIPT+ DDV+
Sbjct: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/390 (72%), Positives = 340/390 (87%), Gaps = 1/390 (0%)

Query: 11  IVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGAN 70
           +  LL M S+++L EEIS +VI EYSKLKS C+P  RP+GI+EWTILAGV  INR GGAN
Sbjct: 1   MAKLLIMSSKNELAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGAN 60

Query: 71  KIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFI 130
            +E+LS+ATGVKALPDSELQRS GK+LHDCHAEILALRGANTVLL  I++Y+P++G  FI
Sbjct: 61  NVEVLSVATGVKALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIKDYDPANGSDFI 120

Query: 131 QHNDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKN-DDFIKIEDSDEFQYVDRS 189
           + N+EIP RFNLK++WELALYISRLPCGDASM FLND+CKN +DFIKIED+D FQYVD  
Sbjct: 121 ESNNEIPIRFNLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPK 180

Query: 190 VKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVF 249
           VKTILRGRLNF++++VVRTKPGRYDSNITLSKSCSDKL MKQ SS+LN LNYELFE+PV+
Sbjct: 181 VKTILRGRLNFHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVY 240

Query: 250 LKYIVIPNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKL 309
           LKYIVIP++ED+TKH LE+SFH RLP   ++++FLNC  PFYDD+ DE D+P  MCS+KL
Sbjct: 241 LKYIVIPDIEDKTKHILERSFHNRLPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKL 300

Query: 310 FMDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFK 369
           F++D STEEAI NG++NGFYTKSSKPLRKHCQSQVSRFAQWELF++IRP+++ +SYL FK
Sbjct: 301 FVNDSSTEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFK 360

Query: 370 SRQKKRSQLIIAIKNILSPDGWIPTRTDDV 399
           S+QK+R++LI   KN LSPDGWI TR DDV
Sbjct: 361 SQQKERNRLITTAKNALSPDGWISTRIDDV 390

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/385 (70%), Positives = 324/385 (84%), Gaps = 1/385 (0%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76
           MP++D+L E+IST+VI EYSKLK+ CRP+ RPSGIREWTILAGVAAINR+  A+ I++LS
Sbjct: 1   MPTKDELAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLS 60

Query: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136
           IATGVK+LPDSELQRS GK+LHDCHAEILALRGANTV LN I++++ ++GD  I+ N+EI
Sbjct: 61  IATGVKSLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIKDWDLTNGDDLIESNNEI 120

Query: 137 PARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSD-EFQYVDRSVKTILR 195
           P +F LK+ WELALYIS+LPCGDASM FLNDNC++DD     D D  FQYVD  VKTILR
Sbjct: 121 PPKFRLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILR 180

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GRLNF +++VVRTKPGRYDSNITLSKSCSDKLLM+Q SS+LN LN  LF +PVFL+YIVI
Sbjct: 181 GRLNFGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVI 240

Query: 256 PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFS 315
           PNL+++T+H LEQSFH RLP   +  +FLNC  PFYDDK DE  VP LMCS KLFM+D +
Sbjct: 241 PNLDEKTRHTLEQSFHNRLPFCSHRFEFLNCHTPFYDDKKDENSVPSLMCSTKLFMNDST 300

Query: 316 TEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375
            EEAILNG++NGFYTK  KPLRKHC+S +SRFAQWELF +I+PEY+  SYL+FK++Q +R
Sbjct: 301 VEEAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTER 360

Query: 376 SQLIIAIKNILSPDGWIPTRTDDVK 400
           +QLI  IK  LSPDGWIPT+TDDVK
Sbjct: 361 NQLITLIKGALSPDGWIPTKTDDVK 385

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  382 bits (982), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 193/388 (49%), Positives = 271/388 (69%), Gaps = 16/388 (4%)

Query: 20  EDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIAT 79
           E  LG++IS  +  EYSKLKS+ +P  R + ++EWT+LA + AI+ D   N+I  ++I+T
Sbjct: 3   EKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISND--ENEIIPITIST 60

Query: 80  GVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPAR 139
           GVKA P+ EL+RS GKILHDCH+EIL+LR  NT LL  +Q  +     KFI     +PA+
Sbjct: 61  GVKATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFI-----LPAK 115

Query: 140 ----FNLKENWELALYISRLPCGDASMSFLNDNCK-NDDFIKIEDSDEFQYVDRSVKTIL 194
               +N  EN+++ALYIS+LPCGDASM  LN++ + N+    IED+D +Q++D  +KT++
Sbjct: 116 ADGKYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVI 175

Query: 195 RGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIV 254
           RGRLN++++NVVRTKPGRYDSN+TLSKSCSDKL MKQ  S+LN LN++LFE P+FL Y++
Sbjct: 176 RGRLNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVI 235

Query: 255 IPNLEDETKHHLEQSFHTRLPNLDNEI---KFLNCLKPFYDDKLDEEDVPGLMCSVKLFM 311
           IP L+DE    L + F  RL  +   I    FL C++ F DDK + +  P L+ S+K+ +
Sbjct: 236 IPTLKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILL 295

Query: 312 D-DFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKS 370
             +   E++I+NGVRNG YTK +KPL+K+CQS +S+++QW+LFK ++ E    SY+E+K 
Sbjct: 296 PREHQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKK 355

Query: 371 RQKKRSQLIIAIKNILSPDGWIPTRTDD 398
            Q  R  L   IK+ LSPDGWI T  DD
Sbjct: 356 SQTLREDLKDIIKSKLSPDGWISTFQDD 383

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 264/380 (69%), Gaps = 14/380 (3%)

Query: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82
           LG  I+ +V+  Y KL S+C+P  R +G++EWT+LAG+ AI++    + + ++SIATGVK
Sbjct: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63

Query: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDK--FIQHNDEIPARF 140
           ALPD+ L RS GK++HDCHAEILALR  N V+L++I   N +S ++   ++   E    F
Sbjct: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE-DQLF 122

Query: 141 NLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNF 200
           + K+NWELA+YIS LPCGDASM  L   C+++  I+++D D  Q+VD +V +I+RGR N+
Sbjct: 123 HFKDNWELAIYISTLPCGDASMDLL---CQDESIIEMQDDDPIQFVDPAVTSIVRGRFNY 179

Query: 201 NRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLED 260
           +RR VVRTKPGR+DS ITL KSCSDKL  +Q  S+LNC+ ++L  KPV+LKY+V PN  D
Sbjct: 180 SRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTD 239

Query: 261 ETKHHLEQSFHTRLPNLDN-EIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFST-EE 318
                L QSF+ R+  L N  +K L C   F  DK   E+ P  M S+KL+    ST E+
Sbjct: 240 ----LLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQ 295

Query: 319 AILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKRSQL 378
           A+LNG++NGFYTK +KPLR++C+  VSR+AQW+LFK +RPE+   +YL+FK+  + R+ L
Sbjct: 296 ALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNAL 355

Query: 379 IIAIKNILSPDGWIPTRTDD 398
           I   + +LSP GWI T  DD
Sbjct: 356 IQDCRKLLSPKGWISTSRDD 375

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  363 bits (931), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 185/383 (48%), Positives = 255/383 (66%), Gaps = 8/383 (2%)

Query: 21  DKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATG 80
           D LG+EI+  V  EY +LK++ +P+ R +G +EWT+LA V AIN +     +++++I+TG
Sbjct: 3   DSLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAISTG 62

Query: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARF 140
           VKA+P++ L RS G+ILHDCHAEILALRG N VLL  +Q+   +    F+  + +   +F
Sbjct: 63  VKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSSFLDKSAQ-GGKF 121

Query: 141 NLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNF 200
             K  W+LALY+SRLPCGDASM  L D  + D  I++ + D  QY+D     ILRGR+NF
Sbjct: 122 RWKSKWKLALYVSRLPCGDASMDHLEDASELD--IEMSEDDRLQYIDPGKSKILRGRMNF 179

Query: 201 NRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLED 260
            R+  VRTKPGR DS+ITLSKSCSDKL +KQ +S LN L +EL E PV+LKY+VIP L D
Sbjct: 180 KRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPELND 239

Query: 261 ETKHHLEQSFHTRLP---NLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLF-MDDFST 316
             K  L + FHTRL    +L +  +FL     F DDK  +  +P     +K+F   + + 
Sbjct: 240 TDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEHTI 299

Query: 317 EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYE-GISYLEFKSRQKKR 375
           E+AILNGV+NGFYTK  KPLR+ C+S +SR++QW L+K ++ + E G+SYL+FK+ Q++R
Sbjct: 300 EQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQEQR 359

Query: 376 SQLIIAIKNILSPDGWIPTRTDD 398
             L+   K  LS   WI T  DD
Sbjct: 360 RDLVENAKICLSHGSWIATLKDD 382

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  362 bits (930), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/387 (49%), Positives = 263/387 (67%), Gaps = 10/387 (2%)

Query: 21  DKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATG 80
           D+LG+ I+    +EY KL SAC+P+IR +G +EWT+L+G+ AI+      K+ ++SI TG
Sbjct: 8   DRLGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTG 67

Query: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARF 140
           VKALPD+ L+RS G+++HDCHAEILALRG NTVLL  + NY  +         +   A  
Sbjct: 68  VKALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHM-NYMVTEQCGETDLIERTTAGV 126

Query: 141 N-LKENWELALYISRLPCGDASM----SFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILR 195
             LK  W+LALYIS LPCGDASM    ++ N +      +  E++ E Q++D+ +++ILR
Sbjct: 127 CILKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILR 186

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GR N++R  VVRTKPGRYDS IT SKSCSDKL +KQ +S+LN L + L  +PVFL Y+VI
Sbjct: 187 GRFNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVI 246

Query: 256 PNLEDETKHHLEQSFHTRLPNL-DNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMD-- 312
           PNL  +    +  SF  RL  L    ++ L C  PF+D+K  + + P  M SVKLF+D  
Sbjct: 247 PNLAVDRCQGVHHSFQDRLGRLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDLP 306

Query: 313 -DFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSR 371
               TE+AILNG++NGFYTK +KPLRK+C+S VSR AQW+++  IRP+ +  +YLEFK+ 
Sbjct: 307 ERKCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKAG 366

Query: 372 QKKRSQLIIAIKNILSPDGWIPTRTDD 398
             +R+++I  +K +LSPDGWI TR DD
Sbjct: 367 LSERNRIIQEVKKVLSPDGWISTRNDD 393

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  359 bits (921), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 181/387 (46%), Positives = 261/387 (67%), Gaps = 9/387 (2%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76
           M  E +L + I+  +  +Y  LKS+ +P+ R +GI+EWT+ AG+ AIN D   N + ++S
Sbjct: 1   MAQEHQLADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTD--TNDLRVIS 58

Query: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRI-QNYNPSSGDKFIQHNDE 135
           +ATGVKALP+ EL+RS GK+LHD HAEI+ALRG NTV+L +I Q  N    D  I   D 
Sbjct: 59  LATGVKALPNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEETDLVIHSKDS 118

Query: 136 IPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILR 195
               ++ K N ++ALYIS+LPCGD SM  L +     + + I+D D  QY+++  KTILR
Sbjct: 119 --EYYSFKSNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILR 176

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GRLNFN++  VRTKPGR DS +T SKSCSDKL MKQ +S+LNCL ++L E+PV+L Y+++
Sbjct: 177 GRLNFNKKGYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIV 236

Query: 256 PNLEDETKHHLEQSFHT---RLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMD 312
           P +  E K  ++  F+    R     +E+ +L+  K F D +   +  P  + ++K+F+ 
Sbjct: 237 PGMTTEMKEDIDLCFNKQFERCVGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIG 296

Query: 313 DF-STEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSR 371
              S E+ ILNGV+NG YTK +KPLRK+C++ VSRF+QW++FK+I P+Y  +SYL+FK  
Sbjct: 297 QGNSIEQTILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQS 356

Query: 372 QKKRSQLIIAIKNILSPDGWIPTRTDD 398
           Q +R +LI   ++ +SPDGWI T+ DD
Sbjct: 357 QHERRKLIDYTRSKMSPDGWISTQEDD 383

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  358 bits (920), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 188/387 (48%), Positives = 258/387 (66%), Gaps = 7/387 (1%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76
           M  E  L + ++  V  EY+KLK + +P++R +G++EWT+LA    ++ + G   ++++S
Sbjct: 1   MGGEVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTG--NLKMIS 58

Query: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136
           ++TGVKALPD EL RS GK++HDCHAEILALRG NTVLL  I N N +     +    + 
Sbjct: 59  LSTGVKALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNLRQSDLLEISDA 118

Query: 137 PARFNLKENWELALYISRLPCGDASM-SFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILR 195
             +++L+  W+L LYISRLPCGDASM +  N +  +     I+DSDEFQY+D ++ TILR
Sbjct: 119 NGKYHLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILR 178

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GRLNF+R  VVRTKPGR DS  TLSKSCSDKL ++Q +S+LNC+ + L + PVF+ Y++I
Sbjct: 179 GRLNFSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLI 238

Query: 256 PNLEDETKHHLEQSFHTRLPNLD---NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMD 312
           P L  + K+ L  SF  RL         +K+L     F +DK    + P  M S+KLF+ 
Sbjct: 239 PQLNYDNKNDLLLSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLT 298

Query: 313 DFST-EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSR 371
              T EEA+LNGV+NG YTK +KPLRK+C+S VSR+AQW ++K+I P Y   SYLEFK  
Sbjct: 299 QGETIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRS 358

Query: 372 QKKRSQLIIAIKNILSPDGWIPTRTDD 398
           Q  R +LI     ILS +GW+PT+ DD
Sbjct: 359 QTARLELIKYTNEILSSEGWLPTQPDD 385

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  349 bits (895), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 185/386 (47%), Positives = 262/386 (67%), Gaps = 11/386 (2%)

Query: 19  SEDKLGEEISTRVINE-YSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSI 77
           S ++  E+ S+++INE Y++LK  C+P +R +GI+EWT+LAG+ AIN     N + ++S+
Sbjct: 2   SYEEFVEQGSSKLINEAYARLKPICKPTVRSNGIKEWTVLAGIIAINER--KNTMRLVSL 59

Query: 78  ATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIP 137
            TGVKA P+ EL+RS+GKI+HDCHAEILALRG NTVLL ++        ++       + 
Sbjct: 60  GTGVKATPNEELKRSKGKIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVD 119

Query: 138 A-RFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRG 196
              F + ++W  ALYIS+LPCGD+SM  L +   N     IE++D  QY++++  T+LRG
Sbjct: 120 GLSFKVPDHWSFALYISKLPCGDSSMDTLEEEDLNS--FNIENTDACQYLEQNNHTLLRG 177

Query: 197 RLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIP 256
           R N+ ++  VRTKPGR DS ITLSKSCSDKL ++Q +S+LN +N+ELF+ P++LKYI+IP
Sbjct: 178 RFNYQKKGFVRTKPGRKDSKITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIP 237

Query: 257 NLEDETKHHLEQSFHTRLPNLD--NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDF 314
           NL++     LE+SF  RL N    N ++FL+  + F DDK+ ++  P  M S+ L + + 
Sbjct: 238 NLDEHALVGLERSFE-RLCNHPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHNN 296

Query: 315 STE--EAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQ 372
             E  EAILNGV+NGFY K+ KPLRK+C+S VSR +QW+L+  I    E  +YL+FKS Q
Sbjct: 297 GEEFQEAILNGVKNGFYVKNKKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKSTQ 356

Query: 373 KKRSQLIIAIKNILSPDGWIPTRTDD 398
            +R+ L    K  LSPDGWIPT  DD
Sbjct: 357 VERNILKNEAKLCLSPDGWIPTGVDD 382

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  340 bits (873), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/400 (47%), Positives = 263/400 (65%), Gaps = 36/400 (9%)

Query: 19  SEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIA 78
           S++ + E++S  V  EYSKL+ + +P+I+ + + EWT+LAG+ AIN + G  + E ++I 
Sbjct: 12  SDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETG--EFETIAIT 69

Query: 79  TGVKALPDSELQRSEGKILHDCHAEILALRGANTVLL---NRIQNYNPSSGDKFIQHNDE 135
           TGVKA PD++L RS+GKI+HDCHAEILALR  N  LL   NRI N++ +S  KF+Q    
Sbjct: 70  TGVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRISNHDGTS--KFVQVTKT 127

Query: 136 IPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEF--------QYVD 187
               +N K  W+LALYIS+LPCGDASM         DD +K+ D+ EF        QY+D
Sbjct: 128 NSYEWNKK--WDLALYISKLPCGDASM---------DDLMKVGDTAEFEITDDNPLQYID 176

Query: 188 RSVKTILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKP 247
              KT +RGRLN+ +R+V+RTKPGRYDS ITLSKSC+DKL MKQ   +L+     L + P
Sbjct: 177 PKNKTTIRGRLNYKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDP 236

Query: 248 VFLKYIVIPNLEDETKHHLEQSFHTRLPNLD---NEIKFLNCLKPFYDDKLDEEDV--PG 302
           +FL+YI+IP +  + +  L+ +F  RL   +    E KF++C   F DD  D   V  P 
Sbjct: 237 IFLQYIIIPRISGK-ESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPA 295

Query: 303 LMCSVKLFMDDFST-EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKI---RP 358
           L+ S+K+FMD+    E++I+NGV+NGFY+K  KPLRK+C+  +SR+++W L K+I   R 
Sbjct: 296 LVNSIKIFMDNNRVMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRA 355

Query: 359 EYEGISYLEFKSRQKKRSQLIIAIKNILSPDGWIPTRTDD 398
           E   +SYLEFKS   KR  L   ++++LSPDGWI T+ DD
Sbjct: 356 ELLNVSYLEFKSTLTKRMTLQQEVRSLLSPDGWITTKKDD 395

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  324 bits (830), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 170/383 (44%), Positives = 244/383 (63%), Gaps = 15/383 (3%)

Query: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82
           L ++IS    + Y KLK + +P+IR +G++EW +LA V AI  D G   + ++S+ATGVK
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGPDQG---LRLVSLATGVK 63

Query: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQN-YNPSSG--DKFIQHNDEIPAR 139
           + P+ EL+RS G+ILHDCHAEILALRG N VLL +IQ   +P +      +  + +   +
Sbjct: 64  STPNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGK 123

Query: 140 FNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLN 199
           F L ++W  ALYISR+PCGDASM  L    +++  ++  +    QYV+   +TILRGR N
Sbjct: 124 FKLGDDWSFALYISRIPCGDASMDLL----QSESDMEFSEDTSCQYVNPCNRTILRGRFN 179

Query: 200 FNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLE 259
           +N+R  VRTKPGR DS++TLSKSCSDKL  +Q  S+LN + ++L E P+FLKYIV+P + 
Sbjct: 180 YNKRGYVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVS 239

Query: 260 DETKHHLEQSFHTRL---PNLDNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFST 316
           +  +   E +F  RL   P +   ++ L C K F DDK +   VP  +  + L  +D   
Sbjct: 240 NTARRGFESAFKDRLREFPGI-KSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQP 298

Query: 317 E-EAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375
           E ++ILNGV++G Y +  KPLRK+C++ +SR AQW LFKK++   +  SY  FK  Q  R
Sbjct: 299 EQQSILNGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVAR 358

Query: 376 SQLIIAIKNILSPDGWIPTRTDD 398
           + L   +++ LS DGWI T  DD
Sbjct: 359 NVLKNKVRSSLSSDGWISTGPDD 381

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  321 bits (822), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 258/393 (65%), Gaps = 19/393 (4%)

Query: 22  KLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAI-NRDGGANKIEILSIATG 80
           +LG++I+  +  EY+KLK + +PI + +GI+EWTI++G+ A+ N+D   N I+++S+ATG
Sbjct: 5   ELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKD--TNIIKVISLATG 62

Query: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNY---NPSSGDKFIQHNDEIP 137
           VKA PDSEL+RS+G I+HDCHAEILA+RG NT LL  I+N    + +S D   +  +   
Sbjct: 63  VKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENSKC 122

Query: 138 ARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGR 197
            +++  + ++L LYIS+LPCGD+SM   N + +++  I+ +++D  QYVD +++TILRGR
Sbjct: 123 KKYSWNDEYDLGLYISKLPCGDSSMEEEN-SLESNSLIQFQENDLTQYVDPTIRTILRGR 181

Query: 198 LNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPN 257
           +N+N+   VRTKPGR DS IT SKSCSDK+ +KQ  S+LN LN EL E P+++KY+V P+
Sbjct: 182 INYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCPD 241

Query: 258 LEDETKHHLEQSFHTRLPNLDNEI---------KFLNCLKPFYDDKLDEEDVPGLMCSVK 308
           ++ +    L++SF+ R+ N+  E+          F+     F D K ++   P     VK
Sbjct: 242 IKPQNLILLKKSFN-RIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300

Query: 309 LF--MDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYL 366
           +F   D F  E++I+NGV+ G YTK SKPL K+  + VSR  QW +FK I PE+E  SYL
Sbjct: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360

Query: 367 EFKSRQKKRSQLIIAIKNILSPDGWIPTRTDDV 399
            FK  Q  R +    I+  LS DGWI T  DD+
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDDI 393

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  320 bits (821), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 165/386 (42%), Positives = 253/386 (65%), Gaps = 9/386 (2%)

Query: 21  DKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATG 80
           D LG EI+  V +EY +L ++ +P +R +G +EWTIL+G+ A+    G  ++ ++S+ TG
Sbjct: 3   DLLGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGP-QLRLISLTTG 61

Query: 81  VKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARF 140
           VKA P+ +L+RS+G++LHDCHAEILALRG N VLL ++Q    +     I    +   +F
Sbjct: 62  VKATPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNNDRCDLILPGIQDTNKF 121

Query: 141 NLKENWELALYISRLPCGDASMSFLNDNCK-NDDFIKIEDSDEFQYVDRSVKTILRGRLN 199
            L   ++LAL+ISRLPCGD SM+ L +      D   I+D D  QY+D + +++LRGR N
Sbjct: 122 RLNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFN 181

Query: 200 FNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLE 259
           + ++  VRTKPGR DS IT SKSCSDKL   Q +S+LN   + L E+ V++ Y+++PN+ 
Sbjct: 182 YAKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNIS 241

Query: 260 DETKHHLEQSFHTRLPNLD---NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFST 316
              ++ LE+ F TRL +     ++++ L+C + F DD+ DE++ P  +  VKL++ +  T
Sbjct: 242 ASDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGET 301

Query: 317 -EEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEG--ISYLEFKSRQK 373
            E+A+L+G+RNGF+TK SKPLR +C++ VSR +QW LF  + PE      SY +FKS+  
Sbjct: 302 LEQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLV 361

Query: 374 KRSQLIIAIKNILS-PDGWIPTRTDD 398
            R++LI   +++L+    WIPT +DD
Sbjct: 362 PRAELITRTRSLLTNGQPWIPTCSDD 387

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  319 bits (818), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 174/390 (44%), Positives = 244/390 (62%), Gaps = 15/390 (3%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANK-IEIL 75
           M   +++ ++I+      Y KLK + +P +R +G +EW +LA V AINR   AN+ + ++
Sbjct: 1   MEVNEEVADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINR---ANEDLRLV 57

Query: 76  SIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGD---KFIQH 132
           S+ATGVKA P+ +L+RS G+ILHDCHAEILALRG N VLL +IQ    S        +  
Sbjct: 58  SLATGVKAAPNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSS 117

Query: 133 NDEIPARFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKT 192
           + +    + L E W  ALYISR PCGDASM  L D    +  I   D D  QYVD + KT
Sbjct: 118 SSDNSGIYRLNEEWSFALYISRAPCGDASMGLLYD----EGCISFTDDDRCQYVDDNNKT 173

Query: 193 ILRGRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKY 252
           I+RGR N+ ++  VRTKPGR DS +TLSKSC+DKL  KQ  S+LN L ++L E PVFL+Y
Sbjct: 174 IIRGRFNYAKKGYVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEY 233

Query: 253 IVIPNLEDETKHHLEQSFHTRLPNL--DNEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLF 310
           IVIP L    +   E++F TR+ +     +++ L+C + F DDK  E   P LM S+ L 
Sbjct: 234 IVIPQLPRVAEADFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLN 293

Query: 311 M--DDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEF 368
           +     + +++ILNGV+ G + K   PL+K+C++ VSR +QW LFK+I+   +  +Y EF
Sbjct: 294 IIEGQVTQQQSILNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREF 353

Query: 369 KSRQKKRSQLIIAIKNILSPDGWIPTRTDD 398
           KS+Q  R+ L   I+  LS DGW+ T +DD
Sbjct: 354 KSQQTDRNALKERIRLALSKDGWVGTESDD 383

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  312 bits (800), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/390 (44%), Positives = 247/390 (63%), Gaps = 26/390 (6%)

Query: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82
           L E +S  VI +Y  LK + +P I+ +GI+EWT+LAG+ AI  D   N++ ++S+ATGVK
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAI--DENTNELRLISVATGVK 65

Query: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQ--NYNPSSGDKFIQH-NDEIPAR 139
           ALP+ EL+RS G++LHD HAEILALR  N VLL ++     NP+     ++  N   P R
Sbjct: 66  ALPNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYR 125

Query: 140 FNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLN 199
             +++ W++ALYISR PCGD SM  L ++  + ++++    D  QY++  ++T LRGR N
Sbjct: 126 --MRKRWKIALYISRPPCGDCSMDILGED--DTNYMQFSFDDCCQYINPGIRTTLRGRFN 181

Query: 200 FNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLE 259
           ++ + V RTKPGR DS ITLSKSCSDKL  KQ  S+LN  N++L E PVFL Y+V+P   
Sbjct: 182 YDCKGVTRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLP--- 238

Query: 260 DETKHHLEQS-------FHTRLPNLD--NEIKFLNCLKPFYDDKLDEEDVPGLMCSVKLF 310
              +HH E++       FH RL  L+  + I+ + C K F  DK +E   P  +  V + 
Sbjct: 239 ---QHHREKASDGCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYIN 295

Query: 311 MD--DFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEF 368
           +   +   EE ILNGV NGFY K+++PLRK+C+S +SR + W LF ++       SYL+F
Sbjct: 296 IKPMEMDIEEGILNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDF 355

Query: 369 KSRQKKRSQLIIAIKNILSPDGWIPTRTDD 398
           KS+Q  R+QL   ++  LS DGWIPT  DD
Sbjct: 356 KSKQTSRNQLKEQVRLHLSSDGWIPTSADD 385

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  310 bits (794), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 177/391 (45%), Positives = 244/391 (62%), Gaps = 15/391 (3%)

Query: 17  MPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILS 76
           M   D  G +I+  V++EY KL +  RP+ R +G +E TI+A V A   D   +K  IL+
Sbjct: 1   MSFRDDYGTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIA--SDTRTDKHSILT 58

Query: 77  IATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEI 136
           I TGVK+ P+ EL RS+GKILHDCHAEILALRG N +LL  I+          I HN   
Sbjct: 59  ITTGVKSTPNDELARSKGKILHDCHAEILALRGFNRLLLEHIKRSMEGIESNLI-HN--T 115

Query: 137 PARFNLKENWELALYISRLPCGDASMSFLND-NCKNDDFIKIEDSDEFQYVDRSVKTILR 195
           P  F      EL L+IS+LPCG+ SMS L +  C++++ +  E+ D  QY+   +KTILR
Sbjct: 116 PNGFEWNNELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILR 175

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GR NFN+RN VRTKPGR DS  T SKSCSDKL ++ ++SVLN L   +   P+++   VI
Sbjct: 176 GRCNFNKRNYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVI 235

Query: 256 PNLEDETKHHLEQS--FHTRLPNLDNEIKFLNCLKPFY--DDKLDEEDVPGLMCSVK-LF 310
           PN+     H +E+   +  R  +L +  + L      Y   D L  E  P  M ++K LF
Sbjct: 236 PNI---NSHQIEEMNLYFNRPMDLHSSARRLYIHTSHYKFGDDLSPETPPSSMSALKILF 292

Query: 311 MDDFSTEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKS 370
            D+   EE ILNGV+NG+YTK+SKPLRK+C+S+VSR++ W LF  +  E++ ++YLEFK 
Sbjct: 293 NDNDIQEEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKR 352

Query: 371 RQ-KKRSQLIIAIKNILSPDGWIPTRTDDVK 400
           R   +R++LI +IK+ LS DGW+ T  DD +
Sbjct: 353 RYCAERAELIRSIKSSLSSDGWLSTAEDDCQ 383

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  300 bits (769), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 166/384 (43%), Positives = 224/384 (58%), Gaps = 17/384 (4%)

Query: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82
           + + I+  VI+ Y KL  + +P IR +G+ EWT+L+G+ A   D   ++ E +S+ TGVK
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAF--DELNDRYEPISLGTGVK 61

Query: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARFNL 142
           A P+ ELQRS G+I+HDCHAE++ LR  N +LL  I +         I+ + +    + +
Sbjct: 62  ATPNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKSFLIEKSAD---GYKV 118

Query: 143 KENWELALYISRLPCGDASMSFLN-------DNCKNDDFIKIEDSDEFQYVDRSVKTILR 195
           K+ W+ A+YISR+PCGDASM+ L        +NC+    I I      QYV   + TI+R
Sbjct: 119 KDVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFING----QYVHPEIDTIIR 174

Query: 196 GRLNFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           GR N+  R VVRTKPGR DS ITLSKSCSDKL MKQ  S+ N L + L + PV+L++IV+
Sbjct: 175 GRANYKLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVL 234

Query: 256 PNLEDETKHHLEQSFHTRLPNLDN-EIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDF 314
           P      +  LE +F  RL N      KFL C + F  D+ +    P L   V L+  + 
Sbjct: 235 PKQYQYEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNE 294

Query: 315 STEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKK 374
           +  E ILNGV+NGFY K  KPLRK CQS +SR AQW  FKKI+       Y  FKS    
Sbjct: 295 AVSEVILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVD 354

Query: 375 RSQLIIAIKNILSPDGWIPTRTDD 398
           R+ +I   K  LS  GWI T  D+
Sbjct: 355 RNHIISKAKATLSASGWISTCRDN 378

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  284 bits (727), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 162/383 (42%), Positives = 222/383 (57%), Gaps = 12/383 (3%)

Query: 20  EDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIAT 79
           +DKL E I  +VI +Y   K + +P  R +G  EWT+LAGV  ++R     +  ++S AT
Sbjct: 3   DDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTA--ECRLVSAAT 60

Query: 80  GVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQ-NYNPSSGDKFIQHNDEIPA 138
           GVKALPD EL+RS G+++HD HAEILALRG N VLL + +   +  S +  +    +   
Sbjct: 61  GVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQD 120

Query: 139 RFNLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRL 198
           RF L   W+ ALYIS+ PCGD SM   +D+     F      D  QYV     T+LRGR 
Sbjct: 121 RFRLASRWQAALYISKAPCGDCSMDMADDDADEMTF---SPDDPIQYVAEHNYTMLRGRF 177

Query: 199 NFNRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNL 258
           N++R+ V RTKPGR DS ITLSKSCSDKL  K   S+L+ + +ELFE+PVFL Y+V+P+ 
Sbjct: 178 NYSRKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPHT 237

Query: 259 EDETKHHLEQSFHTRLPNLDNE--IKFLNCLKPFYDDKLDEEDVPGLMCSVKL-FMDDFS 315
                   E+ F  RL  L+     + L C   F  D+   +  P L  SV L       
Sbjct: 238 IATAG--FERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITAKKH 295

Query: 316 TEEAILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKR 375
            E+A+LNGVRNG Y +  + L  H ++ VSR A W +F ++  +   +SY  FK +Q  R
Sbjct: 296 VEQALLNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHAR 354

Query: 376 SQLIIAIKNILSPDGWIPTRTDD 398
           ++L   +++ LSPDGW  TR DD
Sbjct: 355 NRLKRHVRHRLSPDGWPTTRVDD 377

>Smik_1.108 Chr1 complement(176076..176135,176139..176261) [183 bp,
           61 aa] {ON} YGL243W (REAL)
          Length = 61

 Score = 47.0 bits (110), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 90  QRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDKFIQHNDEIPARFNLKENWELA 149
           ++ E K+    +  IL LRGAN VLLN ++   P++ + F   N   P+RF LK N ELA
Sbjct: 1   KKVEEKLYTIVYPGILTLRGANKVLLNYVKGCKPANDNDFFS-NHGTPSRFKLKGNCELA 59

Query: 150 LY 151
           L+
Sbjct: 60  LF 61

>CAGL0I00968g Chr9 (78375..81368) [2994 bp, 997 aa] {ON} similar to
           uniprot|P32480 Saccharomyces cerevisiae YOR038c HIR2
           histone transcription regulator
          Length = 997

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 73/160 (45%), Gaps = 37/160 (23%)

Query: 8   RPCIVNLLTMPSEDKLGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAG-----VAA 62
           RPC ++L    S +K  +EI++  +++ SK       ++ PSG   +T+L       V  
Sbjct: 140 RPCKIHLFDTRSANK--KEITSIALDKNSK---PLTGVVDPSGAGTFTVLTSDRSIVVYH 194

Query: 63  INRDGGANKIEILSIATGVKALPDSELQRSEGKILHDCHAEIL----ALRGAN------- 111
           INR G   +++ LS    V  L          KI     A+ L    +L+G++       
Sbjct: 195 INRTGDYKEVKKLSQHVLVYPL--------HYKITMPPQADFLPIINSLKGSSGAAGSTA 246

Query: 112 TVLLNRIQNY--------NPSSGDKFIQHNDEIPARFNLK 143
           TVLLNR +NY        + SS  K + H+ ++  + NLK
Sbjct: 247 TVLLNRNENYKVMSTLVPSASSNTKVLVHSPKMYEKANLK 286

>YDR173C Chr4 complement(810565..811632) [1068 bp, 355 aa] {ON}
           ARG82Inositol polyphosphate multikinase (IPMK),
           sequentially phosphorylates Ins(1,4,5)P3 to form
           Ins(1,3,4,5,6)P5; also has diphosphoinositol
           polyphosphate synthase activity; regulates arginine-,
           phosphate-, and nitrogen-responsive genes
          Length = 355

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 76/190 (40%), Gaps = 68/190 (35%)

Query: 157 CGDASM----SFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNFNRRNVVRTKPGR 212
            GDA++      L+D+  N D I ++     QY+   ++ +L G   F++ N++  K G+
Sbjct: 82  SGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYL--VLENLLYG---FSKPNILDIKLGK 136

Query: 213 --YDSNITLSKS-------------------CSDKLLMKQRSSVLNCLNYELFEKPVFLK 251
             YDS  +L K                    C  K+  ++  SVLN L+ E +E+     
Sbjct: 137 TLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKI--QKNPSVLNQLSLEYYEEEADSD 194

Query: 252 YIVI-----------------------PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLK 288
           YI I                       P+L D  KH L+++F  R             L+
Sbjct: 195 YIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKR-------------LQ 241

Query: 289 PFYDDKLDEE 298
            FY+  L+EE
Sbjct: 242 LFYNTMLEEE 251

>Skud_2.198 Chr2 (358218..359282) [1065 bp, 354 aa] {ON} YBR076W
           (REAL)
          Length = 354

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 78/190 (41%), Gaps = 30/190 (15%)

Query: 199 NFNRRNVVRTKPGRYDSNIT---LSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVI 255
           N +R NV  + P   DS IT   +  S   K LM +     N +  E F K +F  + ++
Sbjct: 144 NTSRSNVEESIPNDLDSLITYKFMRYSDKKKELMCRFCQGSNWIAAENFLKHLFFAHGIL 203

Query: 256 PNLEDETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLMC-SVKLFMDDF 314
              +  T +H E        NL+ +++ L   +P +  K+       L C +V +     
Sbjct: 204 SEFKPHTLYHFESKLLKIQGNLNFKVQVLK--EPEFSKKM-------LSCLTVSVIPSPL 254

Query: 315 STEEAILNGVRNGFYTKSSKPLRKHCQSQV------------SRFAQWELFKKIRPEYEG 362
           +     LNG     + K       HC++ +              F  +E  + +  +Y+G
Sbjct: 255 AYYTQTLNGGFRRIHVKCP-----HCENWIRLGWCEYDEIIKDSFQDFESLRNLNADYDG 309

Query: 363 ISYLEFKSRQ 372
           +SY++ ++R+
Sbjct: 310 MSYIQTRNRE 319

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 30.8 bits (68), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 38/80 (47%), Gaps = 12/80 (15%)

Query: 67  GGANKIEILSIATGVKALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSG 126
           G + +IE L  A  VK      LQR +G I+H  H EI  + G      +  +++    G
Sbjct: 305 GWSREIEFLDDAKKVK------LQRPKGNIVH--HGEIEQIPGFGMPKGSSGKSF----G 352

Query: 127 DKFIQHNDEIPARFNLKENW 146
           D F+++   +PA+F     W
Sbjct: 353 DLFVEYAVVMPAQFKQTNQW 372

>Suva_7.360 Chr7 complement(616179..616781) [603 bp, 200 aa] {ON}
           YGR078C (REAL)
          Length = 200

 Score = 30.0 bits (66), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%)

Query: 261 ETKHHLEQSFHTRLPNLDNEIKFLNCLKPFYDDKLDEEDVPGLM 304
           E+K    +   TR+P+L N +K    L+   DD  DE+  P L+
Sbjct: 53  ESKMATVKQLQTRIPDLQNTLKICQSLRSHSDDDGDEDAEPVLL 96

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,650,558
Number of extensions: 2148866
Number of successful extensions: 5880
Number of sequences better than 10.0: 43
Number of HSP's gapped: 6019
Number of HSP's successfully gapped: 43
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)