Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL066W (HPA3)na 1ON1791799551e-133
Smik_5.21na 1ON1611617741e-106
Skud_5.22na 1ON1611617421e-101
Suva_5.1na 1ON1611617074e-96
Skud_16.497na 2ON1551504574e-58
KAFR0D02290singletonON1621604584e-58
YPR193C (HPA2)na 2ON1561504505e-57
Suva_16.525na 2ON1551514426e-56
NCAS0A09820na 2ON1501504235e-53
NDAI0C02350na 2ON1581484176e-52
Smik_16.457na 2ON1591504062e-50
KNAG0B02050singletonON1531513941e-48
SAKL0B12606gsingletonON1551493932e-48
KNAG0B02060singletonON1541543514e-42
TBLA0B044808.570ON608102780.094
KLTH0E14806g3.331ON17493700.66
Skud_13.674.343ON105488710.84
SAKL0H06006g8.697ON169103671.6
NDAI0I014706.140ON68649691.7
ZYRO0D10912g8.697ON164116662.1
KLLA0A12089gsingletonON18160653.1
KAFR0K02600singletonON18238653.2
Kwal_26.88778.697ON16271643.6
Ecym_23758.697ON16660626.6
KLTH0D11748g8.697ON16271618.2
Kpol_1065.353.331ON17364628.5
Kwal_27.125343.331ON17464618.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL066W
         (179 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino a...   372   e-133
Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)    302   e-106
Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)    290   e-101
Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)       276   4e-96
Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {O...   180   4e-58
KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON}     181   4e-58
YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}  ...   177   5e-57
Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {O...   174   6e-56
NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON}             167   5e-53
NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON}     165   6e-52
Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {O...   160   2e-50
KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON}               156   1e-48
SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} simil...   155   2e-48
KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON}               139   4e-42
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    35   0.094
KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} simil...    32   0.66 
Skud_13.67 Chr13 complement(115055..118219) [3165 bp, 1054 aa] {...    32   0.84 
SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {O...    30   1.6  
NDAI0I01470 Chr9 complement(347591..349651) [2061 bp, 686 aa] {O...    31   1.7  
ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar...    30   2.1  
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    30   3.1  
KAFR0K02600 Chr11 (535023..535571) [549 bp, 182 aa] {ON}               30   3.2  
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    29   3.6  
Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON} ...    28   6.6  
KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar...    28   8.2  
Kpol_1065.35 s1065 complement(74947..75468) [522 bp, 173 aa] {ON...    28   8.5  
Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR05...    28   8.6  

>YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino acid
           N-acetyltransferase, catalyzes N-acetylation of D-amino
           acids through ordered bi-bi mechanism in which
           acetyl-CoA is first substrate bound and CoA is last
           product liberated; similar to Hpa2p, acetylates histones
           weakly in vitro
          Length = 179

 Score =  372 bits (955), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 179/179 (100%), Positives = 179/179 (100%)

Query: 1   MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM 60
           MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM
Sbjct: 1   MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM 60

Query: 61  PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE 120
           PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE
Sbjct: 61  PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE 120

Query: 121 RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY
Sbjct: 121 RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179

>Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  302 bits (774), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/161 (88%), Positives = 153/161 (95%)

Query: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78
           MSN+E EKM +DRIVV+AIEPKDE+AW+KLWKEYQGFQKT MP EVATT FARF+DPTVK
Sbjct: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60

Query: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138
           LWGALAFDTETG+AIGFAHYL+HLTSWHVEEV+YMNDLYVTE AR+KGVGRKLIEFVY R
Sbjct: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120

Query: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKR GY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161

>Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  290 bits (742), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 135/161 (83%), Positives = 145/161 (90%)

Query: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78
           MS +E EKM NDRIVV+AIE  DEEAWNKLW +YQGFQK VMPPEV  T+FARF+DPTVK
Sbjct: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60

Query: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138
           LWGALA DTETGDAIG AHYL+HLTSWHVEEV+Y+NDLYVTE AR+KGVGRKLIEFVY  
Sbjct: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120

Query: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           ADELGTPAVYWVTDHYNHRAQLLYTKV YKTDKV+YKR GY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161

>Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  276 bits (707), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 144/161 (89%)

Query: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78
           M++ E EK+ NDRIVV+AIEP+DEE WN+LW EYQGFQK VMP EVA TTFARF+DP VK
Sbjct: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60

Query: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138
           LWGALAFDT TG AIGF HYL+H+T+W VEEVVYMNDLYVTE AR+KGVGRKLIEFVY  
Sbjct: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120

Query: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           ADELGTP+VYWVTDH+NHRAQLLYTKVAYKT+KV+YKR G+
Sbjct: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161

>Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  180 bits (457), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 79/150 (52%), Positives = 105/150 (70%)

Query: 30  DRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTET 89
           D ++V+ +   D+E W  LW+ +Q F     P E+    F RF+DP VK+W A+A D+ +
Sbjct: 6   DSVIVRFVTEDDKEGWQGLWRSFQDFYSVSFPNELDEFNFKRFLDPNVKMWAAVAVDSTS 65

Query: 90  GDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYW 149
           G  IG  ++L+H+T+W  ++ VY+NDLYV E +RVKGVGR+LI+FVY  AD+L TP VYW
Sbjct: 66  GKIIGMINFLSHMTTWDFKDKVYINDLYVDESSRVKGVGRELIQFVYEEADKLDTPNVYW 125

Query: 150 VTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
            TD  NHRAQLLYTK+ YK  K LYKRNGY
Sbjct: 126 CTDESNHRAQLLYTKIGYKAPKSLYKRNGY 155

>KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON} 
          Length = 162

 Score =  181 bits (458), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 112/160 (70%)

Query: 20  SNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKL 79
           +N+  E   N+ I V+ ++  D+ +W +LW  +  FQ+T +P E     F RFIDP V +
Sbjct: 3   TNQGTESTENNDITVRLVDKDDKNSWKELWTLFMEFQQTSLPEEQEELNFRRFIDPEVNM 62

Query: 80  WGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRA 139
           W ALA D  +G AIG A++ +H+++W + +++Y+NDLYV E  R +G+GRKLI+FVY  A
Sbjct: 63  WSALAIDEASGRAIGMANFFSHMSTWDLTDIIYLNDLYVREDVRTRGIGRKLIDFVYEHA 122

Query: 140 DELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           D++GTP VYW TD +NHRAQLLYTKV  +T KV+YKR GY
Sbjct: 123 DKMGTPKVYWWTDEHNHRAQLLYTKVGKRTPKVVYKRIGY 162

>YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}
           HPA2Tetrameric histone acetyltransferase with similarity
           to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates histones
           H3 and H4 in vitro and exhibits autoacetylation activity
          Length = 156

 Score =  177 bits (450), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 103/150 (68%)

Query: 30  DRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTET 89
           D I V+ +   D+E W +LWK YQ F +   P ++    F RF+DP +K+W A+A ++ +
Sbjct: 7   DNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVESSS 66

Query: 90  GDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYW 149
              IG  ++ NH+T+W  ++ +Y+NDLYV E +RVKG G KLI+FVY  AD+LGTP+VYW
Sbjct: 67  EKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSVYW 126

Query: 150 VTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
            TD  NHRAQLLY KV YK  K+LYKR GY
Sbjct: 127 CTDESNHRAQLLYVKVGYKAPKILYKRKGY 156

>Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  174 bits (442), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 106/151 (70%)

Query: 29  NDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTE 88
           +D +VV+ +   D++ W +LW+ YQ F K   P E+    F RF+DPTVK+W A+A +  
Sbjct: 5   DDSVVVRLVTEDDKDGWQRLWRSYQDFYKVSFPNELDDFNFERFLDPTVKMWAAVAVNGS 64

Query: 89  TGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVY 148
           +G+ IG  ++ +H+++W  ++ +Y+NDLYV   +RVKGVGRKLI+ VY  AD+L TP+VY
Sbjct: 65  SGEVIGMINFFSHMSTWDFKDKIYINDLYVDGNSRVKGVGRKLIQLVYEEADKLETPSVY 124

Query: 149 WVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           W TD  N+ AQLLYTK+ YK  K +YKRNGY
Sbjct: 125 WCTDESNYSAQLLYTKIGYKAHKTIYKRNGY 155

>NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON} 
          Length = 150

 Score =  167 bits (423), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 73/150 (48%), Positives = 106/150 (70%)

Query: 27  MVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFD 86
           M  ++I+V+ +   DEE W +LWK YQ   +  +  EVA   F  F++P V++W A+A +
Sbjct: 1   MSEEKIIVRPVSLNDEEDWKRLWKHYQEHYEVHLSEEVAERNFKNFLEPGVEMWAAIAIN 60

Query: 87  TETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPA 146
           TETG  IG  +YL+HLT+W +   + ++DL+V E +R+KGVGRKL+E+V+  AD++G   
Sbjct: 61  TETGVPIGMVNYLHHLTTWDIRGKMLLHDLFVEEGSRIKGVGRKLMEYVFHEADKMGIEI 120

Query: 147 VYWVTDHYNHRAQLLYTKVAYKTDKVLYKR 176
           VYW TDHYNHRAQLLYTK+ +K  KV+Y+R
Sbjct: 121 VYWTTDHYNHRAQLLYTKIGHKNSKVIYER 150

>NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON} 
          Length = 158

 Score =  165 bits (417), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 101/148 (68%)

Query: 32  IVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTETGD 91
           +V++ I+  D++ W  LWK+YQ      M  ++   TF RF+DP VK+W A A +T T  
Sbjct: 7   VVIRPIQETDKDDWLLLWKQYQKCYNRTMKEDIPLLTFERFLDPEVKMWAAFAINTTTNK 66

Query: 92  AIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVT 151
            IG   YL+H T+W+++  ++++DL+V E  RVKGVGRKL+EFVY  +D +  P VYW T
Sbjct: 67  PIGMVTYLHHFTTWNLDGKIFLHDLFVQEDQRVKGVGRKLMEFVYDASDRMDVPFVYWTT 126

Query: 152 DHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
           D +NHRAQLLYTKV  KT KVLY+R GY
Sbjct: 127 DDFNHRAQLLYTKVGKKTSKVLYERGGY 154

>Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {ON}
           YPR193C (REAL)
          Length = 159

 Score =  160 bits (406), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 99/150 (66%)

Query: 30  DRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDTET 89
           D I+++ +   D+E W +LWK YQ F K     ++    F RF+D  +K+W A+A +  +
Sbjct: 10  DNIIIRFVTENDKEGWQRLWKSYQKFYKVSFSNDLDDFNFNRFLDSNIKMWTAVAVERSS 69

Query: 90  GDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYW 149
           G  IG  ++ +H+T+W  ++ VY+NDLYV   +R K  G KLIEFVY   D+LGTP+VYW
Sbjct: 70  GKNIGMINFFSHVTTWDFKDKVYVNDLYVDVGSRAKVTGVKLIEFVYGEIDKLGTPSVYW 129

Query: 150 VTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
            TD  N+RAQLLYTK+ YK  K++YKR GY
Sbjct: 130 CTDESNYRAQLLYTKIGYKAPKIMYKRKGY 159

>KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON} 
          Length = 153

 Score =  156 bits (394), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 101/151 (66%), Gaps = 1/151 (0%)

Query: 27  MVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFD 86
           M +D I ++ +   D+E W +LW  ++      +P  +    F R +D +V +W A A D
Sbjct: 1   MASDSIAIRYVTDGDKEEWTRLWLGFRAHYDIPIPDGLGDANFKRIMDDSVDMWSAFAVD 60

Query: 87  TETGDA-IGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTP 145
           T   D  IG  ++++  ++W + ++VY++DLYV E  RV+GVGRKLIEFVYS AD+ GTP
Sbjct: 61  TSRDDKPIGLVNWVSRPSTWDLTDIVYLHDLYVDENERVRGVGRKLIEFVYSEADKRGTP 120

Query: 146 AVYWVTDHYNHRAQLLYTKVAYKTDKVLYKR 176
            VYW TDHYNHRAQLLYTKVA KT KV+Y+R
Sbjct: 121 LVYWTTDHYNHRAQLLYTKVAKKTSKVIYER 151

>SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} similar
           to uniprot|Q06592 Saccharomyces cerevisiae YPR193C HPA2
           Tetrameric histone acetyltransferase with similarity to
           Gcn5p, Hat1p, Elp3p, and Hpa3p
          Length = 155

 Score =  155 bits (393), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 74/149 (49%), Positives = 97/149 (65%)

Query: 28  VNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGALAFDT 87
             D ++V+ +  +DEE W +LWK Y  F K+ +P EVA   F RF+ P VK+W ALA DT
Sbjct: 6   CKDSVIVRLVGTEDEEEWKRLWKLYLVFYKSSLPEEVAELNFKRFLKPEVKMWSALAIDT 65

Query: 88  ETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAV 147
            T   IG  +Y  H  +W V++ + +NDLYV E  RVKGVGR+LI  VY  A++L    V
Sbjct: 66  VTNKPIGMVNYFGHFHTWDVKDKILLNDLYVDENFRVKGVGRRLITHVYGHAEKLEIWNV 125

Query: 148 YWVTDHYNHRAQLLYTKVAYKTDKVLYKR 176
           YW TD +NHRAQLLYTK+  +T KV Y+R
Sbjct: 126 YWHTDFFNHRAQLLYTKIGERTTKVQYRR 154

>KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON} 
          Length = 154

 Score =  139 bits (351), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 94/154 (61%), Gaps = 2/154 (1%)

Query: 28  VNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTV--MPPEVATTTFARFIDPTVKLWGALAF 85
           +   + V+ ++P D E   +L+  Y  F K++  +P       F RF+DP  ++W A+A 
Sbjct: 1   MGSSVEVRYVQPGDREELARLFTLYLNFYKSLDKVPATQFDLNFKRFLDPKERMWAAVAI 60

Query: 86  DTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTP 145
           DT TG  IG   + +H ++W  E  + +NDLYV E +R+ GVGR L+EFV+S  D++G  
Sbjct: 61  DTSTGKHIGMVQWFHHTSTWEPEGCILLNDLYVDEDSRLGGVGRALMEFVFSEGDKIGVG 120

Query: 146 AVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179
            VYW TD  NHRAQLLYTKV Y + +  Y RNGY
Sbjct: 121 NVYWHTDTSNHRAQLLYTKVGYLSSQCRYVRNGY 154

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 34.7 bits (78), Expect = 0.094,   Method: Composition-based stats.
 Identities = 27/102 (26%), Positives = 40/102 (39%), Gaps = 17/102 (16%)

Query: 13  STKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARF 72
           S +     NE  EK   DR  ++ IE  ++  WN       G QK V   E     + + 
Sbjct: 330 SQRGTSQYNESKEKFEGDREEIREIESLNDPRWNLC--SNLGIQKPVSDDEQFKQLYPKP 387

Query: 73  IDPTVKLWG---------------ALAFDTETGDAIGFAHYL 99
             PT+K +G               A  F +  G ++ FAH+L
Sbjct: 388 PKPTLKQYGKLFIYPPITLVSTSIAFLFSSYYGFSVTFAHFL 429

>KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} similar
           to uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 174

 Score = 31.6 bits (70), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 1/93 (1%)

Query: 83  LAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSRADEL 142
           LAF  +T + +G      + T        Y+  L V ++ R +G+ +KL+E    +  E+
Sbjct: 49  LAFSNDTENPVGCV-VCKYETHRGARLRGYIGMLAVDQKYRRRGIAKKLVEQAIQKMQEI 107

Query: 143 GTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYK 175
           G   +   T+  N  A  LY  + +   K +++
Sbjct: 108 GCDEIMLETEVENTTALQLYEGMGFIRLKRMFR 140

>Skud_13.67 Chr13 complement(115055..118219) [3165 bp, 1054 aa] {ON}
           YLR450W (REAL)
          Length = 1054

 Score = 32.0 bits (71), Expect = 0.84,   Method: Composition-based stats.
 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 13/88 (14%)

Query: 47  KLWKEYQGFQKTVMPPEVATTTFARFIDPTVKLWGAL---AFDTETGDAIGF-------A 96
           K+W + +  Q T+     AT+ FAR       L G L    F T TGDA+G         
Sbjct: 762 KIWIDSEEGQNTIKKAFNATSRFARLQHVQTCLAGDLLFIRFRTTTGDAMGMNMISKGVE 821

Query: 97  HYLNHLTS---WHVEEVVYMNDLYVTER 121
           H L  +     W   EVV ++  Y T++
Sbjct: 822 HSLKQMVEEYGWEDMEVVSVSGNYCTDK 849

>SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 169

 Score = 30.4 bits (67), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 41/103 (39%), Gaps = 16/103 (15%)

Query: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138
            +  LA+  ET  A   A  L       +   VY+  L V    R KG+G KL+EF+  +
Sbjct: 54  FFSKLAYYGETAVAAVKAKLLPSSKGGVLPAGVYIEVLAVLSAYRDKGIGSKLLEFIEQQ 113

Query: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVL--YKRNGY 179
                        DH+ H    +Y  VA      L  YK+ G+
Sbjct: 114 CK-----------DHFQHD---IYVHVATDNSVALEWYKKKGF 142

>NDAI0I01470 Chr9 complement(347591..349651) [2061 bp, 686 aa] {ON}
           Anc_6.140 YGL113W
          Length = 686

 Score = 31.2 bits (69), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 29/49 (59%)

Query: 20  SNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTT 68
           S E+ EK + D I VKA+    +E   +L  + + F+  +MPP++ T++
Sbjct: 93  SREDNEKELTDIIDVKALFASCKEKTKELSPDAETFKLQMMPPDIGTSS 141

>ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 164

 Score = 30.0 bits (66), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 11/116 (9%)

Query: 55  FQKTVMPPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMN 114
           FQ+ V       T+FA+           LAF +E       A  + +     +   +Y+ 
Sbjct: 36  FQEIVQNKNGKETSFAQ-----------LAFYSEVAVGAVKAKLIANKKGGILPHGMYIE 84

Query: 115 DLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 170
            L V E    KG+G KL+E+V S A +    A+Y      N RA   Y K  ++ D
Sbjct: 85  VLAVLEHYSGKGIGTKLLEYVESEAKKHYQHALYVHVASDNVRAITWYKKRGFEQD 140

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 31/60 (51%)

Query: 109 EVVYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYK 168
           E V +  +Y+ ++ + KG+GR L++ V+  A   G   ++     +N +A   Y K  ++
Sbjct: 98  EYVELQRIYILQKYQGKGLGRVLMDKVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFE 157

>KAFR0K02600 Chr11 (535023..535571) [549 bp, 182 aa] {ON} 
          Length = 182

 Score = 29.6 bits (65), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 81  GALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYV 118
           G + +DT+ GD +GF      L +W V +V  +  L V
Sbjct: 82  GGIVYDTKLGDKMGFFMSRKGLIAWFVVQVTVLVGLTV 119

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 29.3 bits (64), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 33/71 (46%), Gaps = 16/71 (22%)

Query: 111 VYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 170
           VY+  L V E  R KG+G +L+ FV  +  +           H+ H    LY  VA   +
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQCKK-----------HFQHN---LYVHVATDNE 124

Query: 171 KVL--YKRNGY 179
           K L  Y++ G+
Sbjct: 125 KALSWYQKKGF 135

>Ecym_2375 Chr2 complement(729086..729586) [501 bp, 166 aa] {ON}
           similar to Ashbya gossypii AAL102C
          Length = 166

 Score = 28.5 bits (62), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 111 VYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 170
           V++  L V +  R KGVG KL+E+V +R  +     +Y      N  A   Y K  +K +
Sbjct: 83  VHIETLDVLKAYRGKGVGSKLLEYVENRCKQYHQSELYTYVPSNNEGAVEWYLKHGFKLN 142

>KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 162

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 16/71 (22%)

Query: 111 VYMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 170
           VY+    V E  R KGVG +L++FV  +              H+ H    +Y  VA   +
Sbjct: 79  VYIQIFAVLENYRGKGVGSQLLKFVEEQCKA-----------HFQHN---IYVHVAVDNE 124

Query: 171 KVL--YKRNGY 179
           K +  Y+R G+
Sbjct: 125 KGIQWYQRKGF 135

>Kpol_1065.35 s1065 complement(74947..75468) [522 bp, 173 aa] {ON}
           complement(74947..75468) [522 nt, 174 aa]
          Length = 173

 Score = 28.5 bits (62), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (46%)

Query: 112 YMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDK 171
           Y+  L V  + R KG+ + L+     +  E+G   +   T+  N  A  LY K+ +   K
Sbjct: 80  YIGMLAVDRKYRKKGIAKLLVNKSIEKMKEIGCDEITLETEVENKIALSLYEKIGFIKMK 139

Query: 172 VLYK 175
            +++
Sbjct: 140 RMFR 143

>Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR051W
           (MAK3) - N-acetyltransferase [contig 260] FULL
          Length = 174

 Score = 28.1 bits (61), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 30/64 (46%)

Query: 112 YMNDLYVTERARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDK 171
           Y+  L V +  R +G+ +KL+E    +   +G   V   T+  N  A  LY  + +   K
Sbjct: 77  YIGMLAVAQTYRRRGIAKKLVEVAIEKMQAIGCDEVMLETEVENKAALKLYEGMGFIRLK 136

Query: 172 VLYK 175
            +++
Sbjct: 137 RMFR 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,022,389
Number of extensions: 868607
Number of successful extensions: 2381
Number of sequences better than 10.0: 32
Number of HSP's gapped: 2416
Number of HSP's successfully gapped: 32
Length of query: 179
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 77
Effective length of database: 41,785,467
Effective search space: 3217480959
Effective search space used: 3217480959
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 62 (28.5 bits)