Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YFR048W (RMD8)3.568ON66266232530.0
Smik_7.3683.568ON65966228980.0
Skud_6.1393.568ON66166328940.0
Suva_12.93.568ON65966228390.0
TDEL0D063603.568ON58525211831e-154
Kpol_507.93.568ON60323611591e-151
ZYRO0E09548g3.568ON59224811541e-150
CAGL0C01969g3.568ON61923711521e-149
NCAS0F039703.568ON59723811441e-148
TBLA0E002103.568ON63124011421e-148
SAKL0F00770g3.568ON63623911371e-147
KNAG0D029603.568ON65123411261e-145
NDAI0B062803.568ON60523711211e-145
KLTH0G00704g3.568ON61523611131e-143
Kwal_47.192683.568ON61623611081e-143
TPHA0A060103.568ON62323711061e-142
KLLA0A00715g3.568ON59124010971e-141
Ecym_25983.568ON60223510971e-141
AFR265C3.568ON59123010571e-135
KAFR0J001703.568ON60724610541e-135
Smik_4.2353.209ON4312324394e-47
Suva_4.2523.209ON4302324385e-47
YDL001W (RMD1)3.209ON4302324387e-47
Skud_4.2533.209ON4302324378e-47
NCAS0A101203.209ON4232434342e-46
SAKL0C11286g3.209ON4282344342e-46
KNAG0K014903.209ON4052334305e-46
TDEL0D041303.209ON4382324317e-46
TBLA0A001703.209ON5052374348e-46
NDAI0A073503.209ON5222304332e-45
Kwal_27.110013.209ON4082344252e-45
KLTH0G16544g3.209ON4082344253e-45
CAGL0M10483g3.209ON4322044254e-45
Kpol_1045.583.209ON4472234256e-45
Ecym_52933.209ON4772354251e-44
ZYRO0A04400g3.209ON4582304231e-44
KAFR0F025003.209ON4662464222e-44
TPHA0P005503.209ON4462304212e-44
AEL004W3.209ON4752354213e-44
KLLA0E17381g3.209ON4442134114e-43
Skud_4.5455.291ON4132662114e-17
YDR282C5.291ON4142702081e-16
Suva_2.4485.291ON4172702009e-16
Smik_4.5315.291ON4142681937e-15
Ecym_47435.291ON3662591855e-14
KLTH0G06622g5.291ON3922551777e-13
KLLA0C11165g5.291ON3562341767e-13
SAKL0G10582g5.291ON3832501768e-13
ZYRO0G16478g5.291ON4012601768e-13
Kwal_23.56435.291ON3742531741e-12
Kpol_1033.65.291ON4032481714e-12
CAGL0H01045g5.291ON3611711661e-11
TPHA0D017105.291ON3862081642e-11
AAL122C5.291ON3661551608e-11
KAFR0E015305.291ON3632391591e-10
TDEL0E033605.291ON4052711492e-09
Skud_11.1372.491ON310131741.9
NCAS0A093101.300ON21547696.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YFR048W
         (662 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytoso...  1257   0.0  
Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W ...  1120   0.0  
Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W ...  1119   0.0  
Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON} ...  1098   0.0  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...   460   e-154
Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON} ...   451   e-151
ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} simila...   449   e-150
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...   448   e-149
NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.5...   445   e-148
TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}...   444   e-148
SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON...   442   e-147
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...   438   e-145
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...   436   e-145
KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON...   433   e-143
Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR0...   431   e-143
TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON} Anc_3...   430   e-142
KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON...   427   e-141
Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar...   427   e-141
AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON} S...   411   e-135
KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON...   410   e-135
Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W ...   173   4e-47
Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W ...   173   5e-47
YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}  RMD1Cytopl...   173   7e-47
Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W ...   172   8e-47
NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON} Anc_3...   171   2e-46
SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]...   171   2e-46
KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3....   170   5e-46
TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.2...   170   7e-46
TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209...   171   8e-46
NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa] ...   171   2e-45
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...   168   2e-45
KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]...   168   3e-45
CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa...   168   4e-45
Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON} (1393...   168   6e-45
Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar t...   168   1e-44
ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} simila...   167   1e-44
KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {O...   167   2e-44
TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {...   166   2e-44
AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic ho...   166   3e-44
KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]...   162   4e-43
Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON...    86   4e-17
YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}...    85   1e-16
Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON...    82   9e-16
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    79   7e-15
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    76   5e-14
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    73   7e-13
KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {...    72   7e-13
SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} simila...    72   8e-13
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    72   8e-13
Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa] ...    72   1e-12
Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON...    70   4e-12
CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON...    69   1e-11
TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {O...    68   2e-11
AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON} S...    66   8e-11
KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {O...    66   1e-10
TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.2...    62   2e-09
Skud_11.137 Chr11 complement(255229..256161) [933 bp, 310 aa] {O...    33   1.9  
NCAS0A09310 Chr1 (1840751..1841398) [648 bp, 215 aa] {ON} Anc_1....    31   6.1  

>YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytosolic
           protein required for sporulation
          Length = 662

 Score = 1257 bits (3253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/662 (92%), Positives = 614/662 (92%)

Query: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS 60
           MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS
Sbjct: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS 60

Query: 61  SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERL 120
           SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDI                  QYERL
Sbjct: 61  SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIPSARREERLSSSSSDRPRQYERL 120

Query: 121 SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP 180
           SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP
Sbjct: 121 SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP 180

Query: 181 RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240
           RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR
Sbjct: 181 RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240

Query: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD 300
           IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD
Sbjct: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD 300

Query: 301 TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSDASCGXX 360
           TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSDASCG  
Sbjct: 301 TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSDASCGND 360

Query: 361 XXXXXXXXSKLYAVEGNDQYVQXXXXXXXXXXXXXXXXXXXXQNDFDRVYKMHRDNDHEG 420
                   SKLYAVEGNDQYVQ                    QNDFDRVYKMHRDNDHEG
Sbjct: 361 NNNKNNDKSKLYAVEGNDQYVQSSRSPASPSSISTPSPPSSSQNDFDRVYKMHRDNDHEG 420

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD
Sbjct: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480

Query: 481 RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY 540
           RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY
Sbjct: 481 RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY 540

Query: 541 GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR 600
           GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR
Sbjct: 541 GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR 600

Query: 601 VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHT 660
           VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHT
Sbjct: 601 VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHT 660

Query: 661 ST 662
           ST
Sbjct: 661 ST 662

>Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W
           (REAL)
          Length = 659

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 558/662 (84%), Positives = 584/662 (88%), Gaps = 3/662 (0%)

Query: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS 60
           MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRK+MEN  + +SQGVRS
Sbjct: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKSMENKNLVRSQGVRS 60

Query: 61  SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERL 120
           S IG S LQ+ THPRRRSSGRFSDISIDNILSDNSDI                   YERL
Sbjct: 61  SNIGSSSLQNPTHPRRRSSGRFSDISIDNILSDNSDIPSARREERLSSSSNDRPRNYERL 120

Query: 121 SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP 180
           SSRRKMINPLPPRTSKTSQKLVLIPE+D+L+HFQT+PTNALDRQRP+VGSMK NSFDRLP
Sbjct: 121 SSRRKMINPLPPRTSKTSQKLVLIPEEDDLSHFQTMPTNALDRQRPRVGSMKPNSFDRLP 180

Query: 181 RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240
           R+S++KSMARITAYNVADGFNLNQLYKFL ETHEVSPRLYDECLYVAYTLPLLPGKGGFR
Sbjct: 181 RHSRDKSMARITAYNVADGFNLNQLYKFLHETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240

Query: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD 300
           IKSN+SKKT+GGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELE +GNNN+ NQD
Sbjct: 241 IKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELEANGNNNSTNQD 300

Query: 301 TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSDASCGXX 360
           TT VPDHLPNPVGQQDSFNPMEPQFFAEETPLEIE+RERTERINMLKKEE D D S G  
Sbjct: 301 TTIVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEERERTERINMLKKEEKDIDGSNGEK 360

Query: 361 XXXXXXXXSKLYAVEGNDQYVQXXXXXXXXXXXXXXXXXXXXQNDFDRVYKMHRDNDHEG 420
                      Y  +G D +                      ++DF+RVY++H DN H+G
Sbjct: 361 NDESEPVS---YVNDGKDHHAYSACFSPPASSASTQSALSSSRDDFNRVYEVHSDNGHDG 417

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFA YK+LMIRPLDEQDIETEQFHFEYD
Sbjct: 418 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFAGYKSLMIRPLDEQDIETEQFHFEYD 477

Query: 481 RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY 540
           RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY
Sbjct: 478 RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY 537

Query: 541 GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR 600
           GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR
Sbjct: 538 GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR 597

Query: 601 VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHT 660
           VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 
Sbjct: 598 VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHI 657

Query: 661 ST 662
           ST
Sbjct: 658 ST 659

>Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W
           (REAL)
          Length = 661

 Score = 1119 bits (2894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/663 (83%), Positives = 576/663 (86%), Gaps = 3/663 (0%)

Query: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS 60
           MSYKANQPSPGEMPKRSPSILVTDARTSK RMSAPFAGHAAGSRK MEN  + +SQG RS
Sbjct: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKKRMSAPFAGHAAGSRKTMENKDLARSQGARS 60

Query: 61  SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERL 120
           S IGPSPL +  HPRRRSSGRFSDISIDNILSDNS I                   YERL
Sbjct: 61  SNIGPSPLLNQPHPRRRSSGRFSDISIDNILSDNSGIPSARREERLSSSSSDRPRHYERL 120

Query: 121 SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP 180
           +S RKMINPLPPRTSKTSQKLVLIPEDD+LNHF+T+PT ALDRQRPKVGSM++NSFDRLP
Sbjct: 121 NSHRKMINPLPPRTSKTSQKLVLIPEDDDLNHFKTMPTKALDRQRPKVGSMRTNSFDRLP 180

Query: 181 RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240
           R+S+EKSMARITAYNVADGFNLN LYKFLQ+THEVSPRLYDECLYVAYTLPLLPGKGGFR
Sbjct: 181 RHSREKSMARITAYNVADGFNLNHLYKFLQDTHEVSPRLYDECLYVAYTLPLLPGKGGFR 240

Query: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD 300
           IKSN+SKKT+GGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELET+G NN  NQD
Sbjct: 241 IKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETNGGNNTTNQD 300

Query: 301 TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSDASCGXX 360
           TT VPDHLPNPVGQQDSFNPMEPQFFAEETP EIE RERTERINMLKKEEND+D +    
Sbjct: 301 TTIVPDHLPNPVGQQDSFNPMEPQFFAEETPSEIENRERTERINMLKKEENDADGN--DK 358

Query: 361 XXXXXXXXSKLYAVEGNDQYVQXXXXXXXXXXXXXXXXXXXX-QNDFDRVYKMHRDNDHE 419
                    +  A E  DQY                       +  F+R Y+M +DN+HE
Sbjct: 359 GGNNDDSEIETCAAEDVDQYAPSSRSSASSASSASTPSPPSSSRKGFNRAYEMRKDNEHE 418

Query: 420 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 479
           GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADY+NL IRPLDEQDIETEQFHFEY
Sbjct: 419 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYRNLTIRPLDEQDIETEQFHFEY 478

Query: 480 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
           DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL
Sbjct: 479 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 538

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
           YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ
Sbjct: 539 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 598

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659
           RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEI VRYVIIHRH
Sbjct: 599 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEICVRYVIIHRH 658

Query: 660 TST 662
           T+T
Sbjct: 659 TTT 661

>Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON}
           YFR048W (REAL)
          Length = 659

 Score = 1098 bits (2839), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/662 (81%), Positives = 572/662 (86%), Gaps = 5/662 (0%)

Query: 1   MSYKANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRS 60
           MSYKANQPSPGEMPKRSPSILVTDAR+S+NR+SAPFAGHAAGSRK+MEN  V +SQG+RS
Sbjct: 1   MSYKANQPSPGEMPKRSPSILVTDARSSRNRISAPFAGHAAGSRKSMENKSVERSQGIRS 60

Query: 61  SAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERL 120
           S  GPSP+    HPRRRSSGRFSDISIDNILSDNS+I                   YERL
Sbjct: 61  SNAGPSPMMP-AHPRRRSSGRFSDISIDNILSDNSEIPSARREERLSSSSSDRPRYYERL 119

Query: 121 SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLP 180
           +SRRKMINPLPPRTSKTSQKLVLIPE+D+LN F+ +P NALDRQRPKVGS KS+S DR+P
Sbjct: 120 NSRRKMINPLPPRTSKTSQKLVLIPEEDDLNQFRNMPHNALDRQRPKVGSTKSSSHDRMP 179

Query: 181 RYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFR 240
           R+ +EK MARITAYNVADGFNLN LY+FL++THEVSPRLYDECLYVAYTLPLLPGKGGFR
Sbjct: 180 RHLREKPMARITAYNVADGFNLNLLYRFLEDTHEVSPRLYDECLYVAYTLPLLPGKGGFR 239

Query: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQD 300
           IKSN+SKKT+GGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSG NN+ +QD
Sbjct: 240 IKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGGNNSTSQD 299

Query: 301 TTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDSD-ASCGX 359
           T TVPDHLPNPVGQQDSFNPMEPQFFAEETPLE EKRER ER+NMLKKEEND+D    G 
Sbjct: 300 TVTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEQEKRERIERMNMLKKEENDTDDKGSGN 359

Query: 360 XXXXXXXXXSKLYAVEGNDQYVQXXXXXXXXXXXXXXXXXXXXQNDFDRVYKMHRDNDHE 419
                    +  Y     DQY                      + D +R Y+M +DN+HE
Sbjct: 360 TINDDDDNEAANYVAASTDQY---RTPPSSASSAYTPSPPSSARRDSNRGYEMQKDNEHE 416

Query: 420 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 479
           GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY
Sbjct: 417 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 476

Query: 480 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
           D DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL
Sbjct: 477 DSDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 536

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
           YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ
Sbjct: 537 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 596

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659
           RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSL EIFVRY+IIHRH
Sbjct: 597 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLAEIFVRYIIIHRH 656

Query: 660 TS 661
           ++
Sbjct: 657 ST 658

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score =  460 bits (1183), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 215/252 (85%), Positives = 233/252 (92%), Gaps = 4/252 (1%)

Query: 410 YKMHRDNDHEG----NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPL 465
           + M  +N   G     D+HAEIFIF YGVIVFWNFTEIQEKNILGDI FADYKNL+IRPL
Sbjct: 333 FNMPANNKRHGTTSSGDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADYKNLVIRPL 392

Query: 466 DEQDIETEQFHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISP 525
           DEQDIE EQFHF+YD+DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISP
Sbjct: 393 DEQDIEREQFHFDYDKDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISP 452

Query: 526 ILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLH 585
           IL +VTKLPKRLALYGTLG+KREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLH
Sbjct: 453 ILTAVTKLPKRLALYGTLGMKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLH 512

Query: 586 PLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFS 645
           PLY+AMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVA+RN+ARVTWWFI+ I+ GV+FS
Sbjct: 513 PLYIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVADRNIARVTWWFIIAIIVGVVFS 572

Query: 646 LTEIFVRYVIIH 657
           L+EI VRY+II 
Sbjct: 573 LSEILVRYIIIQ 584

 Score =  330 bits (846), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/368 (52%), Positives = 236/368 (64%), Gaps = 30/368 (8%)

Query: 1   MSYKANQPSPGE-----MPKRSPSILVTDARTSKNRMSAPFAGHAAG--SRKNMENAGVT 53
           MSYK       +     + +RSPSILVTD+R+S+ RMSAPFAGHAAG  SR  + N   +
Sbjct: 1   MSYKVGDGDRSDANGLPLARRSPSILVTDSRSSRKRMSAPFAGHAAGVRSRDELPNMKSS 60

Query: 54  KSQGVRSSAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXX 113
            S G + S             +RR+SGRFS+ISIDNILS+ SD+                
Sbjct: 61  GSFGNKVSN------------KRRTSGRFSEISIDNILSEMSDVPSGRREERLSSSSADR 108

Query: 114 XXQYERLSS--RRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSM 171
               ++  S    KMINPLP RTSKTSQKLVLIPE+ +    +    NA  R+R    SM
Sbjct: 109 HYASDKPRSLNYSKMINPLPARTSKTSQKLVLIPEEAD---GRESSANAFSRKR-STTSM 164

Query: 172 KSNSFDRLPRYSK-EKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTL 230
           K   +    R++K ++ +ARITAYNVA+GFNL  + KFL+ THEVSPR+YDECLYVAYTL
Sbjct: 165 KG--YGESARHAKKDEKLARITAYNVAEGFNLKLMSKFLKCTHEVSPRMYDECLYVAYTL 222

Query: 231 PLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELET 290
           PLL GK GFR+KSN+SKK +GGKTLI+ LIDTSEQRDHHYEYYSGVET+EDA N +EL+ 
Sbjct: 223 PLLLGKDGFRVKSNISKKVVGGKTLIEKLIDTSEQRDHHYEYYSGVETLEDARNAFELDP 282

Query: 291 SGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEE 350
           +        D   +P+HLPNP G  DSF+P EPQFFAEETP E + RER E+ NM    +
Sbjct: 283 TA--VLVENDPNIIPNHLPNPPGNLDSFDPSEPQFFAEETPTEQKLRERREQFNMPANNK 340

Query: 351 NDSDASCG 358
                S G
Sbjct: 341 RHGTTSSG 348

>Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON}
           complement(53819..55630) [1812 nt, 604 aa]
          Length = 603

 Score =  451 bits (1159), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 207/236 (87%), Positives = 226/236 (95%)

Query: 422 DRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDR 481
           D+HAEIFIFHYGVIVFWNFTE QEKNILGDI F++YKNL+IR LDEQDIETEQFHFEYD+
Sbjct: 366 DQHAEIFIFHYGVIVFWNFTEQQEKNILGDIAFSEYKNLVIRALDEQDIETEQFHFEYDK 425

Query: 482 DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYG 541
           + ERPRIFNDI+TLRSGDHIIELTLSHAIAQSSKLSRFESR++PIL S+TKLP+RLALYG
Sbjct: 426 ENERPRIFNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRVTPILSSITKLPRRLALYG 485

Query: 542 TLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 601
           TLGLKREQLLK+SGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLYVAMREYLEIDQRV
Sbjct: 486 TLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 545

Query: 602 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIH 657
           QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFI++I+  V+FSL EI +RY IIH
Sbjct: 546 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFIMMIIVSVLFSLAEILIRYNIIH 601

 Score =  335 bits (858), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 186/359 (51%), Positives = 237/359 (66%), Gaps = 21/359 (5%)

Query: 1   MSYKANQPSPG------EMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTK 54
           MSY ++  + G       M KRSPSILVTD+R++KNR+SAPFA HAAG+R   E+     
Sbjct: 1   MSYNSSNNASGAHLATSSMSKRSPSILVTDSRSNKNRLSAPFARHAAGARSR-ESLSSVP 59

Query: 55  SQGVRSSAIGP------SPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXX 108
           S  + SS+  P      + ++S         GRFSDISIDNILSD+SD+           
Sbjct: 60  SNSIGSSSYVPYLNSNKNQVRSVNRAASPQFGRFSDISIDNILSDSSDVPSGRREERRSS 119

Query: 109 XXXXXXXQYERL--SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRP 166
                   Y++L  S+  K ++ +PPRTSKTS KLVLIPE+  +     +P N L  +  
Sbjct: 120 SSWDRFSIYDKLRTSNYGKGLSHIPPRTSKTSHKLVLIPENSEIPK-DYMPNNFLRNRSS 178

Query: 167 KVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYV 226
              +++S  F +   + +++ + RITAYNVA+GFNL+ + KFL+ THEVSPR Y ECLYV
Sbjct: 179 SYKNLQSEQFQQ---HDRDEILPRITAYNVAEGFNLDLMSKFLKSTHEVSPRQYAECLYV 235

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNY 286
           AYTLPLLPGK G+RIKSN+SKK +GGKTLID LIDTSEQRDHHYEYYSGVE +EDANNNY
Sbjct: 236 AYTLPLLPGKDGYRIKSNISKKVVGGKTLIDELIDTSEQRDHHYEYYSGVEILEDANNNY 295

Query: 287 ELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINM 345
           EL  +  +     + T +PDHLPNP    DSF+P EPQFFAEETP+E + RER E+I M
Sbjct: 296 ELNATTPSQEP--EVTVIPDHLPNPTNNSDSFDPSEPQFFAEETPIEQKLRERKEQIKM 352

>ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} similar
           to uniprot|P43620 Saccharomyces cerevisiae YFR048W RMD8
           Cytosolic protein required for sporulation
          Length = 592

 Score =  449 bits (1154), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 228/248 (91%), Gaps = 2/248 (0%)

Query: 416 NDHEGND--RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETE 473
           ND  GND  +HAEIFIF YGVIVFWNFTEIQEKNILGDI FAD+KNL+IRPLDE DIE E
Sbjct: 344 NDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIERE 403

Query: 474 QFHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKL 533
           QFHF+YD+D ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI+PIL S TKL
Sbjct: 404 QFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKL 463

Query: 534 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMRE 593
           PKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS+ILDTPEFFWSFEPSLHPLY+AMRE
Sbjct: 464 PKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523

Query: 594 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRY 653
           YLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI VI+ GV+FS+ EI VRY
Sbjct: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583

Query: 654 VIIHRHTS 661
           V+I    S
Sbjct: 584 VMIRNRLS 591

 Score =  325 bits (834), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 190/367 (51%), Positives = 233/367 (63%), Gaps = 37/367 (10%)

Query: 1   MSYK-ANQPSPGE------MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVT 53
           M+YK  ++  PG+      M KRSPSILVTD+R++  RMSAPFAGHAAG +   ++    
Sbjct: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADR 60

Query: 54  K------SQGVRSSAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXX 107
                  S G +SS++           RRR SGRFSDISIDNILSD SD+          
Sbjct: 61  NRLAPYPSNGSKSSSV-----------RRRPSGRFSDISIDNILSDASDVPSGRREERQS 109

Query: 108 XXXXXXXXQYERLS--SRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQR 165
                       L   S  KM+NPLP RTSKTSQKLVLIPE+       T          
Sbjct: 110 SSSLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYG------ 163

Query: 166 PKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLY 225
           PK  +   N+  +  +  + + ++RITAYNVA+GFNL  +  FL+ THEVSPR+YDECLY
Sbjct: 164 PKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLY 223

Query: 226 VAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNN 285
           VAYTLPLL GK GFR++SN+SKK +GGKTLID LID SEQRDHHYEYYSGVET+ED +NN
Sbjct: 224 VAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNN 283

Query: 286 YELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINM 345
           +EL+++G     N D    PDHLPN +G QD+FNP EPQFFAEETP+E E+RER E  N 
Sbjct: 284 FELDSNG-----NYDADITPDHLPNAMGNQDTFNPSEPQFFAEETPVEQERRERRENFNF 338

Query: 346 LKKEEND 352
               +ND
Sbjct: 339 DSSSKND 345

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score =  448 bits (1152), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 205/237 (86%), Positives = 226/237 (95%)

Query: 422 DRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDR 481
           D+HAEIF+FHYGVIVFWNFTE +EKN+LGDI F+DYKNL+IRPLDEQDIE EQFHFEYD+
Sbjct: 380 DQHAEIFVFHYGVIVFWNFTEEEEKNLLGDIAFSDYKNLVIRPLDEQDIEIEQFHFEYDK 439

Query: 482 DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYG 541
           DTERPRIFNDI+TLRSGDHIIELTLSHAIAQSSKLSRFESRISPIL +VT+LPKRLALYG
Sbjct: 440 DTERPRIFNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRISPILTTVTRLPKRLALYG 499

Query: 542 TLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 601
           TLGLKREQL+KKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLYVAMREYLEIDQRV
Sbjct: 500 TLGLKREQLIKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 559

Query: 602 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658
           QVLNDRC VFLEFFDICVDS+AERN+ RVTWWF + I+  VIFSL E+F+RY+II+R
Sbjct: 560 QVLNDRCMVFLEFFDICVDSIAERNIVRVTWWFFVAIVITVIFSLIEVFIRYLIINR 616

 Score =  335 bits (860), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 240/380 (63%), Gaps = 49/380 (12%)

Query: 1   MSYK---ANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNME--------- 48
           MSY+    ++   G M KRSPSILVTDARTSKNR SAPFAGHAAG R             
Sbjct: 1   MSYRDTGMDKKGTGTMSKRSPSILVTDARTSKNRRSAPFAGHAAGVRSASSSTGSGSSAS 60

Query: 49  -----------NAGVTKSQGVRSSAIGPSPLQSFTH----------PRRRSSGRFSDISI 87
                      N  +  S+G  ++  G S     T           PRRR+SGRFS+ISI
Sbjct: 61  AERGAELMKYVNGNLRGSRGQYAATGGRSSSNHGTGDLSNRGTSSPPRRRASGRFSEISI 120

Query: 88  DNILSDNSDIXXXXXXXXXXXXXXXXXXQYERLSSR--RKMINPLPPRTSKTSQKLVLIP 145
           DNILSD SD+                   Y+RL  +  RKMIN LP RTSKTSQKLVLIP
Sbjct: 121 DNILSDRSDVPSGRREERGSNSSFDRSMIYDRLHPQPIRKMINTLPIRTSKTSQKLVLIP 180

Query: 146 EDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQL 205
           ED ++      PT     +R +   +K N  +R+P+ S++  ++RITAYN+A+GFNL  L
Sbjct: 181 EDGSVP-----PTRGALERREQPTFVKRNPTERIPKSSRDHRLSRITAYNLAEGFNLKLL 235

Query: 206 YKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQ 265
            KFL+ THEV PRLYDECLY+AYTLPLLPGK GFR+KSN+SKK +GGKTLI+ LIDTSEQ
Sbjct: 236 SKFLKSTHEVKPRLYDECLYIAYTLPLLPGKDGFRLKSNVSKKVVGGKTLIEKLIDTSEQ 295

Query: 266 RDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQF 325
           RDHHYEYYSGVET+EDANNNYEL+ +  +N  N ++   P          DSF+P EPQ+
Sbjct: 296 RDHHYEYYSGVETLEDANNNYELDPTSVDNENNNNSNNNP---------ADSFDPSEPQY 346

Query: 326 FAEETPLEIEKRERTERINM 345
           FAEETP E  +RER+E +++
Sbjct: 347 FAEETPKEQLERERSESLHI 366

>NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.568
           YFR048W
          Length = 597

 Score =  445 bits (1144), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 211/238 (88%), Positives = 233/238 (97%)

Query: 422 DRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDR 481
           D+HAE+FIFHYGVIVFWNFTE++EKN+LGDI F+DYKNL+IRPLDEQDIETEQFHFEYD+
Sbjct: 359 DQHAELFIFHYGVIVFWNFTEMEEKNLLGDIAFSDYKNLVIRPLDEQDIETEQFHFEYDK 418

Query: 482 DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYG 541
           DTERPRIFNDI+TLRSGDH+IELTLSHAIAQSSKLSRFESRI+PIL SVTKLPKRLALYG
Sbjct: 419 DTERPRIFNDILTLRSGDHMIELTLSHAIAQSSKLSRFESRITPILASVTKLPKRLALYG 478

Query: 542 TLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 601
           TLGL+R+QLLK+SGKLFKLRVDVNLSS++LD+PEFFWS EPSLHPLY+AMREYLEIDQRV
Sbjct: 479 TLGLQRKQLLKRSGKLFKLRVDVNLSSSVLDSPEFFWSSEPSLHPLYIAMREYLEIDQRV 538

Query: 602 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659
           QVLNDRCKVFLEFFDICVDSVAERN+ARVTWWFI+VI+ GVIFSLTEIFVRY+IIH H
Sbjct: 539 QVLNDRCKVFLEFFDICVDSVAERNIARVTWWFIIVIIVGVIFSLTEIFVRYIIIHSH 596

 Score =  330 bits (845), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/346 (54%), Positives = 232/346 (67%), Gaps = 20/346 (5%)

Query: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNME--NAGVTKSQGVRSSAIGPSPLQS 70
           M KRSPSILVTD+R+SK+RMSAPFAGHAAGS    +  N G+       S+ I       
Sbjct: 18  MSKRSPSILVTDSRSSKHRMSAPFAGHAAGSLNQPKPFNRGIPHHTPYSSTGI------- 70

Query: 71  FTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXX-QYERLSSR--RKMI 127
            +  R++SSGRF D+SIDNIL D+SD+                     +RL S   ++ I
Sbjct: 71  HSQLRKKSSGRFGDVSIDNILLDSSDVPSGRREERLSNSSQERFPFASDRLRSSYFKRSI 130

Query: 128 NPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS 187
           NPLP RTSKTSQKLVLIPED+ +   +   +N LDR+R    +    S +R     KE  
Sbjct: 131 NPLPSRTSKTSQKLVLIPEDEPIGA-EVGSSNVLDRKR---HATTPRSPERYESSYKESK 186

Query: 188 MARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSK 247
           +ARITAYNVADGFNL  L KFL +THEVSPR+YDECLY+AYTLPLLPGK GFRIKSN+SK
Sbjct: 187 LARITAYNVADGFNLKLLSKFLGDTHEVSPRMYDECLYIAYTLPLLPGKEGFRIKSNISK 246

Query: 248 KTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPDH 307
           KT+GG+TLID LIDTSEQRDHHYEY+SGVET+EDA+NNYEL+++    +   D   +P H
Sbjct: 247 KTVGGQTLIDKLIDTSEQRDHHYEYFSGVETLEDAHNNYELDSNAIPIDTT-DPNLIPSH 305

Query: 308 LPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINMLKKEENDS 353
           LP P    DSFNP EPQFFAEE+  + E R+   R   LK ++N S
Sbjct: 306 LPIPTTNPDSFNPSEPQFFAEESHNDQELRKGDGR---LKNQKNKS 348

>TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}
           Anc_3.568 YFR048W
          Length = 631

 Score =  444 bits (1142), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 202/240 (84%), Positives = 226/240 (94%)

Query: 420 GNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEY 479
           G  +HAEIFIF YGVIVFWNFTE QEKNILGDI FADYK+L+IRPLDEQDIETE+FHFEY
Sbjct: 391 GKSQHAEIFIFRYGVIVFWNFTEAQEKNILGDIAFADYKDLVIRPLDEQDIETEEFHFEY 450

Query: 480 DRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
           D DTERPRIFND++TLRSGDHII+LTLSH+IAQSSKLSRFESR+ P+L SVTKLPKRLAL
Sbjct: 451 DADTERPRIFNDVITLRSGDHIIKLTLSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLAL 510

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
           YGTLGL R+QLLKKSGKLFKLRVDVNLSS++LDTPEFFW+FEPSLHPLYVAMREYLEID+
Sbjct: 511 YGTLGLTRQQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDE 570

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659
           RVQV+NDRC V LEFF+ICVDSVAERN+ARVTWWFI+V++ GV+FSLTEI +RY+II RH
Sbjct: 571 RVQVVNDRCMVLLEFFNICVDSVAERNIARVTWWFIIVLILGVLFSLTEILIRYLIIQRH 630

 Score =  312 bits (800), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 234/381 (61%), Gaps = 55/381 (14%)

Query: 4   KANQPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMEN--------AGVTKS 55
           K  Q  P  + KRSPSILVTD R+++ R SAPFAGHAA S  N+E         +G  KS
Sbjct: 12  KIEQKKP--LSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQVRKNLSSYSGGYKS 69

Query: 56  QGVR-----SSA-----IGPSPLQ-SFT------HPRRRSSGRFSDISIDNILSDNSDIX 98
              R     SSA      G  P + SF         RR S GRFSDISIDNIL D S+I 
Sbjct: 70  TWNRNLSNNSSAANGNVFGNKPFKKSFASVNNGRKSRRGSQGRFSDISIDNILQDTSEIP 129

Query: 99  XXXXXXXXXXXXXXXXXQYERLS-----------SRRKMINPLPPRTSKTSQKLVLIPED 147
                             YER S           +  K I PLPPRTSKTSQKLVLIPE+
Sbjct: 130 SARREERSSGS------SYERFSMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVLIPEE 183

Query: 148 DNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYS-KEKS-MARITAYNVADGFNLNQL 205
            +        +N+L R R    S+++       RY  K K+ + R+TAY++++G NL  +
Sbjct: 184 PDSR------SNSLGRPR-STSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLM 236

Query: 206 YKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQ 265
            KFL++ HEVSPRLYDECLYVAYTLPLLPGK G+RIKSN+SKK +GGKTLID +ID SEQ
Sbjct: 237 SKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQ 296

Query: 266 RDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQF 325
           RDHHYEYYSGVE +EDANNNYEL T  N   A+ D   +PDHLPN +   D+FNP EPQ+
Sbjct: 297 RDHHYEYYSGVEVLEDANNNYELST--NPVQADTDINNIPDHLPNTMANTDNFNPSEPQY 354

Query: 326 FAEETPLEIEKRERTERINML 346
           FAEETP E + RE+ E++ ++
Sbjct: 355 FAEETPSEQKLREQEEQLGLI 375

>SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 636

 Score =  442 bits (1137), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 207/239 (86%), Positives = 223/239 (93%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           +HAEIFIF YGVIVFWNFTEIQEKNILGDI FADYK+L+IRPLDEQDIETEQFHFEYD D
Sbjct: 394 QHAEIFIFGYGVIVFWNFTEIQEKNILGDIAFADYKSLVIRPLDEQDIETEQFHFEYDMD 453

Query: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
           TERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFESRISPIL +V+KLPKRLAL+GT
Sbjct: 454 TERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFESRISPILGTVSKLPKRLALHGT 513

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           LGLKREQLLKKSGKLFKLRVDVNLSS+ILDTP+FFWS EPSLHPLY+AMREYLEIDQRVQ
Sbjct: 514 LGLKREQLLKKSGKLFKLRVDVNLSSSILDTPDFFWSLEPSLHPLYLAMREYLEIDQRVQ 573

Query: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHTS 661
           VLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+ S+ EI VRY II +  S
Sbjct: 574 VLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSIAEILVRYFIIKKGGS 632

 Score =  330 bits (845), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 228/347 (65%), Gaps = 33/347 (9%)

Query: 11  GEMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRSSAIGPSP--- 67
           G++ +RSPSILVTD+R+SKNRMSAPFAGHAAG +    ++G    QG  S A G +P   
Sbjct: 16  GKLSRRSPSILVTDSRSSKNRMSAPFAGHAAGLKGGRSDSG-NGGQG-SSYARGSTPNAK 73

Query: 68  --------------------LQSFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXX 107
                                Q+ +   ++  G+FSDIS+DNILSD SD+          
Sbjct: 74  DSRSTRRLSFSISGDHSFSQQQALSKRSKKQHGKFSDISLDNILSDMSDVPSGRREERLS 133

Query: 108 XXXXXXXXQYERLSSRR--KMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQR 165
                    + R   R+  KMINPLPPRTSKTS+KLVLIP++    +F       L   +
Sbjct: 134 LPSYEHLSAHGRPRVRQHTKMINPLPPRTSKTSEKLVLIPDEQEKQNF------LLQNDK 187

Query: 166 PKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLY 225
            +  S   +  +++ +  +++ ++RITAYNVADG +L  + +FL+ETH+VSPRLYDECLY
Sbjct: 188 RRSSSSARSYGEKMSKEHRDRILSRITAYNVADGLSLKLVSQFLRETHDVSPRLYDECLY 247

Query: 226 VAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNN 285
           V Y LPLLPGK GFRIKSN+SKKT+GGKTLID LIDTSEQRDHHYEYYSGVET+ED +NN
Sbjct: 248 VPYCLPLLPGKDGFRIKSNISKKTVGGKTLIDRLIDTSEQRDHHYEYYSGVETMEDMHNN 307

Query: 286 YELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAEETPL 332
           YE++  G N+    D+T+VPDHLPNP     SF+P EPQ+FAEETPL
Sbjct: 308 YEIDEGGANDADRVDSTSVPDHLPNPSTSTASFDPSEPQYFAEETPL 354

>KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.568
           YFR048W
          Length = 651

 Score =  438 bits (1126), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/234 (85%), Positives = 225/234 (96%)

Query: 424 HAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRDT 483
           HAE+FIFHYGVIVFWNFTE QEKN+LGDITFAD K+LMIRP+DEQDIETE+FHFEYD DT
Sbjct: 415 HAELFIFHYGVIVFWNFTEEQEKNLLGDITFADDKDLMIRPIDEQDIETEEFHFEYDMDT 474

Query: 484 ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTL 543
           ERPRIFNDIVTLRSGDHI+++TLS+AIAQSSKLSRFESRI+P+L +V KLPKRLAL+GTL
Sbjct: 475 ERPRIFNDIVTLRSGDHIVKMTLSYAIAQSSKLSRFESRITPLLSAVMKLPKRLALHGTL 534

Query: 544 GLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQV 603
           GL+REQLLKKSGKLFKLRVDVNLSS+ILDTP+FFWS EPSLHPLY+AMREYLEID+RVQV
Sbjct: 535 GLRREQLLKKSGKLFKLRVDVNLSSSILDTPDFFWSIEPSLHPLYIAMREYLEIDKRVQV 594

Query: 604 LNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIH 657
           +NDRCKVFLEFFDICVDSVAERNMARVTWWF++VI+ GV+FSLTEI +RY IIH
Sbjct: 595 VNDRCKVFLEFFDICVDSVAERNMARVTWWFVVVIIIGVLFSLTEITIRYNIIH 648

 Score =  317 bits (811), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 188/384 (48%), Positives = 232/384 (60%), Gaps = 40/384 (10%)

Query: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAA-GSRKNMENAGVTKSQGVR------------ 59
           + KRSPSILVTD+R+S++R SAPFAGHAA GS  N   +   + Q               
Sbjct: 16  LAKRSPSILVTDSRSSQSRSSAPFAGHAASGSMANYHKSKQLQQQKSVRGGGVGSGSSAG 75

Query: 60  ---SSAIGPSPLQSFTHP----RRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXX 112
              S A GPS     + P    R+R SGRFS++S+DNIL ++S +               
Sbjct: 76  NYGSGARGPSGNSLNSAPGARARKRPSGRFSNVSMDNILHNDSAVPSGRREQRGSTSSWD 135

Query: 113 XXXQYERL---SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNA--------- 160
                E L   +S RKMINPLP RTSK SQKLVLIPEDD +N      T           
Sbjct: 136 RFPVTEILHASNSYRKMINPLPSRTSKISQKLVLIPEDDTVNAENGTSTKGSGNPPLRKS 195

Query: 161 ------LDRQRPKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHE 214
                 LDR+R        N FD         +++R+TAYN+A+GF+L  L++FLQ THE
Sbjct: 196 RNIGPVLDRKRHSTRMTNLNEFDNESYRFNSGNLSRLTAYNIAEGFDLTMLHRFLQNTHE 255

Query: 215 VSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYS 274
           V PRLYD+CLYV Y LPLLPGK GFRIKSN+SKK +GG TLID LIDTSE+RDHHYEYYS
Sbjct: 256 VHPRLYDDCLYVPYVLPLLPGKDGFRIKSNVSKKAVGGGTLIDKLIDTSERRDHHYEYYS 315

Query: 275 GVETVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVG--QQDSFNPMEPQFFAEETPL 332
           GVET+EDANNNYELE +G + N   D + +PDHLP P      D+F+P EPQFFAEETP+
Sbjct: 316 GVETLEDANNNYELEATGGHTNEMSDVSVIPDHLPQPTAGINPDAFDPREPQFFAEETPV 375

Query: 333 EIEKRERTERINMLKKEENDSDAS 356
           E E R+R E  ++   E  +  +S
Sbjct: 376 EQELRQREEMKSITSDEGTNKRSS 399

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score =  436 bits (1121), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 202/237 (85%), Positives = 225/237 (94%), Gaps = 1/237 (0%)

Query: 422 DRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYK-NLMIRPLDEQDIETEQFHFEYD 480
           D+HAEIF+FHYGVIVFWNFTE+QEKN+LGDITF+ Y+ NL+IRPLDEQDIETEQFHF YD
Sbjct: 367 DQHAEIFVFHYGVIVFWNFTEVQEKNLLGDITFSYYRRNLVIRPLDEQDIETEQFHFGYD 426

Query: 481 RDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALY 540
           ++TERPRIFNDIVTLRSGDH+IELTLSHAIAQSSKLSRFESRISP+L S+TKLPKRLALY
Sbjct: 427 KNTERPRIFNDIVTLRSGDHMIELTLSHAIAQSSKLSRFESRISPLLTSITKLPKRLALY 486

Query: 541 GTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQR 600
           GTLGLKR QLLKKSGKLFKLRVDVNLSS+ILD+PEFFWS EPSL PLY+AMREYLEIDQR
Sbjct: 487 GTLGLKRSQLLKKSGKLFKLRVDVNLSSSILDSPEFFWSTEPSLSPLYIAMREYLEIDQR 546

Query: 601 VQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIH 657
           VQVLNDRC VFLEFFDICVDSVAE+N+AR TWWF++ I+ G+ FSL+EIFVRY+IIH
Sbjct: 547 VQVLNDRCIVFLEFFDICVDSVAEKNIARFTWWFVIAIIVGLFFSLSEIFVRYIIIH 603

 Score =  332 bits (851), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 189/343 (55%), Positives = 233/343 (67%), Gaps = 15/343 (4%)

Query: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRSSAIGPSPLQSFT 72
           M KRSPSILVTD+RTSKNR+SAPFAGHAAG   N +   + +++  R +A   +      
Sbjct: 15  MAKRSPSILVTDSRTSKNRLSAPFAGHAAGV-LNRDEHRLPRNKSYRYNATNSNAELRGR 73

Query: 73  HPRRRSSGRFSDISIDNILSDNSDI-----XXXXXXXXXXXXXXXXXXQYERLSSRRKMI 127
           HP     GRFSD+SIDNILSD+SD+                        + R   +RK I
Sbjct: 74  HPSG-GGGRFSDVSIDNILSDSSDVPSGRREERLSNSSLERSPLVTDRAHSRSQYQRKTI 132

Query: 128 NPLPPRTSKTSQKLVLIPED-DNLNH--FQTLPTNALDRQR-PKVGSMKSNSFDRLPRYS 183
           NPLP RTSKTSQ+LVLIPE+ DN++    +   ++ LDR+R   +       +   PR  
Sbjct: 133 NPLPSRTSKTSQRLVLIPEEGDNVSKDDIRGNISSGLDRKRHTPIPKYNDEYYQPEPRTH 192

Query: 184 KEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKS 243
           K   +ARITAYNVA+GFNL+ L KFLQ+THEVSPR+YDECLYVAYTLPLLPGK GFRIKS
Sbjct: 193 K---LARITAYNVAEGFNLSLLSKFLQDTHEVSPRMYDECLYVAYTLPLLPGKDGFRIKS 249

Query: 244 NLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTT 303
           N+SKK +GG TLID LIDTSEQRDHHYEY+SGVET+EDANNNYEL  + +    N +   
Sbjct: 250 NVSKKFVGGMTLIDKLIDTSEQRDHHYEYFSGVETLEDANNNYELNPT-SPPMENVENQP 308

Query: 304 VPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERTERINML 346
           +P HLP P    D+FNP EPQFFAEETP+E + RE+ ER+N++
Sbjct: 309 IPTHLPVPPTNPDAFNPSEPQFFAEETPIEQKLREQNERLNIV 351

>KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 615

 Score =  433 bits (1113), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 220/236 (93%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           +HAEIFIF YGV+VFWNFTEIQEKNILGDI FA++ N++IRPLDEQDIETEQFHFEYD +
Sbjct: 375 QHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETEQFHFEYDMN 434

Query: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
            ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRISPIL +V+KLPKRLALYGT
Sbjct: 435 VERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGT 494

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY+AMREYLEIDQRVQ
Sbjct: 495 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRVQ 554

Query: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658
           VLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+ S+ EI VR  II +
Sbjct: 555 VLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRSFIIRQ 610

 Score =  311 bits (796), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 216/344 (62%), Gaps = 33/344 (9%)

Query: 7   QPSPG---EMPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKS---QGV-- 58
           Q  PG    M +RSPSILVTDAR+SK R+ APFAGHAAG R     A   KS   QG   
Sbjct: 8   QEGPGRRTSMSRRSPSILVTDARSSKKRIGAPFAGHAAGLRGG--RAAREKSDTYQGFSA 65

Query: 59  --RSSAIGPSPLQSFTHPRRRS------SGRFSDISIDNILSDNSDIXXXXXXXXXXXXX 110
             R S  G S   S   P RRS       G+FSDISIDNILSD SD+             
Sbjct: 66  SSRGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISS 125

Query: 111 XXXX--XQYERLSSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNAL--DRQRP 166
                   +       K+INPLPPRTSKTS+KLVLIPED +  +      NAL  +R+RP
Sbjct: 126 HEMAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKN------NALQMERRRP 179

Query: 167 KVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYV 226
               +K N  D   + + ++ M+RITAYNVA+GF ++    FL+ TH+VSPRLYDECLYV
Sbjct: 180 ----LKYNRHDPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDECLYV 235

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNY 286
            Y LPLLPGK GFRIKSN+SKKT+GGKTLID LID SEQRDHHYEYYSGVETVED NNN+
Sbjct: 236 PYCLPLLPGKDGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNF 295

Query: 287 ELETSGNNNNANQDTTTVPDHLP-NPVGQQDSFNPMEPQFFAEE 329
           EL  +   +N   D+   PDHLP N      SF+P EPQFFAEE
Sbjct: 296 ELSDTAGKDNERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEE 339

>Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR048W
           - Hypothetical ORF [contig 344] FULL
          Length = 616

 Score =  431 bits (1108), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/236 (85%), Positives = 218/236 (92%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           RHAEIFIF YGV+VFWNFTEIQEKNILGDI FADY NL+IRPLDEQDIETE FHF+YD +
Sbjct: 376 RHAEIFIFRYGVVVFWNFTEIQEKNILGDIAFADYDNLVIRPLDEQDIETEHFHFDYDME 435

Query: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
            ERPRIFNDI+TLRSGDHII+LTLSH+IAQS+KLSRFESRISPIL +V+KLPKRLALYGT
Sbjct: 436 VERPRIFNDIITLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKLPKRLALYGT 495

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY+AMREYLEIDQR Q
Sbjct: 496 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMREYLEIDQRAQ 555

Query: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658
           VLNDRCKVFLEFFDICVDSVAERNMAR+TWWFI VI   V+ S+ EI VR  I+ R
Sbjct: 556 VLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSIGEIVVRSFIVRR 611

 Score =  294 bits (753), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 178/354 (50%), Positives = 213/354 (60%), Gaps = 54/354 (15%)

Query: 7   QPSPGE---MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRSSAI 63
           Q  PG    M +RSPSILVTDAR+++NR  APFAGHAAG             QG RSS  
Sbjct: 8   QEGPGRRTVMSRRSPSILVTDARSNRNRNGAPFAGHAAGL------------QGGRSSKE 55

Query: 64  GPSPLQSFTH--------------------PRRRSS------GRFSDISIDNILSDNSDI 97
           G   L   T                     P RRS       G+FSDIS+DNILSD SD+
Sbjct: 56  GKDALSQRTAHVSRTSMRRSSSSGSSSDLMPLRRSKAKLRQQGKFSDISVDNILSDISDV 115

Query: 98  -XXXXXXXXXXXXXXXXXXQYERLSSRRKMINPLPPRTSKTSQKLVLIPED-DNLNHFQT 155
                              ++ R +   K+INPLP RTSKTS+KLVLIPE+ D  N F  
Sbjct: 116 PSGRREERLSTSSQEWSSSRFGRSAQYTKLINPLPSRTSKTSKKLVLIPEELDRKNGFV- 174

Query: 156 LPTNALDRQRPKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEV 215
                ++R+ P+      N F+   R +  + ++RITAYNVA+GF+L+ + KFL+ TH+V
Sbjct: 175 ----QMERRWPR---KNKNDFEN--RENPSEELSRITAYNVAEGFDLDLVSKFLRNTHDV 225

Query: 216 SPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSG 275
           SPRLYDECLYV Y LPLLPGK GFR+KSN+SKKT+GGKTLID LID SEQRDHHYEYYSG
Sbjct: 226 SPRLYDECLYVPYCLPLLPGKDGFRLKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSG 285

Query: 276 VETVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVGQQD-SFNPMEPQFFAE 328
           VETVED NNNYEL    N +    D    PDHLP+ +     SF+P EPQFFAE
Sbjct: 286 VETVEDMNNNYELNEVTNKDPDRNDVVPTPDHLPSVINSNTASFDPSEPQFFAE 339

>TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON}
           Anc_3.568 YFR048W
          Length = 623

 Score =  430 bits (1106), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/237 (82%), Positives = 219/237 (92%)

Query: 422 DRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDR 481
           D+HAEIFIFHYGVIVFWNF EIQEKNILGD+ FAD KNL+ RPL E+DIE EQFHF YDR
Sbjct: 386 DQHAEIFIFHYGVIVFWNFQEIQEKNILGDVAFADSKNLLTRPLSEEDIEIEQFHFAYDR 445

Query: 482 DTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYG 541
            TERP IFND +TLRSGDHI++LTLSHAIAQSSKLSRFESR++PIL S+TKLPKRLALYG
Sbjct: 446 HTERPSIFNDTITLRSGDHIMKLTLSHAIAQSSKLSRFESRVTPILHSITKLPKRLALYG 505

Query: 542 TLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 601
           TLGLKREQLLK+SGKLFKLRVDVNLSS++LDTPEFFWS EPSLHPLY+AMREYLEIDQRV
Sbjct: 506 TLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSLEPSLHPLYIAMREYLEIDQRV 565

Query: 602 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658
           QVLNDRC VFLEFFDICVDSVAER++ RVTWWF+ VI+  VIFSL EIF+RY++I++
Sbjct: 566 QVLNDRCMVFLEFFDICVDSVAERSIVRVTWWFVFVIIICVIFSLIEIFIRYILINK 622

 Score =  292 bits (747), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 165/330 (50%), Positives = 205/330 (62%), Gaps = 22/330 (6%)

Query: 20  ILVTDARTSKNRMSAPFAGHAAGSRKNMEN-------AGVTKSQGVRSSAIGPSPLQSFT 72
           ILVTD+R+++NR++APFA HAAG R    N       +    S GV +S      L    
Sbjct: 32  ILVTDSRSNRNRINAPFARHAAGLRDRNSNFVGPSADSRKNSSNGVFASPKSHQKLHMNN 91

Query: 73  HPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERLSS--RRKMINPL 130
              +   GRFS IS+DNILSD+SD+                   YE+  +   +K +N L
Sbjct: 92  KHDQVLRGRFSGISVDNILSDSSDVPSGRREERRSSSSWDRLSVYEKFKAYPNQKKLNHL 151

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK---- 186
           P RTSKTSQKLVLIPED   + + +  +N   RQ+P    +K +  +    Y   K    
Sbjct: 152 PSRTSKTSQKLVLIPEDIPGSEYSSPLSNL--RQKPVSSPIKQSRINSTDYYDSSKIRPH 209

Query: 187 -----SMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRI 241
                 + R+TAYN+AD  NL  + KFL+ETHEVS RLY+ECLYVAYTLPLL GK GFRI
Sbjct: 210 NQNYDDLPRLTAYNIADALNLKSISKFLKETHEVSSRLYNECLYVAYTLPLLSGKDGFRI 269

Query: 242 KSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDT 301
           KSN+SKK +GGKTLID LIDTSEQRDHHYEYYSG+E  EDA+NNYELE +G    A  D 
Sbjct: 270 KSNISKKVIGGKTLIDELIDTSEQRDHHYEYYSGIENPEDASNNYELEANG--IPAENDV 327

Query: 302 TTVPDHLPNPVGQQDSFNPMEPQFFAEETP 331
           T +PDHLP+     D+FNP +PQ+FAEETP
Sbjct: 328 TVIPDHLPSVTNSTDAFNPGDPQYFAEETP 357

>KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON}
           weakly similar to uniprot|P43620 Saccharomyces
           cerevisiae YFR048W RMD8 Cytosolic protein required for
           sporulation
          Length = 591

 Score =  427 bits (1097), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 197/240 (82%), Positives = 216/240 (90%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           +HAEIFIF YGV+VFWNFTEIQEKNILGDI+F+ YKN++++PLDEQDIE E FHFEYD D
Sbjct: 352 QHAEIFIFSYGVVVFWNFTEIQEKNILGDISFSSYKNMVLKPLDEQDIEIESFHFEYDMD 411

Query: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
           TERPRIFNDIVTLRSGDH+  LTLSHAIAQS KLSRFE+RI PI  SV+KLPKRLALYGT
Sbjct: 412 TERPRIFNDIVTLRSGDHLTALTLSHAIAQSVKLSRFEARIVPIFGSVSKLPKRLALYGT 471

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLH LY AMREYLEID RVQ
Sbjct: 472 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHSLYQAMREYLEIDPRVQ 531

Query: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRHTST 662
           VLNDRCKVFLEFFDICVDS+AERNMAR+TWWFI +I   V+ S+ EI VRY II +HT T
Sbjct: 532 VLNDRCKVFLEFFDICVDSIAERNMARITWWFITIIFISVLISIVEILVRYFIIKKHTGT 591

 Score =  288 bits (736), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 169/321 (52%), Positives = 204/321 (63%), Gaps = 32/321 (9%)

Query: 20  ILVTDARTSKNRMSAPFAGHAAG-------SRKNMENAGVTKSQGVRSSAIGPSPLQSFT 72
           ILVTDAR++KNR SAPFAGHAAG        R    + G T S+G R    G        
Sbjct: 24  ILVTDARSNKNRPSAPFAGHAAGMRNVSSVPRSAASSGGKTDSKGSRVRRRGYD-----M 78

Query: 73  HPRRRS-SGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQ-YERLSSRRKMINPL 130
           H  ++S S RFSD+S+DN+L D SD+                  +  +R +   KMINPL
Sbjct: 79  HGDKKSISSRFSDVSMDNLLLDVSDVPSGRRQERLSTSSYDMFPRNRQRGTHITKMINPL 138

Query: 131 PPRTSKTSQKLVLIPEDD----NLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK 186
           P RTSKTSQKLVLIP++     N+N F+     A   QR K  S          +  KE 
Sbjct: 139 PTRTSKTSQKLVLIPDEAHDSRNINQFRK---RANKTQRAKSSSKT--------KMDKEV 187

Query: 187 SMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLS 246
            + RITAYNVA+GFNL+    F+++TH+V PRLYDECLYV YTLPLLPGK GFRIKSN+S
Sbjct: 188 DLPRITAYNVAEGFNLSLTSTFMKQTHDVLPRLYDECLYVPYTLPLLPGKDGFRIKSNIS 247

Query: 247 KKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPD 306
           KKT GGK++ID LIDTSE+RDHHYEY+SGVET+ED NNNYEL+  G  NN N + T  PD
Sbjct: 248 KKTQGGKSIIDYLIDTSERRDHHYEYFSGVETLEDVNNNYELDEGGVTNNLNAENT--PD 305

Query: 307 HLPN-PVGQQDSFNPMEPQFF 326
           HLPN PV    SF+P EPQ+F
Sbjct: 306 HLPNPPVNTSVSFDPSEPQYF 326

>Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii AFR265C
          Length = 602

 Score =  427 bits (1097), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/235 (83%), Positives = 217/235 (92%)

Query: 425 AEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRDTE 484
           AEIFIF+YGV+VFWNFTEIQEKNILGDI F+D KN++IRPLDEQDIE EQFHFEYD +TE
Sbjct: 368 AEIFIFNYGVVVFWNFTEIQEKNILGDIAFSDMKNMVIRPLDEQDIEIEQFHFEYDMETE 427

Query: 485 RPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLG 544
           RPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RISPIL +V+KLPKRLALYGTLG
Sbjct: 428 RPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRISPILGTVSKLPKRLALYGTLG 487

Query: 545 LKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVL 604
           LKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQVL
Sbjct: 488 LKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDTRVQVL 547

Query: 605 NDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYVIIHRH 659
           N+RCKVFLEFFDICV+S+AER+MAR+TWW + VI   V+ S+ EI VRY II RH
Sbjct: 548 NERCKVFLEFFDICVNSIAERDMARITWWLVTVIFLSVLVSIAEILVRYFIIRRH 602

 Score =  269 bits (687), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 198/324 (61%), Gaps = 17/324 (5%)

Query: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMEN---AGVTKSQGVRSSAIGPSPLQ 69
           M +RSPSILVTD+R++K R SAPFAG+A   R  + N     +    G R +++      
Sbjct: 14  MSRRSPSILVTDSRSTKKRPSAPFAGNANTRRDKVGNIFPTVIENHSGKRIASLSGRDYI 73

Query: 70  SFTHPRRRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERLSSRRKMINP 129
                RR   G+FSD+S+D+ILS+ SD+                  +   L    KMINP
Sbjct: 74  PKHSTRRARQGKFSDVSMDSILSEMSDVPSGRREERLSSSSYDSYDRLRPLQYN-KMINP 132

Query: 130 LPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKSMA 189
           LP RTSKTS+K VLIPE+ +    Q               S+ +   D + + ++   + 
Sbjct: 133 LPSRTSKTSEKFVLIPEEGSKKFAQGFNKR----------SIYNADSDGIFKEARSHGLP 182

Query: 190 RITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKT 249
            + AYNVA+GFNL    KFL+ETH+VSPR YDECLYV Y LPLLPGK GFR++SN+SK+T
Sbjct: 183 SLMAYNVAEGFNLKLASKFLKETHDVSPRRYDECLYVPYCLPLLPGKNGFRLRSNISKQT 242

Query: 250 MGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPDHLP 309
           +GGKTL+D LIDTSEQRDHHYEYYSGVETVED  NN+E+    N+ +A  +    PDHL 
Sbjct: 243 IGGKTLMDRLIDTSEQRDHHYEYYSGVETVEDMRNNFEISEISNSRDA--EGLRSPDHLS 300

Query: 310 NPVGQQDSFNPMEPQFFAEETPLE 333
             +   ++FNP EPQ+FAEE  +E
Sbjct: 301 G-ISNSEAFNPGEPQYFAEEMSME 323

>AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR048W
           (RMD8)
          Length = 591

 Score =  411 bits (1057), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 188/230 (81%), Positives = 211/230 (91%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           +HAEIFIF+YGVIVFWNFTE++EKNILGDI F+  KN++ RPLDEQDIE EQFHFEYD D
Sbjct: 351 QHAEIFIFNYGVIVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMD 410

Query: 483 TERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
           TERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +V+KLPKRLALYGT
Sbjct: 411 TERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGT 470

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           LGLKREQLLKKSGKLFKLRVDVNLSS++LDTPEFFWSFEPSLHPLY AMREYLEID RVQ
Sbjct: 471 LGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQ 530

Query: 603 VLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVR 652
           VLNDRCKVFLEFFDICV+S+AE++MAR+TWW ++VI   V+ S  EI  R
Sbjct: 531 VLNDRCKVFLEFFDICVNSIAEKDMARITWWLVIVIFISVLVSTAEILAR 580

 Score =  266 bits (680), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 163/351 (46%), Positives = 208/351 (59%), Gaps = 30/351 (8%)

Query: 13  MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVTKSQGVRSSAIGPSPLQSFT 72
           M +RSPSILVTDAR++K R SAPFAG+A   R     +  T  +      +GP   + F 
Sbjct: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENRAGRRMGPMGGREFM 79

Query: 73  HPR----RRSSGRFSDISIDNILSDNSDIXXXXXXXXXXXXXXXXXXQYERLSSR-RKMI 127
            P+    R   G+FS++S+DNILS+ SD+                  +YER  +   K I
Sbjct: 80  -PKAGSGRTRQGKFSEVSMDNILSEMSDVPSGRRQERLSSSSF----EYERRPAHYNKTI 134

Query: 128 NPLPPRTSKTSQKLVLIPEDDNLNHF-QTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK 186
            PLP RTSKTS+K VLIP D+N+  F Q     +  R   ++   + N+           
Sbjct: 135 RPLPSRTSKTSEKFVLIP-DENVKRFAQGFHKRSASRVFSELSYGEHNT----------A 183

Query: 187 SMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLS 246
            +  ITAYNVA+GFNLN   +FL+ETH VS R YDECLYV Y LPLLPGK GFRI+SN+S
Sbjct: 184 GLPSITAYNVAEGFNLNLASQFLKETHNVSIRRYDECLYVPYCLPLLPGKDGFRIRSNVS 243

Query: 247 KKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELETSGNNNNANQDTTTVPD 306
           KK +GGKTLID LIDTSEQRDHHYEYYSGVETVED +NN+E+  +GN  +   D     D
Sbjct: 244 KKMVGGKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDP--DGLRNAD 301

Query: 307 HLPNPVGQQDSFNPMEPQFFAEET------PLEIEKRERTERINMLKKEEN 351
           HL        SF+P EPQFFAEE       P++    E+ ER  +L  +++
Sbjct: 302 HLAPLSSNMQSFDPSEPQFFAEELSEIGLHPIQDSSSEQHEREKVLDAQQH 352

>KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON}
           Anc_3.568 YFR048W
          Length = 607

 Score =  410 bits (1054), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 195/246 (79%), Positives = 222/246 (90%), Gaps = 2/246 (0%)

Query: 414 RDNDHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITF-ADYKNLMIRPLDEQDIET 472
           R  + E  D+HAEIFIFHYGVIVFWNFTE+QEKN+L DI+F  D K L+++PLDEQDIET
Sbjct: 360 RQANLEEEDQHAEIFIFHYGVIVFWNFTEMQEKNVLADISFFEDTKRLVLKPLDEQDIET 419

Query: 473 EQFHFEYDRDT-ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVT 531
           E+FHFEY++D  ERPRIFNDI+TLRS DH+I+LTLS+AIAQSSKLSRFESRISP+  +V 
Sbjct: 420 EEFHFEYNKDNNERPRIFNDIITLRSHDHMIKLTLSYAIAQSSKLSRFESRISPLFTAVI 479

Query: 532 KLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAM 591
           KLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS ILDTP FFWS EPSLHPLYVAM
Sbjct: 480 KLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSNILDTPGFFWSIEPSLHPLYVAM 539

Query: 592 REYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           REYLEID+RVQV+NDRCKVFLEFFDICVDSVAE+N+ARVT WF++VI+ GV+FS TEI V
Sbjct: 540 REYLEIDKRVQVVNDRCKVFLEFFDICVDSVAEKNIARVTLWFLVVIIVGVLFSFTEIVV 599

Query: 652 RYVIIH 657
           RY IIH
Sbjct: 600 RYNIIH 605

 Score =  265 bits (676), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/362 (47%), Positives = 214/362 (59%), Gaps = 53/362 (14%)

Query: 1   MSYKAN---------QPSPGEMPKRSPSILVTDARTSKNRMSAPFAGHAA-GSRKNMENA 50
           MSY  N         QPS   MPKRSPSILVTD+R+SKNRMSAPFAGHAA G+  +++  
Sbjct: 1   MSYSPNRQNRNGSSTQPS---MPKRSPSILVTDSRSSKNRMSAPFAGHAAFGTNSSVDPR 57

Query: 51  GVTKSQGVRSSAIGPSPLQSFTHPR-------RRSSGRFSDISIDNILSDNSDIXXXXXX 103
                QG    A           P+       RR  G+FSDIS+DNIL+DNS++      
Sbjct: 58  TGRPPQG----AFNDGNSTKMYRPKVINNTRIRRQPGKFSDISLDNILADNSEVPSGRRE 113

Query: 104 XXXXXXX-XXXXXQYERL---SSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTN 159
                          ERL   S ++KM+NPLP RTSK SQKLVLIPE++     +    N
Sbjct: 114 ERRSNSSWDRFPIGNERLHASSLKKKMMNPLPTRTSKISQKLVLIPEEELQ---KGRKAN 170

Query: 160 ALDRQ----RPKVGSMKSN---SFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQET 212
            L  Q    RP +G+++ N   + + LPR         +TAYN+A+GFNL  L  FL+ET
Sbjct: 171 FLKEQSHTKRPSLGNIEYNFKKTVNNLPR---------LTAYNIAEGFNLKVLSNFLEET 221

Query: 213 HEVSPRLYDECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEY 272
           H+VSPRLYD+CLYV Y LPLLPG+ GFR+KSN+SK+ +GGKTLID LIDTSEQRDHHYE+
Sbjct: 222 HDVSPRLYDDCLYVPYILPLLPGRDGFRVKSNISKRIVGGKTLIDRLIDTSEQRDHHYEF 281

Query: 273 YSGVE----TVEDANNNYELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFAE 328
           +SGVE    +  D  NN   +   N N  N +     D L      QD F+P EPQFFAE
Sbjct: 282 FSGVEDEVNSGPDTRNNPHDKL--NVNQVNTEELGPTDMLSINAVNQDVFDPSEPQFFAE 339

Query: 329 ET 330
           ++
Sbjct: 340 DS 341

>Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W
           (REAL)
          Length = 431

 Score =  173 bits (439), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 145/232 (62%), Gaps = 8/232 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 200 SDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY-YV 253

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 254 TKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAY 313

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  +ILD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 314 SGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLEINQ 372

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ S+  I V
Sbjct: 373 RVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 424

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 70/152 (46%), Gaps = 23/152 (15%)

Query: 126 MINPL---------PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSF 176
           MINP+           RTS+T+QKL L+PE+     FQ       + +  +V S  +   
Sbjct: 54  MINPISKQSRTGAGAQRTSRTAQKLKLLPEEP----FQRDGDGLTELKNQEVYSQVNRIK 109

Query: 177 DRLPRYSKEKS-------MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYV 226
           D+  R   EK        + R TAY  A  +N+ +L ++L+++   H   P+L+DECLY 
Sbjct: 110 DKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELIRWLKDSRKLHHTHPKLFDECLYT 169

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDN 258
            +      G   F  +  +     GG+ ++ +
Sbjct: 170 PFIYNDWRGDKRFEHEDVIRLDDEGGEIIVSD 201

>Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  173 bits (438), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 145/232 (62%), Gaps = 8/232 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 199 SDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY-YV 252

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 253 TKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAY 312

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 313 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 371

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ S+  I V
Sbjct: 372 RVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 69/152 (45%), Gaps = 23/152 (15%)

Query: 126 MINPL---------PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSF 176
           MINP+           RTS+T+QKL L+PE+     FQ       D +  +V S  +   
Sbjct: 53  MINPISKQSRTGAGAQRTSRTAQKLKLLPEEP----FQRDDEGLTDLKNQEVYSQVNRIK 108

Query: 177 DRLPRYSKEKS-------MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYV 226
           D+  R   EK        + R TAY  +  +N+ +L ++L++    H   P+L+DECLY 
Sbjct: 109 DKPARRDAEKLGKAHRHLLPRSTAYCTSSSYNMKELIRWLKDCRKIHHTHPKLFDECLYT 168

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDN 258
            +      G   F  +  +     GG+ ++ +
Sbjct: 169 PFIYNDWRGDKRFEHEDVIRLDDEGGEIIVSD 200

>YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}
           RMD1Cytoplasmic protein required for sporulation
          Length = 430

 Score =  173 bits (438), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 145/232 (62%), Gaps = 8/232 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 199 SDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY-YV 252

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 253 TKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAY 312

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 313 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 371

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ S+  I V
Sbjct: 372 RVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 68/152 (44%), Gaps = 23/152 (15%)

Query: 126 MINPL---------PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSF 176
           MINP            RTS+T+QKL L+PE+     FQ       D +  +V S  +   
Sbjct: 53  MINPTSKQSRTGSGAQRTSRTAQKLKLLPEEP----FQRDSERLTDLKNQEVYSQVNRIK 108

Query: 177 DRLPRYSKEKS-------MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYV 226
           D+  R   EK        + R TAY  A  +N+ +L ++L++    H   P+L+DECLY 
Sbjct: 109 DKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELVRWLKDCRKLHHTHPKLFDECLYT 168

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDN 258
            +      G   F  +  +     GG+ ++ +
Sbjct: 169 PFIYNDWRGDKRFEDEDVIRLDDEGGEIIVSD 200

>Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  172 bits (437), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/232 (37%), Positives = 145/232 (62%), Gaps = 8/232 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+H ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 199 SDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQVEEFNY-YV 252

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 253 TKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAY 312

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 313 SGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 371

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ S+  I V
Sbjct: 372 RVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIVV 423

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 69/152 (45%), Gaps = 23/152 (15%)

Query: 126 MINPL---------PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSF 176
           MINP+           RTS+T+QKL L+PE+     FQ       D +  +V S  +   
Sbjct: 53  MINPISKQSRTGAGAQRTSRTAQKLKLLPEEP----FQRDDEGLTDLKNQEVYSQVNRIK 108

Query: 177 DRLPRYSKEKS-------MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYV 226
           D+  R   EK        + R TAY  A  +N+ +L ++L++    H   P+L+DECLY 
Sbjct: 109 DKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELIRWLKDCRKIHHTHPKLFDECLYT 168

Query: 227 AYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDN 258
            +      G   F  +  +     GG+ ++ +
Sbjct: 169 PFIYNDWRGDKRFEHEDVIRLDDEGGEIIVSD 200

>NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON}
           Anc_3.209
          Length = 423

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 150/243 (61%), Gaps = 14/243 (5%)

Query: 405 DFDRVYKMHRDNDHEG----NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNL 460
           D D    + R +D  G    +D+H+E+FIF YGV+V W FTE +EK  L D+   + + L
Sbjct: 172 DHDAADDVIRLDDEGGEIDVSDKHSELFIFEYGVVVMWGFTEREEKCFLTDLERFEKEKL 231

Query: 461 MIRPLDEQDIETEQFHFEYDRDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRF 519
                 ++DI+ E+F++ Y   + +PRI+ND +TLR G +++++L++SHAIAQS K+S F
Sbjct: 232 A-----DEDIQVEEFNY-YVTKSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLF 285

Query: 520 ESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWS 579
           E  +   +     +P+ +A  G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS
Sbjct: 286 EELVDNTIEDTQDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS 345

Query: 580 FEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVIL 639
            EP L P+Y A R YLEI+QRV +LN R +V  +   +  + +   +   +   FI++IL
Sbjct: 346 -EPQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIIL 402

Query: 640 FGV 642
            GV
Sbjct: 403 VGV 405

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 50/101 (49%), Gaps = 4/101 (3%)

Query: 133 RTSKTSQKLVLIPEDD-NLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKSMARI 191
           RTS+T+QKL L+PE+  N    Q    N +  Q  ++  M +         +    + R 
Sbjct: 62  RTSRTTQKLKLLPEEPFNDKRKQPNGDNTVYSQVNRITDMPARKDAEKLGKAHRHLLPRA 121

Query: 192 TAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAYT 229
           T Y  A  +N+  L ++L+++   H   P+L+DECLY  + 
Sbjct: 122 TGYCTASSYNMRDLIRWLRDSRKIHHTHPKLFDECLYTPFV 162

>SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]
           {ON} highly similar to uniprot|Q05210 Saccharomyces
           cerevisiae YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 428

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 147/234 (62%), Gaps = 12/234 (5%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGVIV W FTE +EK +L D+   + + L      E+D++ EQF++ Y 
Sbjct: 197 SDKQPDLFIFEYGVIVMWGFTEREEKALLNDVEKFEKEKLA-----EEDVQVEQFNY-YI 250

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 251 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 310

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 311 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 369

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   +   FI+++L G  V+ S+  I V
Sbjct: 370 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIIIVLVGVEVLISVINIIV 421

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 15/108 (13%)

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK---- 186
           P RTS+T+QKL L+PE+     FQ      L+     V S  +   D+  R   EK    
Sbjct: 66  PQRTSRTAQKLKLLPEEP----FQR-KDEELELVDKDVYSQVNRITDKPARRDAEKLGKG 120

Query: 187 ---SMARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAY 228
               + R+TAY  A  +++ +L ++L++    H    +L+DECLY  +
Sbjct: 121 HRHLLPRVTAYCTASSYSMKELIRWLKDCKRIHHTHTKLFDECLYTPF 168

>KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3.209
           YDL001W
          Length = 405

 Score =  170 bits (430), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 148/233 (63%), Gaps = 12/233 (5%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++F+F YGV+V W FTE +EK  L DI   + + L      ++D++ E+F++ Y 
Sbjct: 175 SDKQPDLFVFEYGVVVMWGFTEREEKAFLSDIDRFEKEKLA-----DEDVQVEEFNY-YV 228

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L+++HAIAQS K+S FE  +   +     +P+ +AL
Sbjct: 229 TQSYQPRIYNDFITLRDGSNYMVKLSIAHAIAQSVKISFFEELVDNTIEDTQDIPQEIAL 288

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E+++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 289 SGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 347

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTEIF 650
           RV +LN R +V  +   +  + +   +   +   FI++IL G  V+ SL  +F
Sbjct: 348 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIILVGVEVVISLVNVF 398

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 60/143 (41%), Gaps = 17/143 (11%)

Query: 128 NPLPPRTSKTSQKLVLIPED----DNLNHFQTLPTNALDRQRP---KVGSMKSNSFDRLP 180
           N  P RTS+T+QKL L+PE+     N +   T          P    V S      D+  
Sbjct: 29  NVGPQRTSRTAQKLKLLPEEPFQRGNSSDTGTRTGGGASTLTPVDRDVYSQVDRILDKPA 88

Query: 181 RYSKEK-------SMARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAYTL 230
           R   EK        + R TAY  A  +N+ +L ++ +++   H    RL+DECLY  +  
Sbjct: 89  RRDAEKLGKAHRHLLPRCTAYCTASSYNMRELIRWFKDSKKVHHTHARLFDECLYTPFMY 148

Query: 231 PLLPGKGGFRIKSNLSKKTMGGK 253
               G   F  +  +     GG+
Sbjct: 149 TDWRGDKRFEHEDVIRLDAEGGE 171

>TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.209
           YDL001W
          Length = 438

 Score =  170 bits (431), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 144/232 (62%), Gaps = 8/232 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  E++IF YGVIV W FTE +EK  L D+   + + L      E+D++ E+F++ Y 
Sbjct: 207 SDKQPELYIFEYGVIVLWGFTEREEKAFLNDLERFEKEKLA-----EEDVQVEEFNY-YV 260

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 261 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAC 320

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 321 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 379

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ ++  I V
Sbjct: 380 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGMEVLIAVVNIAV 431

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 70/154 (45%), Gaps = 21/154 (13%)

Query: 133 RTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS----- 187
           RTS+T+QKL L+PE+     FQ        R R  V S  S   D+  R   EK      
Sbjct: 78  RTSRTAQKLKLLPEEP----FQRDEEMQELRDR-DVYSQVSRITDKPARRDAEKLGKGHR 132

Query: 188 --MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAYTLPLLPGKGGFRIK 242
             + R TAY  A  +++ +L K+L++    H   P+L+DECLY  +      G   F  +
Sbjct: 133 HLLPRATAYCTASSYHMKELIKWLKDCRKIHHTHPKLFDECLYTPFMYNDWRGDKRFEHE 192

Query: 243 SNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGV 276
             +     GG+      I+ S+++   Y +  GV
Sbjct: 193 DVIRLDDEGGE------INVSDKQPELYIFEYGV 220

>TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209
           YDL001W
          Length = 505

 Score =  171 bits (434), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/237 (37%), Positives = 148/237 (62%), Gaps = 12/237 (5%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGVIV W F E +E+ +L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 274 SDKQPDLFIFEYGVIVMWGFIEREEQALLADIERFEREKLA-----EEDIQIEEFNY-YV 327

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+ +AL
Sbjct: 328 TQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQGIPQEIAL 387

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 388 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 446

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTEIFVRYV 654
           RV +LN R +V  +   +  + +   +   +   FI+++L G  V+ SL  I V  +
Sbjct: 447 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIVLVGVEVLISLINIAVDLI 501

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 57/112 (50%), Gaps = 20/112 (17%)

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLP----TNALDRQRPKVGSMKSNSFDRLPRYSKEK 186
           P RTS+T++KL L+PE      FQ  P    T+    Q  +V S  +   D+  R   EK
Sbjct: 140 PQRTSRTARKLKLLPE----GPFQMTPAEFQTDIFPEQ--EVYSQVNRITDKNARRDAEK 193

Query: 187 S-------MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAY 228
                   + R TAY  A  +N+  L  +L+ET   H+ +P+L+DECLY  +
Sbjct: 194 LGKAHRHLLPRTTAYCTASSYNMRGLIHWLKETKKAHQTTPKLFDECLYTPF 245

>NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa]
           {ON} Anc_3.209
          Length = 522

 Score =  171 bits (433), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 141/230 (61%), Gaps = 8/230 (3%)

Query: 423 RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRD 482
           R+ ++FIF YGVIV W FTE +EK  L D+     +      L E+DI+ E+F++ Y   
Sbjct: 292 RYPDLFIFEYGVIVMWGFTEREEKRFLNDL-----EKFEKEKLAEEDIQIEEFNY-YVTK 345

Query: 483 TERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYG 541
           + +PRI+ND +TLR G +++ +L++SHAIAQS K+S FE  +   +     +P+ +A  G
Sbjct: 346 SYQPRIYNDFITLRDGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSG 405

Query: 542 TLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRV 601
            + + +E+++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+QRV
Sbjct: 406 KVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRV 464

Query: 602 QVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFV 651
            +LN R +V  +   +  + +   +   + +  I ++   VI SL  I V
Sbjct: 465 ALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIFLVAVEVIISLVNIAV 514

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 55/126 (43%), Gaps = 29/126 (23%)

Query: 133 RTSKTSQKLVLIPED---------------DNLNHFQTLPTNALDRQR----PKVGSMKS 173
           R+S+TSQKL L+P++               D   +   +  N   R R     +V S  +
Sbjct: 106 RSSRTSQKLKLLPDEPFLDYDNSGNRASGNDVGGYITGIVNNKTGRNRVGGNEEVYSQVN 165

Query: 174 NSFDRLPRYSKEK-------SMARITAYNVADGFNLNQLYKFLQE---THEVSPRLYDEC 223
              D+  R   EK        + R T Y  A  +N+ +L ++L++    +   P+L+DEC
Sbjct: 166 KIMDKPARKDAEKLGKAHRHLLPRTTGYCTASSYNMRELIRWLRDFSGVYHTHPKLFDEC 225

Query: 224 LYVAYT 229
           LY  + 
Sbjct: 226 LYTPFV 231

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score =  168 bits (425), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 147/234 (62%), Gaps = 12/234 (5%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ EQF++ Y 
Sbjct: 177 SDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLEKFEKEKLA-----EEDVQLEQFNY-YI 230

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +     +P+++A 
Sbjct: 231 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIAS 290

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 291 SGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 349

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   +   FI+++L G  V+ SL  I V
Sbjct: 350 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIIIVLVGVEVLVSLINIIV 401

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 61/122 (50%), Gaps = 14/122 (11%)

Query: 117 YERLSSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSF 176
           +E  SS  K     P RTS+T+QKL L+PE +  N  Q    ++ DR+   V S      
Sbjct: 31  HEDKSSAVKASRVGPQRTSRTTQKLKLLPE-EPFNRQQDELLSSTDRE---VYSQVGRIT 86

Query: 177 DRLPRYSKEK-------SMARITAYNVADGFNLNQLYKFLQE---THEVSPRLYDECLYV 226
           D   R   EK        + R+TAY  +  +N+ +L ++L++    H   P+L+DECL+ 
Sbjct: 87  DTPARRDAEKLGKGQRHLLPRVTAYCTSSSYNMKELIRWLKDCKKVHHTHPKLFDECLFT 146

Query: 227 AY 228
            +
Sbjct: 147 PF 148

>KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 408

 Score =  168 bits (425), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 89/234 (38%), Positives = 146/234 (62%), Gaps = 12/234 (5%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGVIV W FTE +EK  L D+   + + L      E+D++ EQF++ Y 
Sbjct: 177 SDKQPDLFIFEYGVIVMWGFTEREEKAFLNDVEKFEKEKLA-----EEDVQVEQFNY-YI 230

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +     +P+++A 
Sbjct: 231 TQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQQIAS 290

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +  ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 291 SGKVSMGKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHATRGYLEINQ 349

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTEIFV 651
           RV +LN R +V  +   +  + +   +   +   FI+++L G  V+ SL  I V
Sbjct: 350 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIIIVLVGVEVLISLINIVV 401

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 14/131 (10%)

Query: 133 RTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS----- 187
           RTS+T+QKL L+PE+   N  + L     DR    V S  +   D   R   EK      
Sbjct: 47  RTSRTAQKLKLLPEEP-FNRPEDLLLGNADRD---VYSQVNRITDTPARRDAEKLGKGQR 102

Query: 188 --MARITAYNVADGFNLNQLYKFLQ---ETHEVSPRLYDECLYVAYTLPLLPGKGGFRIK 242
             + R+TAY  +  +N+ +L ++L+   + H   P+L+DECL+  +      G   F+ +
Sbjct: 103 HLLPRVTAYCTSSAYNMKELVRWLKGCKKAHHTHPKLFDECLFTPFIYTDWRGDKRFKDE 162

Query: 243 SNLSKKTMGGK 253
             +     GG+
Sbjct: 163 DVIRLDDEGGE 173

>CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|Q03441 Saccharomyces
           cerevisiae YDL001w
          Length = 432

 Score =  168 bits (425), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 133/204 (65%), Gaps = 8/204 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+H +IFIF YGVIV W FTE +EK  L D+   + + L      E+DI+ E+F++ Y 
Sbjct: 201 SDKHPDIFIFEYGVIVLWGFTEREEKAFLNDLEKFEKEKLA-----EEDIQIEEFNY-YV 254

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 255 TQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 314

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E+++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 315 SGKVSMSKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 373

Query: 600 RVQVLNDRCKVFLEFFDICVDSVA 623
           RV +LN R +V  +   +  + + 
Sbjct: 374 RVALLNQRLEVISDLLQMLKEQLG 397

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 53/106 (50%), Gaps = 15/106 (14%)

Query: 133 RTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS----- 187
           RTS+T+QKL L+PE+    H     +   DR    V S  +   D+  R   EK      
Sbjct: 72  RTSRTAQKLKLLPEE--AFHRDEEVSELRDRD---VYSQVNRITDKNARRDAEKLGKAHR 126

Query: 188 --MARITAYNVADGFNLNQLYKFLQE---THEVSPRLYDECLYVAY 228
             + R T+Y  A  +N+  L ++L++   TH   P+L+DECLY  +
Sbjct: 127 HLLPRCTSYCTASSYNMKDLIRWLKDSKKTHHTHPKLFDECLYTPF 172

>Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON}
           (139329..140672) [1344 nt, 448 aa]
          Length = 447

 Score =  168 bits (425), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 142/223 (63%), Gaps = 10/223 (4%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGV+V W FTE +EK  L DI   + + L      E+D++ E+F++ Y 
Sbjct: 214 SDKQPDVFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDVQVEEFNY-YI 267

Query: 481 RDTERPRIFNDIVTLR-SGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
            ++ +PRI+ND +TLR + +++I+L++SH +AQS K+S FE  +   +     +P+ +A 
Sbjct: 268 TESYQPRIYNDFITLRDASNYMIKLSISHGLAQSVKISLFEELVDNTIEDTQDIPQEIAS 327

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y AMR YLEI+Q
Sbjct: 328 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQAMRGYLEINQ 386

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGV 642
           RV +LN R +V  +   +  + +   +   +   FI++IL GV
Sbjct: 387 RVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIILVGV 427

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 14/106 (13%)

Query: 133 RTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS----- 187
           RTS+T+QKL L+PE+     F+  P N +  +   V +  +   D+  R   EK      
Sbjct: 84  RTSRTAQKLKLLPEEP----FKIDPENLIALRDQDVYTQVNRITDKNARRDAEKLGKAHR 139

Query: 188 --MARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAY 228
             + R TAY  A  +N+  L K+L+++   H   P+L+DECLY  +
Sbjct: 140 HLLPRTTAYCTASSYNMRGLIKWLKDSKKAHHTHPKLFDECLYTPF 185

>Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar to
           Ashbya gossypii AEL004W
          Length = 477

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 143/235 (60%), Gaps = 8/235 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
            D+  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ E+F++ Y 
Sbjct: 244 GDKQPDLFIFEYGVVVMWGFTEREEKAFLNDVEKFEKEKLA-----EEDVQVEEFNY-YV 297

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAI+QS K+S FE  +   +     +P+ +A 
Sbjct: 298 TQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIAS 357

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +  ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 358 SGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 416

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYV 654
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ SL  I V  +
Sbjct: 417 RVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLVGVEVLISLINIIVDII 471

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 14/108 (12%)

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS--- 187
           P RTS+T+QKL L+PE+     FQ +     D     V S  +   D+  R   EK    
Sbjct: 112 PQRTSRTAQKLKLLPEEP----FQRIREQDCDIIDRDVYSQVNRITDKPARRDAEKLGKS 167

Query: 188 ----MARITAYNVADGFNLNQLYKFLQ---ETHEVSPRLYDECLYVAY 228
               + R TAY  A  +N+ +L ++L+   +TH   P+L+DECLY  +
Sbjct: 168 QRHLLPRATAYCTASSYNMKELVRWLKYCKKTHHTHPKLFDECLYTPF 215

>ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} similar
           to uniprot|Q05210 Saccharomyces cerevisiae YDL001W RMD1
           Cytoplasmic protein required for sporulation
          Length = 458

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 143/230 (62%), Gaps = 8/230 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++F+F YGV+V W FTE +EK  L DI   + + L      E+D++ E+F++ Y 
Sbjct: 227 SDKQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEKLA-----EEDVQIEEFNY-YV 280

Query: 481 RDTERPRIFNDIVTLR-SGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR + +++I+L++SHAIAQS K+S FE  +   +     +P+ +A 
Sbjct: 281 TQSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIAS 340

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 341 SGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 399

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEI 649
           RV +LN R +V  +   +  + +   +   + +  IL++   VI S+  I
Sbjct: 400 RVALLNQRLEVVSDLLQMLKEQLGHSHEEYLEFIVILLVGVEVIISVVNI 449

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 60/119 (50%), Gaps = 15/119 (12%)

Query: 120 LSSRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRL 179
           L +  K I     RTS+T+QKL L+PE+     FQ     +LD +   V S  +   D+ 
Sbjct: 85  LRAPNKQIRTGAQRTSRTAQKLKLLPEEP----FQR-DEESLDLRDRDVYSQVNRITDKP 139

Query: 180 PRYSKEK-------SMARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAY 228
            R   EK        + R TAY  A G+++ +L ++L+E    H   P+L+DEC+Y  +
Sbjct: 140 ARRDAEKLGKSHRHLLPRATAYCTASGYSMRELVRWLKECKKIHHTHPKLFDECIYTPF 198

>KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {ON}
           Anc_3.209 YDL001W
          Length = 466

 Score =  167 bits (422), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/246 (36%), Positives = 151/246 (61%), Gaps = 17/246 (6%)

Query: 417 DHEG-----NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIE 471
           D EG     +D+  ++FIF YGVIV W FTE +EK  L DI   + + L      E+D++
Sbjct: 226 DDEGGEINVSDKQPDLFIFEYGVIVMWGFTEREEKAFLNDIERFEKEKLA-----EEDVQ 280

Query: 472 TEQFHFEYDRDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISV 530
            E+F++ Y   + +PRI+ND +TLR+G +++ +L++SHAIAQS K+S FE  +   +   
Sbjct: 281 VEEFNY-YVTQSYQPRIYNDFITLRNGSNYMTKLSISHAIAQSVKISLFEELVDNTIEDT 339

Query: 531 TKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVA 590
             +P+++A  G + + +E +++  G+LF LR+++NL  ++LD+P+  WS EP L P+Y A
Sbjct: 340 EDIPQQIASSGKVSMSKEDIMRSIGELFILRININLHGSVLDSPDIMWS-EPQLEPIYQA 398

Query: 591 MREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFG--VIFSLTE 648
            R YLEI+QRV++LN R +V  +   +  + +       +   FI++IL G  V+ S+  
Sbjct: 399 TRGYLEINQRVELLNQRLEVVSDLLQMLKEQLGHSQEEYLE--FIVIILVGVEVLISVIN 456

Query: 649 IFVRYV 654
           I V  +
Sbjct: 457 IAVDMI 462

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 10/106 (9%)

Query: 133 RTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK------ 186
           RTS+T+QKL L+PE+             ++ +  +V S  +   D+  R   +K      
Sbjct: 101 RTSRTAQKLKLLPEEAFAKESSIDSGITVNDEDREVYSQVNRIKDKPARIDAQKLGKAHR 160

Query: 187 -SMARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAY 228
             + R TAY  A  +N+ +L ++++ +   H   P+L+DECL+  +
Sbjct: 161 HLLPRCTAYCTASSYNMRELIRWIKNSKKIHFTHPKLFDECLFTPF 206

>TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {ON}
           Anc_3.209 YDL001W
          Length = 446

 Score =  166 bits (421), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 87/230 (37%), Positives = 143/230 (62%), Gaps = 10/230 (4%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGV+V W FTE +EK  L DI   + + L      E+DI+ E+F++ Y 
Sbjct: 215 SDKQPDVFIFEYGVVVLWGFTEREEKEFLNDIEKYEKEKLA-----EEDIQIEEFNY-YV 268

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
            ++ +PRI+ND +TLR G +++ +L++SHA++QS K+S FE  +   +     +P+ +A 
Sbjct: 269 TESYQPRIYNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDTQDIPQEIAS 328

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +E ++K  G+LF LR+++NL  +ILD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 329 SGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQATRGYLEINQ 387

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEI 649
           RV +LN R +V  +   +  + +       +   FI+++L GV   L+ I
Sbjct: 388 RVALLNQRLEVVSDLLQMLKEQLGHTQEEYLE--FIVIVLVGVEVLLSVI 435

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/120 (30%), Positives = 63/120 (52%), Gaps = 20/120 (16%)

Query: 122 SRRKMINPLPPRTSKTSQKLVLIPE---DDNLNHFQTLPTNALDRQRPKVGSMKSNSFDR 178
           ++ K +     RTS+T+QKL L+PE   D + N+F  LP N +  Q  ++        D+
Sbjct: 74  NKNKHVRSGAQRTSRTTQKLKLLPEEPYDLDHNNFPDLPENEVYSQVNRIK-------DK 126

Query: 179 LPRYSKEK-------SMARITAYNVADGFNLNQLYKFLQET-HEV--SPRLYDECLYVAY 228
             R   EK        + R+TA+  A  +N+  L ++L+++ H+    P+L+DECLY  +
Sbjct: 127 SARRDAEKLGKAHRHLLPRVTAFCTASSYNMRGLIRWLKDSKHQFRSHPKLFDECLYTPF 186

>AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL001W (RMD1)
          Length = 475

 Score =  166 bits (421), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 144/235 (61%), Gaps = 8/235 (3%)

Query: 421 NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD 480
           +D+  ++FIF YGV+V W FTE +EK  L D+   + + L      E+D++ E+F++ Y 
Sbjct: 244 SDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLERFEKEKLA-----EEDVQVEEFNY-YI 297

Query: 481 RDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
             + +PRI+ND +TLR G +++I+L++SHAI+QS K+S FE  +   +     +P+ +A 
Sbjct: 298 TQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEELVDNTIEDTQDIPQEIAS 357

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
            G + + +  ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A R YLEI+Q
Sbjct: 358 SGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQ 416

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYV 654
           RV +LN R +V  +   +  + +   +   + +  IL++   V+ S+  I V  V
Sbjct: 417 RVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLLGVEVLISVVNIIVDIV 471

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 14/108 (12%)

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEKS--- 187
           P RTS+T+QKL L+PE+      Q    +++DR+   V S  +   D+  R   EK    
Sbjct: 112 PQRTSRTAQKLKLLPEEP-FQRSQEQEDDSVDRE---VYSQVNRITDKPARRDAEKLGKS 167

Query: 188 ----MARITAYNVADGFNLNQLYKFLQE---THEVSPRLYDECLYVAY 228
               + R+TAY  A  +N+ +L ++L++   TH   P+L+DECLY  +
Sbjct: 168 HRHLLPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDECLYTPF 215

>KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 444

 Score =  162 bits (411), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 134/213 (62%), Gaps = 13/213 (6%)

Query: 417 DHEG-----NDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIE 471
           D EG     +D+  ++FIF YGVIV W FTE +EK  L D+   + + L      E+D++
Sbjct: 204 DDEGGEISTSDKQPDLFIFEYGVIVMWGFTEREEKAFLRDLERFEKEKLA-----EEDVQ 258

Query: 472 TEQFHFEYDRDTERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRISPILISV 530
            EQF++ Y   + +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +   
Sbjct: 259 VEQFNY-YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDT 317

Query: 531 TKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVA 590
             +P+ +A  G + + +E ++K  G+LF LR+++NL  ++LD+PE  WS EP L P+Y A
Sbjct: 318 QDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQA 376

Query: 591 MREYLEIDQRVQVLNDRCKVFLEFFDICVDSVA 623
            R YLEI+QRV ++N R +V  +   +  + + 
Sbjct: 377 TRGYLEINQRVALVNQRLEVISDLLQMLKEQLG 409

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 72/156 (46%), Gaps = 21/156 (13%)

Query: 131 PPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQRPKVGSMKSNSFDRLPRYSKEK---- 186
           P RTS+ +QKL L+P++     F+ +  +   + R  V S  +   D+  R   EK    
Sbjct: 82  PQRTSRKAQKLKLLPDE----AFERINEDDAPQDR-DVYSQVNRITDKPARRDAEKLGKN 136

Query: 187 ---SMARITAYNVADGFNLNQLYKFLQET---HEVSPRLYDECLYVAYTLPLLPGKGGFR 240
               + R+TAY  A  + + +L ++L++    +   P+L+DECLY  +      G   F 
Sbjct: 137 QRHLLPRVTAYCTASLYKMKELIRWLKDCKRFNHTHPKLFDECLYTPFIYTDWRGDKRFE 196

Query: 241 IKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGV 276
            +  +     GG+      I TS+++   + +  GV
Sbjct: 197 HEDVIRLDDEGGE------ISTSDKQPDLFIFEYGV 226

>Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON}
           YDR282C (REAL)
          Length = 413

 Score = 85.9 bits (211), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 118/266 (44%), Gaps = 42/266 (15%)

Query: 418 HEGNDRHAEIFIF-HYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFH 476
           ++ N    ++ I    G IV W F E   +N +  +     K   I PL E+D ETE   
Sbjct: 145 YQDNGTKGDLMILGQNGSIVGWGFGESTVRNKIVPLV----KAASINPLSEEDFETEDMD 200

Query: 477 F---EYDRDTERPRIFNDIVTLR-------SGDHII------------ELTLSHAIAQSS 514
           +   E  +D E+    N  VTL+       SGD I+            +   S  +++S+
Sbjct: 201 YVELEKKKDLEKLFSGNKNVTLKTVDQSFLSGDLILINSLDSDQGMLDKAAFSSGLSRST 260

Query: 515 KLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTP 574
            L+  E  +   +     + + ++   TL LK    LK  G+LF +R  +NL S +++TP
Sbjct: 261 NLAVLEEAMERHISKTRTITENISKGTTLKLKSSDALKSIGRLFLIRGKLNLYSELIETP 320

Query: 575 EFFWSFEPSLHPLYVAMREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNM 627
           + +WS EP L  ++  +  YL+I  R+ +LN       D C+  +   +       ER  
Sbjct: 321 DLYWS-EPQLELIFKNVSRYLDIVPRINILNSKLDYSTDECRALISLLN-------ERKG 372

Query: 628 ARVTWWFILVILFGVIFSLTEIFVRY 653
             + W  I +I F + F L  ++ RY
Sbjct: 373 TFLEWIIIYLIAFELCFELFHLYQRY 398

>YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function
          Length = 414

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 123/270 (45%), Gaps = 45/270 (16%)

Query: 413 HRDNDHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIET 472
           ++DN ++G+     + +   G IV W F+E   +N +  I  A   N    PL+ +D ET
Sbjct: 145 YQDNGNKGD----VMILGQNGSIVSWGFSESSVRNCIVPIVKAASLN----PLNGEDFET 196

Query: 473 EQFHF---EYDRDTERPRIFNDIVTLR-------SGDHII------------ELTLSHAI 510
           E   +   E ++D ++    ++ VT R       SGD II            +   S  +
Sbjct: 197 EDMDYVEIEGEQDFDKLSSLDNKVTPRIACESFLSGDLIIINSLDSDQGMLDKAAFSSGL 256

Query: 511 AQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTI 570
           ++S+ L+  E  +   +     + + ++    L L+    LK  G+LF +R  +NL S +
Sbjct: 257 SRSTNLAVLEEAMEKHISKTRTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSEL 316

Query: 571 LDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVA 623
           ++TP+ +WS EP L  ++  +  YL+I  R+ +LN       D C+  +   +       
Sbjct: 317 IETPDLYWS-EPQLEEIFKNVSRYLDIGPRINILNSKLDYSTDECRALISLLN------- 368

Query: 624 ERNMARVTWWFILVILFGVIFSLTEIFVRY 653
           ERN   + W  I +I F + F +   + +Y
Sbjct: 369 ERNSTFLEWIIIYLIAFELCFEIYHFYQKY 398

>Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON}
           YDR282C (REAL)
          Length = 417

 Score = 81.6 bits (200), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 116/270 (42%), Gaps = 46/270 (17%)

Query: 418 HEGNDRHAEIFIF-HYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFH 476
           ++ N    +I I    G IV W F E    + + D      +   I PL ++D ETE   
Sbjct: 145 YQDNGVKGDIMILGQNGSIVSWGFGE----STVRDKIVPLVEGASINPLAKEDFETEDMD 200

Query: 477 F---EYDRDTER---------PRIFNDIVTLRSGDHII------------ELTLSHAIAQ 512
           +      +D E+         PR  N+  +  SGD I+            +   S  +++
Sbjct: 201 YVELAKKQDLEKFFSGNNEVKPRFVNE--SFLSGDLILINSLDADQGMLDKAAFSSGLSR 258

Query: 513 SSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILD 572
           S+ L+  E  +   +     + + ++    L LK    LK  G+LF +R  +NL S + +
Sbjct: 259 STNLAVLEEALEKHISKTRTITENISKGTKLNLKSSDALKSIGRLFLIRGKLNLYSELTE 318

Query: 573 TPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAER 625
           TP+ +WS EP L  ++  +  YL+I  R+ +LN       D C+  +   +       ER
Sbjct: 319 TPDLYWS-EPQLEEIFKKVSRYLDIGPRINILNSKLDYSTDECRALISLLN-------ER 370

Query: 626 NMARVTWWFILVILFGVIFSLTEIFVRYVI 655
           N A + W  I +I F + F +   + RY +
Sbjct: 371 NGAFLEWIIIYLIAFELCFEVYHFYQRYYL 400

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 79.0 bits (193), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 118/268 (44%), Gaps = 42/268 (15%)

Query: 418 HEGNDRHAEIFIF-HYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFH 476
           ++ N    +I I    G IV W F E   +N +  +  A      I PL  Q+ ETE   
Sbjct: 145 YQDNGNKGDIMILGQNGSIVSWGFDESSVRNKIVPLIEA----ASINPLSAQNFETEDMD 200

Query: 477 F-EYDRDTERPRIFN-----------------DIVTLRSGDH----IIELTLSHAIAQSS 514
           + E +++ +  + FN                 D++ + S D     + +   S  +++S+
Sbjct: 201 YVELEKNQDLEKYFNRNSKLTPKNADQSFLCGDLILINSLDSDQGMLDKAAFSSGLSRST 260

Query: 515 KLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTP 574
            L+  E  +   ++    + + ++    L LK    LK  G+LF +R  +NL S +++TP
Sbjct: 261 NLAVLEEAMEKHILKTRTITENISRGTKLNLKSSDALKSIGRLFLIRGKLNLYSELIETP 320

Query: 575 EFFWSFEPSLHPLYVAMREYLEIDQRVQVLN-------DRCKVFLEFFDICVDSVAERNM 627
           + +WS EP L  ++  +  YL+I  R+ +LN       D C+  +   +       ERN 
Sbjct: 321 DLYWS-EPQLEEIFKNVSRYLDIAPRINILNSKLDYSTDECRALISLLN-------ERNS 372

Query: 628 ARVTWWFILVILFGVIFSLTEIFVRYVI 655
             + W  I +I F + F +   + ++ +
Sbjct: 373 TFLEWIIIYLIAFELCFEIYHFYQKHFL 400

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 75.9 bits (185), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 114/259 (44%), Gaps = 27/259 (10%)

Query: 418 HEGNDRHAEIFIFHYGVIVFWNFTEI-QEKNILGDITFADYKNLMIRPLDEQDIETEQFH 476
           H+G+     I I   G +V W   E  Q +NIL  +  A      I PL E+  E+E   
Sbjct: 104 HDGHQGDVMI-IRQNGTVVAWGLDESSQMENILPLVDEA-----RINPLKEKQYESEDLD 157

Query: 477 FEYDRDTERPRIFNDIV-------TLRSGDHII------------ELTLSHAIAQSSKLS 517
           +     TE     +DI        +   GD I+            +  LS  +++S++LS
Sbjct: 158 YVELDTTESWTQLHDITNRGEANESFVEGDLIVINSISANHGMLDKAALSGGLSRSTRLS 217

Query: 518 RFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFF 577
             E+ +   +    K  + L+    L      +L+ +G+LF +R ++NL S +++TP+ +
Sbjct: 218 VLEAALESHIAKTKKFTELLSSGKKLNFTENHILESTGRLFLIRGNLNLYSELIETPDLY 277

Query: 578 WSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILV 637
           WS EP L  LY  +   L+I  R+ +LN +     +     +  + E+   ++ W  I +
Sbjct: 278 WS-EPDLEKLYEKISRNLDIQPRITILNKKLDYATDESRALLSVLNEKKSTKLEWIIIWL 336

Query: 638 ILFGVIFSLTEIFVRYVII 656
           I   V F L   + +Y  I
Sbjct: 337 ISVEVCFELFHFYEKYKTI 355

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 64/255 (25%), Positives = 114/255 (44%), Gaps = 26/255 (10%)

Query: 421 NDRHAEIFIF-HYGVIVFWNFTE-IQEKNILGDITFADYKNLMIRPLDEQDIETEQFHF- 477
           N  H++I +  + G +V W   E    +NIL  I         + PL E+ +E+E   F 
Sbjct: 133 NGCHSDIMVLGNSGTVVAWGLEESFVFENILPLIEHGR-----VNPLTEECVESEDLDFL 187

Query: 478 --EYDRDTERPR-----------IFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFE 520
             E   D E+ R           +  D++ + + D  + L      S  +++S++L+  E
Sbjct: 188 QVENAEDLEKVRQITNRSAPESFVEGDLIIVNAIDSDLGLLDKAAFSSGMSRSTRLAVLE 247

Query: 521 SRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSF 580
             +   +    K  + L+    L L   ++L+ +G LF +R  +NL S +++TP+ +WS 
Sbjct: 248 HLLEAHIEKSRKFTELLSQGKKLSLTESEVLQSTGSLFLIRGKLNLYSELIETPDLYWS- 306

Query: 581 EPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILF 640
           EP L  +Y  M   L+I  R+ +LN +     E     +  + E+    + W  I +I  
Sbjct: 307 EPQLERIYKQMSRSLDIQPRISILNTKLDYATEESRAFMAVLNEKKSTHLEWIIIYLITV 366

Query: 641 GVIFSLTEIFVRYVI 655
            V F L   + RY +
Sbjct: 367 EVFFELHHYYERYWV 381

>KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 356

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 110/234 (47%), Gaps = 14/234 (5%)

Query: 433 GVIVFWNFTE-IQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYD-----RD---T 483
           G IV W F E +    IL  ++ A   +L+    + +D++  +   E D     RD    
Sbjct: 107 GSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLKRDYSIN 166

Query: 484 ERPRIFNDIVTLRSGDH----IIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLAL 539
           +   + N+++ +   +H    + +   S  I++S++L+  E  +   +    +  + L+ 
Sbjct: 167 DESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTREFTESLSR 226

Query: 540 YGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQ 599
              L +  + +L+ +G+LF +R  +NL S +++TP+ +WS EP L  LY  +   L+I  
Sbjct: 227 GKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWS-EPQLEKLYRQISRNLDIQP 285

Query: 600 RVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRY 653
           R+ +LN +     +     +  + E+   R+ W  I +I   V F L   + +Y
Sbjct: 286 RISILNTKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEVCFELYHFYEKY 339

>SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 383

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 60/250 (24%), Positives = 113/250 (45%), Gaps = 16/250 (6%)

Query: 421 NDRHAEIFIF-HYGVIVFWNFTE-IQEKNILGDITFADYKNLMIRPLDEQD--------- 469
           N    +I +    G +V W F E    +NIL  I+ A    L  +  + +D         
Sbjct: 133 NGHRGDIMVLGQNGSVVSWGFDETCLTENILPLISPARVNPLAPKQFESEDMDYVELENS 192

Query: 470 IETEQFHFEYDRDTERPRIFNDIVTLRSGDH----IIELTLSHAIAQSSKLSRFESRISP 525
           IE EQ      +  +   I  D++ + S D     + +   S  +++S++L+  E  +  
Sbjct: 193 IELEQLKSVTHKIDDGSFIEGDLIVINSTDSEQGLLDKAAFSSGMSRSTRLAVLEGALET 252

Query: 526 ILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLH 585
            +    +  + L++   L L    +LK +G+LF +R  +NL S +++TP+ +WS EP L 
Sbjct: 253 HIEKTREFTELLSVGKKLNLTESDVLKYTGRLFLMRGKLNLYSELIETPDLYWS-EPRLE 311

Query: 586 PLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFS 645
            +Y  + + L+I  R+ +LN +     +     +  + E+   R+ W  I +I   V F 
Sbjct: 312 KIYKQISKNLDIHPRITILNTKLDYATDESRALMAVLNEKKSTRLEWIIIYLITIEVCFE 371

Query: 646 LTEIFVRYVI 655
           L   + +Y +
Sbjct: 372 LYHFYEKYYL 381

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 115/260 (44%), Gaps = 29/260 (11%)

Query: 418 HEGNDRHAEIFIF-HYGVIVFWNFTEIQ-EKNILG------------------DITFADY 457
           H  N    +I I    G I+ W F E    +NIL                   D+ + + 
Sbjct: 131 HHCNGSTGDIMILGQSGSIICWGFDEATVNQNILKLVEDARTNPLNPDEFESEDMDYVEL 190

Query: 458 KNLMIRPLDEQDIETEQFHFEYDRDTERPRIFNDIVTLRSGD----HIIELTLSHAIAQS 513
           +N     L  + ++ E  +    +  E   +  D++ + S D     + +   S   ++S
Sbjct: 191 EN----KLQLESVQLESANHAAVKYLETSLLVGDLILINSTDPGAGLLHKAAFSSGFSRS 246

Query: 514 SKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDT 573
           +KL+  E+ +   ++    + ++++    L LKR   LK  G+LF +R  +NL S +++T
Sbjct: 247 TKLAVLENAMERHIVETRIITEKVSKGVRLNLKRGDALKSIGRLFLIRGKLNLYSELIET 306

Query: 574 PEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWW 633
           P+ +WS EP L  ++    +YL+I  R+ +LN +     E     +  ++E+N   +   
Sbjct: 307 PDLYWS-EPQLEKIFKETSKYLDIGPRINILNSKLDYSTEETRALMGVLSEKNSTVLELI 365

Query: 634 FILVILFGVIFSLTEIFVRY 653
            I +I F + F L   + RY
Sbjct: 366 IIYLIAFELCFELYHFYERY 385

>Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa]
           {ON} YDR282C - Hypothetical ORF [contig 11] FULL
          Length = 374

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 110/253 (43%), Gaps = 26/253 (10%)

Query: 421 NDRHAEIFIF-HYGVIVFWNFTE-IQEKNILGDITFADYKNLMIRPLDEQDIETEQFHF- 477
           N   ++I I  + G +V W   E    +NIL  I  A      I PL E  +E+E   + 
Sbjct: 119 NGYRSDIMILGNSGTVVSWGIDESFTLENILPLIQSAR-----INPLAENAMESEDLDYL 173

Query: 478 --EYDRDTERPR-----------IFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFE 520
             E   D ER R           +  D++ + S D  + L      S  I++S++L+  E
Sbjct: 174 EIESIEDLERVRHTLSRSVDGSFVEGDLIVVNSIDPELGLLDKAAFSSGISRSTRLAILE 233

Query: 521 SRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSF 580
             +   +    K  + L+    L L    +L+ +G LF +R  +NL S + +TP+ +WS 
Sbjct: 234 ELLEAHIEKTRKFTENLSDGKRLNLTESMVLRSTGSLFLIRGKLNLYSELTETPDLYWS- 292

Query: 581 EPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILF 640
           EP L  +Y  M   L+I  R+ +LN +     E     +  + E+    + W  I +I  
Sbjct: 293 EPQLERIYKQMSRSLDIQPRIAILNTKLDYATEESRAFMAVLNEKKGTHLEWIIIYLITV 352

Query: 641 GVIFSLTEIFVRY 653
            V F L   + RY
Sbjct: 353 EVCFELHHYYERY 365

>Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON}
           complement(11719..12930) [1212 nt, 404 aa]
          Length = 403

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 107/248 (43%), Gaps = 23/248 (9%)

Query: 433 GVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHF-EYDRD--------- 482
           G +V W F E    N L +      ++ +I PL     E+E   F E D +         
Sbjct: 154 GSVVSWGFDE----NTLTNNILPLIESAIINPLVPDKYESEDLDFIELDNEDETTLKLLP 209

Query: 483 ----TERPRIFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFESRISPILISVTKLP 534
                E   I  D++ + S D    L      S  I++S+ L+  ES +   +     + 
Sbjct: 210 SGDANEASFIAEDVIVINSIDQTSGLLDKAAFSSGISRSTSLAVLESALEEHINRSRIIT 269

Query: 535 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREY 594
           + ++    + L     LK  G+LF +R  +NL S I++TP+ +WS EP L  +Y  + +Y
Sbjct: 270 ESVSNGKKMNLNERDFLKSIGRLFLIRGKLNLYSEIIETPDLYWS-EPQLEKIYKNVSKY 328

Query: 595 LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYV 654
           L++  R+ +LN +     +     +  + ER    + W  I +I F V F L   + +  
Sbjct: 329 LDVVPRINILNSKLDYSTDESRALLAVLNERKSTFLEWIIIYLIAFEVCFELYHYYEKNY 388

Query: 655 IIHRHTST 662
           I    +ST
Sbjct: 389 IQTEQSST 396

>CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282c
          Length = 361

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/171 (26%), Positives = 87/171 (50%), Gaps = 19/171 (11%)

Query: 487 RIFNDIVTLRS---GDHIIE-LTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGT 542
           R+  D++ + S    + I++    S  +++S+ L+  E+ +   + +   + ++++    
Sbjct: 182 RLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAMERHISNTRIITEKISTGIK 241

Query: 543 LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQ 602
           L +K    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  +  YL+I  R+ 
Sbjct: 242 LKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWS-EPELEIIFKDVSRYLDISPRIN 300

Query: 603 VLN-------DRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSL 646
           +LN       D C+  L   +       ERN + + W  I +I F VIF L
Sbjct: 301 ILNSKLDYSTDECRAILSLLN-------ERNSSFLEWIIIYLITFEVIFEL 344

>TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {ON}
           Anc_5.291 YDR282C
          Length = 386

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 54/208 (25%), Positives = 94/208 (45%), Gaps = 17/208 (8%)

Query: 462 IRPLDEQDIETEQFHF-------EYDRDTER-----PRIFNDIVTLRSGDHIIEL----T 505
           I PLDE   ETE   F          ++ E        I +D++ + S D  + L     
Sbjct: 171 INPLDESKYETEDIDFIEIENSKALSKNMESHLHNGSYIMDDLLIVNSIDPELGLLDKAA 230

Query: 506 LSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVN 565
            S  IA+S+ L+  E+ +         + ++ +    + LK +  L   GKLF +R  +N
Sbjct: 231 FSSGIARSTSLAVLEAALEEHTQKSRIITEKFSRGIQINLKEKHFLTSIGKLFLIRGRLN 290

Query: 566 LSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAER 625
           L S I++TP+ +WS EP L  +Y  +  +L+I  R+ +LN +     +   + +  + E+
Sbjct: 291 LYSNIIETPDLYWS-EPRLEKIYKNVSHFLDIAPRINILNSKLDYCTDHSRMLLSVLNEK 349

Query: 626 NMARVTWWFILVILFGVIFSLTEIFVRY 653
               + W  I +I   V F L   +V +
Sbjct: 350 KGTFLEWIIIYLITVEVCFELHHYWVSF 377

>AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR282C
          Length = 366

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 77/155 (49%), Gaps = 1/155 (0%)

Query: 499 DHIIELTLSHAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLF 558
           D + +   S  I++S+ L+  E  +   + S     + L+    L +   ++LK +G+LF
Sbjct: 200 DMLDKAAFSSGISRSTMLAVLERNMEAHIESTRSFTELLSKGNRLNITEAEILKSTGRLF 259

Query: 559 KLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDIC 618
            +R  +NL S +++TP+ +WS EP+L  +Y  +   L++  R+ +LN +     +     
Sbjct: 260 LMRGKLNLYSELIETPDLYWS-EPTLETIYKQVSRNLDVPARISILNKKLDYATDESRAL 318

Query: 619 VDSVAERNMARVTWWFILVILFGVIFSLTEIFVRY 653
           +  + E+   R+ W  I +I   V F L   + R+
Sbjct: 319 MSVLNEKKSTRLEWIIIYLITVEVCFELHHFYERF 353

>KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {ON}
           Anc_5.291 YDR282C
          Length = 363

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/239 (23%), Positives = 108/239 (45%), Gaps = 24/239 (10%)

Query: 433 GVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETEQFHFEYDRDTERPRIFNDI 492
           G  V W      E+N+L        +N  I PL E + E E   +   R +E      DI
Sbjct: 119 GATVSWGI----EENVLRSEIIPLIENACINPLSENEFEIEDMDYIELRKSEDLSFVQDI 174

Query: 493 V------TLRSGDHII------------ELTLSHAIAQSSKLSRFESRISPILISVTKLP 534
                  +   GD I+            ++  S  +++S+ L+  E+++   +    K+ 
Sbjct: 175 CDREDDNSFLLGDLIMINSVGPLYGVMDKVAFSSGLSRSTMLAVLENKMETHIKETRKVT 234

Query: 535 KRLALYGT-LGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMRE 593
           ++++   T   +K + +L+  G+LF +R  +NL S +++TP+ +WS E  L  ++  +  
Sbjct: 235 EKISKGVTNTKMKEKDVLRFIGRLFMIRGQLNLYSELIETPDLYWS-ETQLEEIFKKISN 293

Query: 594 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVR 652
           YL++  R+ +LN +     E   + +  + ER  + + W  I +I F + F L   + R
Sbjct: 294 YLDMKPRISILNSKLDYSTEECRLLISLLNERKSSFLEWIIIYLIAFELFFELYHYYER 352

>TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.291
           YDR282C
          Length = 405

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 115/271 (42%), Gaps = 36/271 (13%)

Query: 418 HEGNDRHAEIFIFHYGV-IVFWNFTE-IQEKNILGDITFADYKNLMIRPLDEQDIETEQF 475
           ++G+    ++ I      +V W F E    +NIL  +  A      I PL +   ETE  
Sbjct: 134 YQGDGYKGDVMIISQNASVVSWGFDETFVSQNILHLVEEA-----RINPLAQDAFETEDM 188

Query: 476 HFEYDRDTERPRIFN------------------------DIVTLRSGD----HIIELTLS 507
            +    + E+ +  N                        D++ + S D     + +   S
Sbjct: 189 DYVEVENYEQFQSINSKASSSATVGATLAKYGETSFLAGDLIVINSTDPDSGMLYKAAYS 248

Query: 508 HAIAQSSKLSRFESRISPILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLS 567
             +A+S+ L+  E+ +   +     + ++++    L L   + L+  G+LF +R  +NL 
Sbjct: 249 SGLARSTSLAVLENSMEAHISRTRIITEKISRGVKLNLNEGEALRSIGRLFLIRGRLNLY 308

Query: 568 STILDTPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNM 627
           S +++TP+ +WS EP L  ++     YL+I  R+ +LN +     +     +  ++E+  
Sbjct: 309 SELIETPDLYWS-EPLLERIFKQTSRYLDIGPRINILNTKLDYSTDECRALMGVLSEKKG 367

Query: 628 ARVTWWFILVILFGVIFSLTEIFVRYVIIHR 658
             + W  I +I   +IF +   + RY +  R
Sbjct: 368 TFLEWIIIYLISLEIIFEIYHFYERYYLDTR 398

>Skud_11.137 Chr11 complement(255229..256161) [933 bp, 310 aa] {ON}
           YKL091C (REAL)
          Length = 310

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 54/131 (41%), Gaps = 17/131 (12%)

Query: 162 DRQRPKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYD 221
           D++R K+  M    +  + +        R   +    G NLN++YK   E H +   + +
Sbjct: 99  DKERIKLAKMYPQYYHHVDK------DGRPLYFEELGGINLNKMYKITTEEHMLRNLVKE 152

Query: 222 ECLYVAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVED 281
             L+  Y +P    + G+ I+++ +   + G +L            + Y   S ++ V D
Sbjct: 153 YELFARYRVPACSRRAGYLIETSCTVLDLKGISL-----------SNAYHVLSYIKDVAD 201

Query: 282 ANNNYELETSG 292
            + NY  E  G
Sbjct: 202 ISQNYYPERIG 212

>NCAS0A09310 Chr1 (1840751..1841398) [648 bp, 215 aa] {ON} Anc_1.300
           YJL072C
          Length = 215

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 7/47 (14%)

Query: 303 TVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEKRERT-ERINMLKK 348
           ++P HL      Q++F+P E QF  E  P++I  R  T +R+NM+ K
Sbjct: 2   SLPKHL------QETFSPEEIQFIVENEPIKIFPRITTRQRVNMVNK 42

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 68,318,629
Number of extensions: 3099572
Number of successful extensions: 16603
Number of sequences better than 10.0: 106
Number of HSP's gapped: 16926
Number of HSP's successfully gapped: 142
Length of query: 662
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 546
Effective length of database: 40,180,143
Effective search space: 21938358078
Effective search space used: 21938358078
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)