Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL065W (SIT1)na 1ON62862831010.0
Smik_5.22na 1ON62862829450.0
Skud_5.24na 1ON62762828650.0
Suva_5.2na 1ON62762827810.0
TPHA0M00120singletonON61958821530.0
NDAI0I02650na 1ON63860621290.0
NCAS0D02350na 1ON63456421200.0
Kpol_358.4na 1ON61756120880.0
SAKL0C12122gna 2ON61160420510.0
TDEL0G04740singletonON60156019770.0
Kwal_23.5241na 2ON59156319610.0
KLTH0A01562gna 2ON61557018970.0
Kwal_23.4853na 3ON60356017650.0
KLTH0G09504gna 3ON62455117490.0
Kpol_416.6singletonON59755616550.0
NCAS0A11500singletonON61457615700.0
Kpol_416.5singletonON60754815600.0
TPHA0G03780singletonON61258314850.0
Kpol_513.33singletonON62657014710.0
TDEL0B00140singletonON63256114420.0
NDAI0A02050singletonON61758414230.0
TPHA0B00180singletonON63359614010.0
SAKL0G06600gsingletonON62955813710.0
Suva_8.12na 4ON63357913571e-180
CAGL0E04092gna 4ON64556513511e-179
KAFR0D00930singletonON61456013441e-179
Skud_8.3na 4ON63158513321e-177
KAFR0C02660singletonON59155513261e-176
KNAG0J02980singletonON63658313301e-176
Smik_8.1na 4ON62758113231e-175
YHL040C (ARN1)na 4ON62757213151e-174
KAFR0I01560singletonON63262112911e-170
TBLA0C01040singletonON66957712901e-170
NDAI0H00140na 4ON63257812871e-170
KLTH0D00506gsingletonON61662812541e-165
ZYRO0G07414gsingletonON70753812451e-162
TPHA0K02330singletonON63154812331e-162
SAKL0G03300gsingletonON61658512181e-160
KLLA0C19272gsingletonON62357512171e-159
KLLA0A10439gsingletonON63458911991e-157
SAKL0F00792gsingletonON61754711691e-152
KLTH0D18150gsingletonON60756411611e-151
Kwal_56.22298singletonON61053911611e-151
TDEL0H00130singletonON62156311591e-151
KLLA0C00220gsingletonON62453711141e-144
Kwal_23.2794singletonON61955111061e-143
KLTH0A07964gsingletonON61955110971e-141
KLTH0D00110gsingletonON62056810861e-140
KLTH0B10450gsingletonON62056810861e-140
Kwal_34.15711na 4ON61857210831e-139
YHL047C (ARN2)singletonON62055810821e-139
SAKL0E00132gsingletonON62057410821e-139
SAKL0F00110gsingletonON62055710781e-139
TBLA0F00470singletonON73261610521e-133
NCAS0I00110na 4ON45244510151e-131
Skud_18.6singletonON61055110221e-130
YKR106W (GEX2)singletonON6155719701e-122
YCL073C (GEX1)singletonON6155719691e-122
KLLA0E14609gsingletonON6395589671e-122
Kwal_14.722singletonON6115719571e-121
KLTH0B00110gsingletonON6275529361e-117
KLLA0D19945gsingletonON6445798961e-111
KLTH0G00198gna 4ON4584397783e-96
Smik_11.370singletonON4404417424e-91
YOL158C (ENB1)singletonON6065546752e-79
Smik_21.4singletonON6055545871e-66
TDEL0H01600singletonON6045565703e-64
Suva_26.1singletonON5344865558e-63
Suva_10.9singletonON6375704812e-51
Skud_6.14singletonON6365704784e-51
Smik_6.22singletonON6365594751e-50
TDEL0A03210singletonON5845003494e-34
NCAS0I00100singletonON1631302779e-28
Smik_11.369singletonON1681212681e-26
Smik_17.11singletonON5443471592e-10
Skud_16.503singletonON5433771537e-10
KLTH0C10120gsingletonON6513771493e-09
YPR198W (SGE1)singletonON5433771466e-09
Skud_7.560na 5ON6423841385e-08
KNAG0K01020singletonON5993841323e-07
Smik_16.81na 5ON6253861314e-07
NCAS0C03460na 5ON6303911271e-06
KLTH0C10142gsingletonON5733791208e-06
KLTH0B00132gsingletonON5683611181e-05
SAKL0A08228gsingletonON5693981144e-05
Kwal_26.9616singletonON5623761144e-05
Kwal_56.237548.272ON5892151127e-05
SAKL0A00726gsingletonON5982491127e-05
Smik_13.2722.473ON5611521119e-05
KLTH0D16962gsingletonON5712591101e-04
KLLA0A04631g8.272ON5791201082e-04
Suva_13.2652.473ON5611521073e-04
Skud_13.2442.473ON5621301054e-04
TBLA0F030408.272ON9062471056e-04
TDEL0F039908.272ON6312121030.001
Kpol_543.448.272ON6432841020.001
YMR088C (VBA1)2.473ON5621231020.001
TDEL0G03260singletonON6124431010.001
NDAI0H022002.473ON5711661010.001
Skud_14.406na 6ON5641931010.001
AGR076C8.272ON6861451000.002
YNR072W (HXT17)singletonON564164990.003
YEL069C (HXT13)na 7ON564193980.003
KLTH0G13464g8.272ON593320980.003
YJR158W (HXT16)singletonON567193960.006
ZYRO0C01430g8.272ON590297960.006
Smik_6.20singletonON569198940.009
Skud_6.12singletonON470197940.010
YDL245C (HXT15)singletonON567157940.010
Smik_14.401na 6ON636164940.010
Smik_10.8singletonON569197940.011
SAKL0H16808g8.272ON657148940.011
Smik_5.19na 7ON567164930.012
SAKL0D00814g8.858ON570192930.012
TBLA0B029408.858ON661170930.012
YJL214W (HXT8)singletonON569196930.013
Ecym_42988.272ON678122930.015
Smik_25.4singletonON315197910.015
SAKL0C05588gsingletonON677250930.015
Skud_4.5singletonON573191920.017
NCAS0A078102.473ON568162920.019
TBLA0E01970singletonON578163920.019
Ecym_13888.858ON572146910.025
SAKL0F00198gsingletonON537363900.027
TPHA0L015708.521ON45564900.028
Skud_7.620singletonON468197900.028
KAFR0F04080singletonON549189900.030
NDAI0E002108.858ON613150900.030
KAFR0F02800singletonON551189900.030
Suva_15.2915.396ON592128900.033
CAGL0J01375g2.473ON564291890.034
KAFR0E02030singletonON548189890.035
Kwal_26.77552.473ON559119890.038
TBLA0A03450singletonON573165880.048
NCAS0C002708.858ON570145880.055
KLTH0B00594gsingletonON618367880.056
KLTH0B10142gsingletonON568360870.069
TBLA0D032708.843ON55073870.071
TPHA0G031502.473ON600231860.082
SAKL0B12716gsingletonON632363860.086
AFL207C5.394ON539190860.090
YGR224W (AZR1)na 5ON613340860.099
Skud_13.188.858ON585148850.11
Suva_13.208.858ON584134850.11
SAKL0C02178gsingletonON565229850.12
Kpol_541.168.843ON52862850.12
Smik_13.118.858ON586146850.13
TBLA0D03280singletonON58073850.13
Suva_15.419singletonON588193840.14
KLLA0E09879gsingletonON630216840.15
Suva_12.263singletonON487193840.15
TBLA0B00840singletonON63779840.16
KLTH0D05434g2.473ON576131840.17
KLLA0D19941gsingletonON611367830.18
Skud_8.1575.395ON592174830.19
TBLA0D05800singletonON574160830.19
ABL040W2.473ON567104830.20
Skud_18.3singletonON590375820.27
Skud_18.5singletonOFF5351720.28
SAKL0C00154gsingletonON571246820.29
Kwal_14.1585na 8ON570121810.33
SAKL0E02992g2.473ON570142810.33
ZYRO0G21868gna 8ON620108810.35
TBLA0A03480singletonON574168810.37
TBLA0A03470singletonON57879800.43
KLLA0F17776gna 9ON553122800.44
ZYRO0C00374gna 10ON56460800.50
NDAI0K002808.858ON571129790.54
Ecym_5319singletonON530183790.57
NDAI0D05010singletonON574187790.61
TBLA0A03460singletonON568126790.62
YML123C (PHO84)8.858ON587146790.64
KNAG0E025602.473ON578101790.65
NCAS0B002208.858ON625132790.66
AFR343C3.84ON571109780.71
CAGL0B02475g8.858ON580132780.85
CAGL0A01826g5.396ON588189770.99
NDAI0G015203.23ON53093771.0
AFL205C5.395ON54676761.2
TPHA0I003808.858ON578134761.2
Kpol_541.208.858ON568132761.2
NDAI0D05020singletonON57370761.3
Kwal_14.854na 11ON570202761.4
Kwal_27.102458.843ON51577761.4
ZYRO0A00902g8.858ON604221761.5
ZYRO0G21890gsingletonON576109761.6
TDEL0A024902.473ON554102751.8
Kpol_467.242.473ON370102741.9
Kwal_26.6669singletonON590133752.0
Kpol_1003.112.241ON581121752.1
NDAI0K004008.843ON55376742.1
KLTH0H05456gna 8ON568153742.2
Kwal_26.6686singletonON56968742.3
TBLA0A033905.394ON57461742.4
Suva_13.278.843ON55342742.5
TBLA0A03500singletonON573103742.5
NDAI0C017405.396ON60788732.9
TDEL0E02290singletonON571187733.0
TBLA0A01250singletonON50339733.1
TBLA0A01240singletonON56961733.3
ZYRO0G03234g2.473ON562111733.3
KAFR0A029108.858ON586149733.5
TBLA0F01600singletonON567195723.9
TBLA0E038002.242ON608129724.0
Kwal_33.142688.858ON569170724.0
AFR442C8.858ON563146724.1
CAGL0D02640gsingletonON564101724.2
CAGL0D02662gsingletonON564101724.2
SAKL0A07480gsingletonON573430724.3
TPHA0A017508.272ON636120724.4
TDEL0H04480na 10ON57037724.5
KAFR0D00750singletonON55791724.6
NDAI0F01940singletonON551104715.0
TPHA0C047908.843ON55672715.1
KAFR0G037303.500ON14430685.2
TDEL0B002708.858ON58197715.4
KNAG0A037908.521ON45561715.5
TBLA0D05810singletonON574160715.6
Kwal_55.19582singletonON56768715.8
TBLA0B10150singletonON571185715.8
Kpol_1014.213.23ON53276716.2
Kwal_47.189193.503ON640205716.3
TBLA0A03430singletonON56479706.6
SAKL0H10538g8.521ON42663706.7
Suva_4.2singletonON57050706.9
KLTH0E02750g5.395ON56775706.9
KLLA0E20945g3.23ON52860706.9
SAKL0E04246gna 9ON565117707.0
KNAG0C051905.395ON56476707.1
KNAG0C052505.394ON56476707.4
Suva_4.4618.521ON46669707.4
Suva_2.2278.187ON30743697.6
NDAI0B03060singletonON59871708.0
KLLA0E09021gna 10ON56668708.1
Skud_4.3228.187ON33143689.3
Kpol_1053.243.84ON620165699.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL065W
         (628 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...  1199   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)  1139   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)  1108   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)     1075   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               833   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              824   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              821   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   808   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   794   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   766   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   759   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   735   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   684   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   678   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   642   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   609   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   605   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   576   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   571   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                560   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   552   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      544   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   532   0.0  
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   527   e-180
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   525   e-179
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   522   e-179
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   517   e-177
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              515   e-176
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             516   e-176
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   514   e-175
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   511   e-174
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     501   e-170
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              501   e-170
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      500   e-170
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   487   e-165
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   484   e-162
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             479   e-162
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   473   e-160
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   473   e-159
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   466   e-157
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   454   e-152
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   451   e-151
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   451   e-151
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      451   e-151
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   433   e-144
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   430   e-143
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   427   e-141
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   422   e-140
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   422   e-140
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   421   e-139
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   421   e-139
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   421   e-139
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   419   e-139
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              409   e-133
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        395   e-131
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   398   e-130
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   378   e-122
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   377   e-122
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   377   e-122
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   373   e-121
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   365   e-117
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   349   e-111
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   304   3e-96
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   290   4e-91
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   264   2e-79
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    230   1e-66
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   224   3e-64
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       218   8e-63
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   189   2e-51
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   188   4e-51
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   187   1e-50
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              139   4e-34
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         111   9e-28
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...   107   1e-26
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    66   2e-10
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    64   7e-10
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    62   3e-09
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    61   6e-09
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    58   5e-08
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    55   3e-07
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    55   4e-07
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    54   1e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    51   8e-06
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    50   1e-05
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    49   4e-05
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    49   4e-05
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    48   7e-05
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    48   7e-05
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    47   9e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    47   1e-04
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    46   2e-04
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    46   3e-04
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    45   4e-04
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    45   6e-04
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    44   0.001
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    44   0.001
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    44   0.001
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               44   0.001
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    44   0.001
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    44   0.001
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    43   0.002
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    43   0.003
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    42   0.003
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    42   0.003
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    42   0.006
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.006
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    41   0.009
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    41   0.010
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    41   0.010
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    41   0.010
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    41   0.011
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    41   0.011
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    40   0.012
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    40   0.012
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    40   0.012
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    40   0.013
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.015
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      40   0.015
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    40   0.015
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    40   0.017
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    40   0.019
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    40   0.019
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    40   0.025
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    39   0.027
TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {...    39   0.028
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    39   0.028
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    39   0.030
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    39   0.030
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               39   0.030
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    39   0.033
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    39   0.034
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               39   0.035
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    39   0.038
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    39   0.048
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    39   0.055
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    39   0.056
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    38   0.069
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    38   0.071
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    38   0.082
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    38   0.086
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    38   0.090
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    38   0.099
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    37   0.11 
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    37   0.11 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    37   0.12 
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    37   0.12 
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    37   0.13 
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    37   0.13 
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    37   0.14 
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    37   0.15 
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    37   0.15 
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    37   0.16 
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    37   0.17 
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    37   0.18 
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    37   0.19 
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    37   0.19 
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    37   0.20 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    36   0.27 
Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp...    32   0.28 
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    36   0.29 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    36   0.33 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    36   0.33 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    36   0.35 
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               36   0.37 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     35   0.43 
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    35   0.44 
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    35   0.50 
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    35   0.54 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    35   0.57 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    35   0.61 
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     35   0.62 
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    35   0.64 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    35   0.65 
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    35   0.66 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    35   0.71 
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    35   0.85 
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    34   0.99 
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    34   1.0  
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    34   1.2  
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    34   1.2  
Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON} (55476..5...    34   1.2  
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    34   1.3  
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    34   1.4  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    34   1.4  
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    34   1.5  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    34   1.6  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    33   1.8  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    33   1.9  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    33   2.0  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    33   2.1  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                33   2.1  
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    33   2.2  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    33   2.3  
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    33   2.4  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    33   2.5  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    33   2.5  
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               33   2.9  
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    33   3.0  
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               33   3.1  
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    33   3.3  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    33   3.3  
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    33   3.5  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    32   3.9  
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    32   4.0  
Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {...    32   4.0  
AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}...    32   4.1  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    32   4.2  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    32   4.2  
SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {...    32   4.3  
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    32   4.4  
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    32   4.5  
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    32   4.6  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               32   5.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    32   5.1  
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    31   5.2  
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    32   5.4  
KNAG0A03790 Chr1 (496954..498321) [1368 bp, 455 aa] {ON} Anc_8.5...    32   5.5  
TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa] ...    32   5.6  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    32   5.8  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             32   5.8  
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    32   6.2  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    32   6.3  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    32   6.6  
SAKL0H10538g Chr8 (905094..906374) [1281 bp, 426 aa] {ON} simila...    32   6.7  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       32   6.9  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    32   6.9  
KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weak...    32   6.9  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    32   7.0  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             32   7.1  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             32   7.4  
Suva_4.461 Chr4 (805238..806638) [1401 bp, 466 aa] {ON} YBR207W ...    32   7.4  
Suva_2.227 Chr2 (384110..385033) [924 bp, 307 aa] {ON} YDR068W (...    31   7.6  
NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {O...    32   8.0  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    32   8.1  
Skud_4.322 Chr4 (559325..560320) [996 bp, 331 aa] {ON} YDR068W (...    31   9.3  
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    31   9.9  

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 1199 bits (3101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/628 (94%), Positives = 591/628 (94%)

Query: 1   MDPGIANHTLXXXXXXXXXXXMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60
           MDPGIANHTL           MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY
Sbjct: 1   MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRG      
Sbjct: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
           RMAVVTSLYLATYNI            WTNILPKEISKRISDPTLAAQAYGSPFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628
           TFEIEEKEESFLKNKFFTHFTSSKDRKD
Sbjct: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/628 (88%), Positives = 578/628 (92%)

Query: 1   MDPGIANHTLXXXXXXXXXXXMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60
           MDP  ANH L           +LEKEVGA VDV PTLTTSSPAPSYIELIDPGV+NIEIY
Sbjct: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60

Query: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEMY+RP+YRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSIMIVS+IFYS+GTIIESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISG+VTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           PFTLAGGLKEEWK+AHIIVPEVIGWVVVLPLYMLWE+KYSRHPLTPWDLI+DRG      
Sbjct: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
           RMAVVTSLYLATYNI            WTNILPKEISKRISDPTLAAQAY +PFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNH+LTDSIALEGNDHL+SK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600

Query: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628
           +FE EEK+ESFLK+  FT FT S+D+++
Sbjct: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1108 bits (2865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/628 (85%), Positives = 568/628 (90%), Gaps = 1/628 (0%)

Query: 1   MDPGIANHTLXXXXXXXXXXXMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60
           MDP  A+  L           + EKE G  VDV PTLT SSPAPSYIELIDPGVHNIEIY
Sbjct: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE+YNRP+YRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++S+IFY MGT+IESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           G+CMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT FFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           PFTLAGGLKEEW+TAHIIVPEVIGWVV LPLYMLWE+KYSRHPLTPWDLI+DRG      
Sbjct: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILP+EISKRISDPTLAAQAYGSPFTFI TY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEG+D+LESK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600

Query: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628
            FE +EKEE+FLK+KF + FT  K++++
Sbjct: 601 AFEPKEKEETFLKSKFLSQFT-GKNKEN 627

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1075 bits (2781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/628 (82%), Positives = 553/628 (88%), Gaps = 1/628 (0%)

Query: 1   MDPGIANHTLXXXXXXXXXXXMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60
           MDP  AN  L           +LEKEVG      P LTTSSPAPSYIELIDPGV NIEIY
Sbjct: 1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELIDPGVRNIEIY 60

Query: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE Y+RP+YR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++S+IFYS+GTIIESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISG+VTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           G+CMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+T FFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           PFTLAGGLKEEWK AHIIVPEVIGWVV LPLYM+WE+KYSRHPLTPWDLI+DRG      
Sbjct: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALF 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILPKEISKRISDPTLAA+AYGSPFTFITTY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNHKLTDSIALEGNDHLESKN
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628
             EI EKEE+ L+ +F   FT SK++K+
Sbjct: 601 DNEIVEKEETSLRTRFLAQFT-SKEKKN 627

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  833 bits (2153), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/588 (66%), Positives = 474/588 (80%), Gaps = 2/588 (0%)

Query: 24  EKEVGAKVDVKPTLTTSSPAPSYIEL-IDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAY 82
           + E+   +D++P LT  S +    E  +D GVHNIE+YAE Y+ PI+R ALFFS+FL+AY
Sbjct: 23  DAEMQKDLDIEPKLTAVSSSSDDAESHVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAY 82

Query: 83  AYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVS 142
           AYGLDG +RYT+Q+YATSSY+QHSLLSTVNCI TVIAA GQI +AR SDIFGR +I+++ 
Sbjct: 83  AYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGRMTILVIG 142

Query: 143 IIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPAL 202
           +IFYSMGTIIESQA N++RFA G CFYQLG TGI+L LEVIA+DFSNLNWRLLA F+PAL
Sbjct: 143 VIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPAL 202

Query: 203 PFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPE 262
           PFIINTWISGNVTSA++ NWKWGIGMWAFILPL+ IPLG C+LHMRYLA+K+A DRL  E
Sbjct: 203 PFIINTWISGNVTSAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKE 262

Query: 263 FEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEV 322
              +  L WK F ++I FW+LD IG+L++ V FGC+L+PFTLAGGL+ EW+TAHIIVPEV
Sbjct: 263 ASLIGTLGWKKFIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEV 322

Query: 323 IGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVV 382
           IGW + LPL++LWEIK+SRHPLTPW LI+DRG              WYMQGDYMYTVL+V
Sbjct: 323 IGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIV 382

Query: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRG 442
           +VHES+KSATRITSLYSFVSVI GTILG  + K+RRTKPFI+FG+ CW ++FGLLVHYRG
Sbjct: 383 SVHESVKSATRITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRG 442

Query: 443 DSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXX 502
           D+ +HSGIIGSLCLLGFGAG FTY TQASIQASAK+H++MAV+T+LYLATYNI       
Sbjct: 443 DNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSVGAA 502

Query: 503 XXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILC 562
                WTNILPKEISKR+++ TLAA AY SP++FI  YTWGTPER A+V++YRY Q+ILC
Sbjct: 503 VSGAIWTNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYRYTQRILC 562

Query: 563 IIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEEKEES 610
           I+GL FC  LL  A  LRNHKL  S++++  +  + +   +I  KE++
Sbjct: 563 IVGLCFCTTLLISALFLRNHKLVSSVSID-KEQTKVEEVSDITSKEKA 609

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/606 (66%), Positives = 474/606 (78%), Gaps = 7/606 (1%)

Query: 24  EKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83
           E+E+  K +     +T   + S I + D GV NIE+YAE Y +P YRV LFFSLFL+AYA
Sbjct: 12  EEEIAQK-ETYSVHSTDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYA 70

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143
           YGLDGNIRYT+QAYATSSYSQHSLLSTVNCIKTVIAA GQI+FAR SDIFGR +++I++I
Sbjct: 71  YGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAI 130

Query: 144 IFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           +FY +GTIIESQA N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+PALP
Sbjct: 131 LFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALP 190

Query: 204 FIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEF 263
           FIINTWISG+VTSA+  +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L    
Sbjct: 191 FIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHV 250

Query: 264 EALNKLKWKS-FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEV 322
                 +WK  F ID+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EWKTAHIIVPEV
Sbjct: 251 MVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEV 310

Query: 323 IGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVV 382
           IGWVV LPLY+LWE+K+S+HPLTPW L++DRG              WYMQGDYMYTVLVV
Sbjct: 311 IGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVV 370

Query: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRG 442
           AVHES+KSATRITSLYSFVSV+ GT LG +LIKVRRTKPFIIFGIS W V+FGLL+ YRG
Sbjct: 371 AVHESVKSATRITSLYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISMWFVAFGLLIRYRG 430

Query: 443 DSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXX 502
           DS +H+GIIGSLCLLGFGAG FTY TQASIQA+ ++H ++AV+T+LYLA YNI       
Sbjct: 431 DSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIGSGLGSA 490

Query: 503 XXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILC 562
                WTN+LP  ISK I++ TLAA+AYGSPFTFI T TWGTP+R+A+V +YR VQKILC
Sbjct: 491 VSGAVWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILC 550

Query: 563 IIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEEKEESFLKNKFFTHFTS 622
           IIGL FC PLL  A  LRNH+L D +AL   + L+ KN  E ++    FL  KF     +
Sbjct: 551 IIGLCFCIPLLCAALFLRNHRLEDVVAL---NELDEKNVKE-DDPVVDFLA-KFIPSLRN 605

Query: 623 SKDRKD 628
            K+  +
Sbjct: 606 KKNSGN 611

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  821 bits (2120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/564 (69%), Positives = 454/564 (80%), Gaps = 4/564 (0%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIEIYAE Y  P  R  LFFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLST
Sbjct: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTVIAA GQI+FAR SDIFGR +I+ VSIIFY +GT+IESQA N+ RF  GGCFYQ
Sbjct: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG TG +LI+E+IA+DFSNLNWRLLALFIPALPFIINTWISG+VT+A++ NWKWGIGMWA
Sbjct: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PLACIPL  CMLHMRYLA K+AKDRL P F     +  K + ID+ FW+LD+IG+LL
Sbjct: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           I  FFGCVL+PFTLAGG+KE+W+TAHIIVPEVIGW V LPLY+LWEIK+SRHPLTPW+L+
Sbjct: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDYMYTVL+VAVHES+K+ATRITSLYSFVSVI GTILG
Sbjct: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             L+K+RRTKPFI+FGI  W +SFGLL+HYRGDSGAH+GIIGSLCLLGF AG FTY TQ 
Sbjct: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQT 466

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQA+ ++HA+MAV+T+LYLA YNI            WTN+LP  IS+ IS+ TLAA+AY
Sbjct: 467 SIQATTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAY 526

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
           GSPFTFI TYTW T ER A+V +YR  QKILCIIGLVFC PLL  A MLR+HKL D +AL
Sbjct: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586

Query: 591 EGNDHLESKNTFEIEEKEESFLKN 614
           +      S+   E ++   +FLK 
Sbjct: 587 DQ----MSEKVVEDDDPIFAFLKK 606

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  808 bits (2088), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/561 (67%), Positives = 454/561 (80%), Gaps = 3/561 (0%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YAE Y+ PIYRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLST
Sbjct: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLST 114

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           VN I TVIAA GQI +AR SDIFGR +I+I+ ++FY++GTIIESQA N+TRFAVG CFYQ
Sbjct: 115 VNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG TG+IL LE+IA DFSNLNWRL A F+PALPFIINTWISGNV+ A+  +WKWGIGMWA
Sbjct: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+ IPLG C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL
Sbjct: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +   FGC+LVPFTLAGGL+++WKTAHIIVPEVIGW V LP+++LWEIK+S+ PLTPW LI
Sbjct: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDYMYTVL+V+V+ESIKSATRITSLYSFVSVI GT+LG
Sbjct: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            ++IKVRRTKPFIIFG+SCW ++FGLLVHYRG S +HSGI+GSLCLLGFGAG FTY TQA
Sbjct: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQA 474

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQAS K H++MAV+T+LYLA YNI            WTN+LPK+ISKRI++ TLAA+AY
Sbjct: 475 SIQASVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAY 534

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA- 589
           GSPFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNHKL   +A 
Sbjct: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594

Query: 590 --LEGNDHLESKNTFEIEEKE 608
             LE   + + + +F   +K 
Sbjct: 595 SELENTPNSDEQGSFADNDKN 615

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/604 (65%), Positives = 471/604 (77%), Gaps = 13/604 (2%)

Query: 32  DVKPTLTTSSPAPSYIELI--------DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83
           D+K T+T  S AP     I        D GVHNIEIYA+ Y  P YRVALFFS+FL+AYA
Sbjct: 5   DIKKTVTEGSVAPKDTWSIKTSDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYA 64

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143
           YGLDGNIRYTFQAYATSSYSQHSL+STVNCIKTVIAA GQI FAR SD+FGR SI+I+++
Sbjct: 65  YGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAV 124

Query: 144 IFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           +FY +GT+IESQA N++RFA G CFYQLGLTGIILILEVI  DFSNLNWRL+A F+PALP
Sbjct: 125 LFYVVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALP 184

Query: 204 FIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEF 263
           FIINTWISG+VTSAI  NW+WGI MWAFILPL+CIPL  CMLHMRYLA K+A + L  EF
Sbjct: 185 FIINTWISGDVTSAIGTNWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLMSEF 244

Query: 264 EALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVI 323
           +   ++ W  + ++I FWKLD +G+LL+ V FG VL+PFTLAGGL+ +WK+A IIVPEV+
Sbjct: 245 KLYKQMPWSEYLVEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVL 304

Query: 324 GWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVA 383
           GW + LPL++LWE KY+R+PLTPWDLI+DRG              WYMQGDYMYTVL+VA
Sbjct: 305 GWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVLIVA 364

Query: 384 VHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGD 443
           VHESIKSATRI SLYSFVSVI GT+LGF+++KVRRTKPFI+FG+ CW +SFGLLVHYRGD
Sbjct: 365 VHESIKSATRIVSLYSFVSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGD 424

Query: 444 SGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXX 503
           SGAH+GI+GSLCLLGFGAG FTY TQASIQAS  +H  MAV+T+LYLATYNI        
Sbjct: 425 SGAHAGIVGSLCLLGFGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAV 484

Query: 504 XXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCI 563
               WTN+LP+++SKR+SDP +A+ AYGSPFTFI TYTW T ER A+V +YR+VQKILC 
Sbjct: 485 SGAIWTNVLPQQLSKRLSDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKILCT 544

Query: 564 IGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSS 623
           +G+ FC PL+  A +LRNHKL   +AL   D L+ KN   +++ E      KFF    S+
Sbjct: 545 VGVCFCVPLVLAALLLRNHKLESVVAL---DDLDEKN--RVDDNENGNFLTKFFPSSRSN 599

Query: 624 KDRK 627
            + +
Sbjct: 600 GETE 603

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/560 (66%), Positives = 442/560 (78%), Gaps = 3/560 (0%)

Query: 48  ELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           E  D GVHNIE++   Y+   YR+ LFFS+FLI+YAYGLD NIRYT Q YAT+SYSQHSL
Sbjct: 29  EEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSL 88

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGC 167
           L+TVNCI  VIAA GQ+ FAR +DIFGRF+++IV++IFY MGTIIESQA N++RFA G C
Sbjct: 89  LATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRFAAGAC 148

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIG 227
           FY+LG+TG++L++EVIA DFSNLNWRLLA F+PALPFIINTWISGNV +AI  NWKWGIG
Sbjct: 149 FYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIINTWISGNVLTAIGTNWKWGIG 208

Query: 228 MWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           MWAFILPL+CIPLG CMLHMRYLA K+AKD+L+ EF+    + W  + +++ FW+LD  G
Sbjct: 209 MWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPG 268

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPW 347
           ++LI V FGC+L+PFTL GGL E+WKTA IIVPEVIGWVV LPLYM+WE KY+RHPLTPW
Sbjct: 269 LILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPW 328

Query: 348 DLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            LI+DRG              WYMQGDYM+TVL VAV+ES  SA RITSLYSFVSVI GT
Sbjct: 329 KLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGT 388

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
           +LG +++KVRRTK FI+FGI CW +SFGLLVH+RGDS +HSGIIGSLCL+GFGAG FTY 
Sbjct: 389 LLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYT 448

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
           TQASIQAS K H  +AV+TSLYLATYNI            WTN+LPKEI KR++D TL  
Sbjct: 449 TQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQ 508

Query: 528 QAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
           QAY  P TFI TYTW T ER A+V++YRY QK+LCI+GL FC PLL  AF+LR+H+L D 
Sbjct: 509 QAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDV 568

Query: 588 IALEGNDHLESKNTFEIEEK 607
           IALE    L+ KN  E EE 
Sbjct: 569 IALE---DLDEKNLAEDEES 585

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  759 bits (1961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/563 (62%), Positives = 438/563 (77%), Gaps = 3/563 (0%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YA+ Y+   YR+ LFFSLFL+AYAYGLDG +RY FQAYAT+SY  HSLLST
Sbjct: 24  DAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLST 83

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           VNCIK VIAA GQ+ FAR +DIFGR SI+IVSI+FY +GTII+SQA  ++++A G C YQ
Sbjct: 84  VNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIYQ 143

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRLLA F+PA+PFIINTWISG+V SA+ ANWKWGIGMWA
Sbjct: 144 LGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMWA 203

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PL+ +PL  CM HMRYLAR+ A DRL  E      + W ++  ++ FW+LD +G+++
Sbjct: 204 FIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLIM 263

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           + V FGC+L+PFTLAG LK++W+TA IIVPEVIGW V LPL++LWE+K+++HPL PW++I
Sbjct: 264 VCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVI 323

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQG +MYTVL++AV+ES+KSATRITSLYSFVSV+ G  LG
Sbjct: 324 KDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGLG 383

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F++  +R+TK FI+FGI CW+VSFGLL+HYRGDS +HSGIIG+ CLLGFGAG FTY TQ 
Sbjct: 384 FVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTTQT 443

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQASAKTH  MAV+T+LYL+ YNI            WTNILP+E+ KRI+DPT  A AY
Sbjct: 444 SIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALAY 503

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
           GSPFTFI TY WGTPER A+V SY+YVQK+LC++G+ FC  L+  A  LR+H+L DS+AL
Sbjct: 504 GSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSVAL 563

Query: 591 EGNDH---LESKNTFEIEEKEES 610
           E  D    + S    E+++  ES
Sbjct: 564 EDEDEKFSINSDAEGELQDSTES 586

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/570 (61%), Positives = 433/570 (75%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV+NIE+YA  Y+   YRVALFFSLFL+AYAYGLDG +R + QAYATSSY  HSLL+T
Sbjct: 44  DAGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLAT 103

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           +NC+K VIAA GQI FAR SDIFGR +I+ ++++ Y++GTII+SQA NITR+A G C YQ
Sbjct: 104 INCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ 163

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRL+A F+PALPFIINTWISGN   A+  NWKWGIGMWA
Sbjct: 164 LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMWA 223

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+C+PL  C+LHMR+LA K+AKD+L+ E      + W  + +++ FW+LD++G+LL
Sbjct: 224 FIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLL 283

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           + V FGC+LVPFTLAG L+ +WK A IIVPEVIGW V LPL++LWE KYSRHPL PW L+
Sbjct: 284 VCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLV 343

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDYMYTVL+VAV+E+ KSA RITSLYSFVSVI G +LG
Sbjct: 344 KDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLG 403

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            +++  RRTK FI+FGI+CW V+FGLLVHYRGDS +HSGI+GSLCLLGFGAG FTY TQ 
Sbjct: 404 GVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQT 463

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQAS K+H  MAV+T+LYL+ YNI            WTNILP+E+ KRI+D      AY
Sbjct: 464 SIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVATYTLAY 523

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
           GSPF FI  Y WGTPER+ +V +YR VQ+IL I+GL FC  LL  AF LR+H+L +++AL
Sbjct: 524 GSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVAL 583

Query: 591 EGNDHLESKNTFEIEEKEESFLKNKFFTHF 620
           E  D   S+ + E+E + E   + K F  +
Sbjct: 584 EDVDEKSSRKSDELEARIEDNTETKGFERY 613

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/560 (57%), Positives = 412/560 (73%), Gaps = 11/560 (1%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NI++YA+ YN   YRVALFFSLFL+AY+Y LDG +R   + YAT SY  HSLLST
Sbjct: 27  DAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLST 86

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTVI A G I +AR SDIFGR +++ ++++ Y +GTI+E Q+  +++FA G   +Q
Sbjct: 87  VNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIFQ 146

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG  GI+L+L+VIA DFS LNWR++AL++PALP IINTW+SG++  AI+ NWKWGIGMWA
Sbjct: 147 LGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMWA 206

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FILPLAC+PL  C++HMRYLA K+ KD+L  E+E      W ++  ++ FW+LDI+G++L
Sbjct: 207 FILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLDILGLIL 266

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           IT   GCVL+PFTLAGGL ++WK+AHIIVPEVIGW V  PL++LWE KY+RHPLTPW L+
Sbjct: 267 ITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLL 326

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG               YMQ DYMYTVLVVAV+ES+KSA RIT+L++FV++I GT+LG
Sbjct: 327 KDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTLLG 386

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F++  V+RTK FI+FGI  W V+FGLL+ YRGDS +HSGI+G+LCLLGFG G F Y TQ 
Sbjct: 387 FVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYATQV 446

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+ AS  +H  MAV+TSLYLA+YN+            WTN+LPK++ KRISD ++A  AY
Sbjct: 447 SLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANIAY 506

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
            SPF FI  Y WG+PERIA++ +Y+ VQKILC +GL FC  LL  A  LR+ KL   +AL
Sbjct: 507 SSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVVAL 566

Query: 591 EGNDHLESKNTFEIEEKEES 610
           E           + EEKE S
Sbjct: 567 E-----------DAEEKEPS 575

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/551 (56%), Positives = 410/551 (74%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA  Y+   YRVALFFSLFLIAYAY LDG +R   +AYAT SY  HSLLST
Sbjct: 36  DVGVKNIEVYAAQYDHVAYRVALFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLST 95

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTV+AA G + +AR SD+FGR  ++ +SI+   +GTI+E Q+  +++FA G C YQ
Sbjct: 96  VNCIKTVMAAGGMVAYARASDMFGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQ 155

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG  G+ LIL+VIA DFSNLNWR++AL++PALP IINTW+SG+V SAI ++W+WGIGMWA
Sbjct: 156 LGKAGLALILQVIAVDFSNLNWRMVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWA 215

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+CIPL  C++HMRYLA KHA ++L  + +  +   W  + I++ FW+LD +G++L
Sbjct: 216 FIIPLSCIPLFCCLVHMRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLIL 275

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +    GCVLVPFTLAGGL ++W+TA IIVPEVIGW V LPL++LWE K++R PLTP  ++
Sbjct: 276 VVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVL 335

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG               YMQ DYMYTVLV+AVHES+K+A RIT+L++FVS+I GT+LG
Sbjct: 336 KDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLLG 395

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F+++ V+RTK FI+FG+  W V+FGLLVH+RGD  +HSGIIG+LCLLGFG G F Y  Q 
Sbjct: 396 FVIVYVKRTKKFILFGVCVWFVAFGLLVHFRGDESSHSGIIGALCLLGFGGGFFNYSAQV 455

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QAS   H  +AVVTSLYLA YNI            WTN+LPKE++KRI++  +A  AY
Sbjct: 456 SMQASTAAHQDLAVVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLAY 515

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
            SPF FI  Y WGTP+R+A+V +Y+ VQ+ILCI+ L FC  LL  AF+LR+ KL++ +AL
Sbjct: 516 SSPFKFIIKYKWGTPQRVAVVHAYQKVQRILCIVPLCFCVTLLIAAFLLRDKKLSEVVAL 575

Query: 591 EGNDHLESKNT 601
              +H  S++ 
Sbjct: 576 GELEHGHSESA 586

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/556 (54%), Positives = 403/556 (72%), Gaps = 8/556 (1%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV+N E+YA+ Y+ P  R  +F  LF I YAYGLD  +R  +Q  ATSSY QHSLLSTVN
Sbjct: 47  GVYNSEVYAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVN 106

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
            IK+VI+A GQI+FAR SD+FGR +I+IV+++FY +GTI+ESQAV++++FA G C +QLG
Sbjct: 107 AIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLG 166

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
             G++++++++ SDFSNLNWR+ A+  P LP +INTW+SG++ SA+D NWKWGIGMWAFI
Sbjct: 167 YDGVVMMVQILVSDFSNLNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFI 226

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PL+CIP GI +LHM+YLARK+  D LK  F+    + WK +  +I  WKLD IG+LL  
Sbjct: 227 FPLSCIPFGILLLHMKYLARKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAV 285

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQD 352
            FFG VLVPFTLAGGL ++WKTA IIVPEV+GWVV  P ++ WEIK++++PLTPW  ++D
Sbjct: 286 AFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKD 345

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              +YMQ  YMYT+L+VAV+++ KSATRI SL++FV+ + GT+LG +
Sbjct: 346 RGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLV 405

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FI FGI+ W +SFGLL  Y G + A++GII +LCLLGFG G   Y T+AS+
Sbjct: 406 IVKVRRTKEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASM 465

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGS 532
           QASA TH  MA++TSL++A   I            WTN+LP +I K +++ TLA  AY S
Sbjct: 466 QASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNS 525

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           P  FI  Y W +PER  +V +Y++V+KIL I+GL F  PLLG AF+LRN +L D++AL  
Sbjct: 526 PTKFILQYNWESPERQIVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVAL-- 583

Query: 593 NDHLESKNTFEIEEKE 608
            D +E KN    E+KE
Sbjct: 584 -DKVEPKN----EKKE 594

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/576 (51%), Positives = 398/576 (69%), Gaps = 6/576 (1%)

Query: 32  DVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIR 91
           ++  +  +S+    YIE  + GVHN EIY + Y+ PI R+ +F SLFLIA+AYGLD ++R
Sbjct: 38  ELSSSAASSTIGSEYIE--NSGVHNAEIYCKYYSHPIKRIMVFSSLFLIAFAYGLDNSVR 95

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTI 151
            T+Q  ATSSYSQHSLLSTV CIK VI+A  Q++FAR +D+FGR +I+ +SIIFY +GTI
Sbjct: 96  TTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSADMFGRPTILTISIIFYVIGTI 155

Query: 152 IESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           IE +A +++R+A G C + LG  GI+L+ E+  +DFSNLNWR+ A     LP +I TWIS
Sbjct: 156 IECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPNVITTWIS 215

Query: 212 GNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKW 271
           GN+T AID NW+WGIGMWAFI PL+C+PL IC++HMRYLARK+  + LK  F+  N + W
Sbjct: 216 GNITGAIDKNWEWGIGMWAFIFPLSCVPLIICIIHMRYLARKN-NENLKVVFQKPNYMTW 274

Query: 272 KSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPL 331
           K +CIDI FWKLDIIG++L+  FF  +LVPFTLAG L   WK+  IIVPEV+GWV+ +PL
Sbjct: 275 KEYCIDIFFWKLDIIGLILLVAFFSLILVPFTLAGSLT--WKSPKIIVPEVLGWVLAIPL 332

Query: 332 YMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSA 391
           Y++WE+KY+R+PLTPW+ I+DRG              +YMQ  YM TVL+VAV +S KSA
Sbjct: 333 YLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAVGQSKKSA 392

Query: 392 TRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGII 451
           TRI   YSFV V+    LGF++ KVRRTK FI  GI  W V+FGLL HY G  GA +GII
Sbjct: 393 TRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIALGIGIWFVAFGLLEHYEGGLGARAGII 452

Query: 452 GSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNI 511
            ++C+LGFG G   +  +ASIQA+A +HA M + TSL+ A  +I            W+N+
Sbjct: 453 AAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAGGIWSNV 512

Query: 512 LPKEISKRIS-DPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCF 570
           LP EI+KRI+ + TLA  AYGSP  FI  Y W T ER A+V +Y+ V++++ I+GL    
Sbjct: 513 LPGEINKRITNNSTLATYAYGSPTKFIKQYGWETTERQAVVSAYKVVERLMAIVGLCLLV 572

Query: 571 PLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEE 606
           P+L  +  LRN +L D ++ +  D    + + + EE
Sbjct: 573 PMLVASIFLRNRRLEDVVSFDKLDETFDEKSTDDEE 608

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/548 (53%), Positives = 394/548 (71%), Gaps = 1/548 (0%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GVHN+EIYA+ Y+ P+ R  +FFSLF IAYAYGLD ++R T+Q  ATSSY+QHSLLSTV+
Sbjct: 43  GVHNVEIYAKYYSTPVKRFLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVS 102

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
           CIK VI+A  QI+FAR +D+FGR +I+++SI+FY +GT++ESQAV++++FA G C Y +G
Sbjct: 103 CIKAVISAAAQIWFARSADMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVG 162

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
            + I+L  EV  +DFSNLNWR+ A   P LP +INTWISG++T+AID NWKWGIGMWAFI
Sbjct: 163 HSAIVLFSEVYVADFSNLNWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFI 222

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PL+CIP+G C+LHM+YLA+K+ KD LK  F+      W  + +D+ FWKLD++G+LL+ 
Sbjct: 223 FPLSCIPMGACILHMKYLAKKN-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLV 281

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQD 352
             FG +L+PFTLAGG ++ W TA IIVPEV+GW   LPL+++WEIK++R+PLTP D +++
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + MQ  Y+YTVL+VAV ES KSATRI  L+SFVSVI G + GF+
Sbjct: 342 RGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFV 401

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           + KVRRTK FI FGI  W +SFGL++ Y G   +H GII + C+LGFG G   +  +ASI
Sbjct: 402 VAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASI 461

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGS 532
           QASA +H  MAV+TSL+LA  +I            WTN+LP +IS+ I++ TLA  AYGS
Sbjct: 462 QASAYSHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGS 521

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           P  FI  Y W TPER A+V +Y+ + ++L I+G+    PLL  AF L+N +L D ++ + 
Sbjct: 522 PTKFILKYKWDTPERQAVVEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDK 581

Query: 593 NDHLESKN 600
            D + S+N
Sbjct: 582 FDKMNSEN 589

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/583 (49%), Positives = 386/583 (66%), Gaps = 7/583 (1%)

Query: 32  DVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIR 91
           D + T T+ S      E++ PGVHN +IY + Y  P  R+ +FFSLFLI YAYGLD   R
Sbjct: 31  DSEYTFTSDSEN----EVLSPGVHNAKIYGKYYTEPYQRIMIFFSLFLICYAYGLDKKTR 86

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTI 151
            T+   ATSSY +HSL+STV CI  VI+A GQI+FAR SDIFGR  I  +S+IFY +GT+
Sbjct: 87  TTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARASDIFGRKLIFGLSVIFYVIGTV 146

Query: 152 IESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           IESQA  I+R+A G C Y LG  GI+L  E+ A+DFSNLNWR++A   P LP IINTW+S
Sbjct: 147 IESQATEISRYAGGECLYGLGHAGIVLTTELYAADFSNLNWRVVAAAAPMLPNIINTWVS 206

Query: 212 GNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKW 271
           GN+T+ +D NWKWGIGMWAFI P++C+PL  C+LHMRY A+K+  + LKP F   + + +
Sbjct: 207 GNITADVDENWKWGIGMWAFIFPISCLPLIGCLLHMRYKAQKN-NEELKPVFVKPSNMSY 265

Query: 272 KSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPL 331
           K + +D+ FWK DIIG++L+   FG VLVP TLAGGL ++W  A IIVPEV+GW + LPL
Sbjct: 266 KEYLVDVFFWKSDIIGLILLVGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPL 325

Query: 332 YMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSA 391
           Y+ WE K++++P+   + ++D G              +YM   Y+ T L+VAV+ES KSA
Sbjct: 326 YVFWENKFAKYPIIKLETVRDSGIWSALSISLFIDFCFYMHETYLVTFLLVAVNESKKSA 385

Query: 392 TRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGII 451
           TRI SL +FV+VI G  LG  ++++RRTK  I+FG   W V+ GL + Y G   +HSG+I
Sbjct: 386 TRINSLSTFVTVITGFFLGLAIVRIRRTKISIVFGTLVWFVAHGLFIEYNGGLRSHSGLI 445

Query: 452 GSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNI 511
           G++CLLGFG G   +  +ASIQ S  TH ++A+VTSL+LA  +I            W+N+
Sbjct: 446 GAICLLGFGNGFIRFPVRASIQVSVGTHEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNV 505

Query: 512 LPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFP 571
           LP +I  RIS+ T+AA AY SP TFI  Y WGT  R A+V +Y YV KIL I GLV   P
Sbjct: 506 LPGQIESRISNATIAASAYSSPTTFIKKYKWGTEYRTAVVSAYGYVWKILNITGLVLVLP 565

Query: 572 LLGCAFMLRNHKLTDSIALEGNDHLE--SKNTFEIEEKEESFL 612
           LL  A  LR+ KL   +A +     E  S+N    ++K +SF+
Sbjct: 566 LLISALFLRDRKLESVLAFDEVTDTEGYSENEKVQQKKHKSFM 608

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/570 (49%), Positives = 377/570 (66%), Gaps = 9/570 (1%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
             HN  IY + Y+ P+    L+FSLFL+AYAY L  ++R T+Q  ATSSYS+HSLL+TV 
Sbjct: 38  AAHNARIYVKYYSTPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQ 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
           CI  VI+A GQI++AR SDIFGR  I+I+SI+FY +GT+IESQA +I+++A G C Y LG
Sbjct: 98  CINQVISAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALG 157

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
             G +L+ +V+ SD+S L WRL++  +  LP IINTW+ GN+T  +   W+WG GMWAFI
Sbjct: 158 YAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFI 217

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PLA IPL  C+ HM+YLA K+ +D +K        + W     DI FWKLD++G++L+ 
Sbjct: 218 FPLASIPLLCCLAHMKYLAIKNKED-VKLTISKPRSISWARHLYDIFFWKLDMLGLILLV 276

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQD 352
            FF  +LVP TLA GL E W +A  IVPEV+GW + LPL++ WE+K++ +P+TP DLI+D
Sbjct: 277 AFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKD 336

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + +   Y+YTVLVVAV+ES KSATRITSL++FVSV+    LGF+
Sbjct: 337 RGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFV 396

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FIIFGI+ W +++GL  HYRG + +H+GII ++C+ GFG G   +  + S 
Sbjct: 397 VVKVRRTKEFIIFGIAMWYIAYGLFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVST 456

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGS 532
           QASAKTH R+A+ TSLYLA  +I            WTNILP +I   I + TLA  AY S
Sbjct: 457 QASAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYES 516

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           P  FI T+ W +PER ALV++YRY+Q++L I+ L    PLL  +F LRN  LTD++A E 
Sbjct: 517 PIKFIRTHKWDSPERQALVVAYRYIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

Query: 593 ND--------HLESKNTFEIEEKEESFLKN 614
            D         LE+     +EE  E    N
Sbjct: 577 TDIPKESDSSDLENSKIDNLEEDSEEDSSN 606

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/561 (50%), Positives = 384/561 (68%), Gaps = 4/561 (0%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV NIE+Y + Y++PIY+V L+FS+FL+AY Y LD  +R+T+Q   TS +   + L TVN
Sbjct: 61  GVINIELYKQQYHKPIYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVN 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
           CIKTV+   GQ  FAR SDIFGR +++  SII Y +GTII+ +A +I++F+ G   YQLG
Sbjct: 121 CIKTVMGTAGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLG 180

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
           L GI ++L VIASDFS+LNWRL A F+PALPF+IN WI G +T  I   W+WGIGM+AFI
Sbjct: 181 LIGIQIMLGVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFI 240

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
           +P ACIPL  C+LHMRYLA K+ + +++ EF     L ++ + +DI FW+LD++G  L+ 
Sbjct: 241 MPCACIPLAFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLC 300

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQD 352
             FGC+L+P  LAGG    W+   IIVPEV+GWVVVLP+++ WE K ++HPL  WD I+D
Sbjct: 301 ALFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIED 360

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              +++ GDY++TVL++ + +S+ ++TRITS YSFV +I GT++G +
Sbjct: 361 RGILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLV 420

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           +I+ RRTKPFIIFGI CW ++ GLLVH+ G+     G+ GSLCLLG GAG FTY TQASI
Sbjct: 421 IIRARRTKPFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASI 480

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGS 532
           QA+ KTHA+MAVVT+LYL+ Y+I            WTN+LP++I  R  + + A  AY S
Sbjct: 481 QAAIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIWTNLLPRKIF-RTMNHSDATAAYDS 539

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           P  FI    WG+P R  L  +Y YVQK+LC++ L FC PLL  A  LRNHKL  ++ALE 
Sbjct: 540 PQLFILNNPWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALEN 599

Query: 593 NDHLESKNTFEIEEKEESFLK 613
            D  + K   E E + +   K
Sbjct: 600 VDEKQVK---EDERRHDLICK 617

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/584 (48%), Positives = 381/584 (65%), Gaps = 7/584 (1%)

Query: 38  TTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAY 97
           + SS   S I   D GV NIE+Y+E Y+    R+  FFS+FL  Y Y LD  +R TFQ  
Sbjct: 27  SVSSTEESQINY-DTGVINIEVYSEYYSTTQRRLLFFFSIFLTTYCYTLDKRVRSTFQTE 85

Query: 98  ATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAV 157
           ATSSY  HSL+STV CI TVI+A GQI +AR +DIFGR S++  +I FY +GT++ESQA 
Sbjct: 86  ATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGRTSLVFTAIFFYVIGTVVESQAT 145

Query: 158 NITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSA 217
           NITR+AVG CFY LG   I+L LEV+A+DFSNLN+R+LA   P LP +INTWISGN+TS 
Sbjct: 146 NITRYAVGACFYSLGHAAIVLALEVLAADFSNLNYRILASAAPMLPNVINTWISGNITSD 205

Query: 218 IDANWKWGIGMWAFILPLACIPLGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCI 276
           I  +W+WGIGMWA I P+ CIPL  C+ HMRYLA+ KH +  L+        +    + I
Sbjct: 206 IGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNRRELRSFSTIPPNMTRMEYFI 265

Query: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWE 336
           D+ FW+LDI+G+LL  +FF CVL+PFTLA    ++WK+A IIVPEVIGW+V LPLY+ WE
Sbjct: 266 DVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEVIGWLVALPLYIFWE 325

Query: 337 IKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITS 396
            K+++ PLTPW+L++DRG              +Y+Q  Y YTVL+V+   ++ +ATR  +
Sbjct: 326 WKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTVLLVSFDTTVLAATRTNN 385

Query: 397 LYSFVSVIVGTILG-FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
           +++FV VI   +LG F+  K+RRTK FI FGIS +IVS GLL  YR  + A  G I + C
Sbjct: 386 MFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRYRIGAHAKVGTIVACC 445

Query: 456 LLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKE 515
           LLGFG G   +  +ASIQA+A TH  +A++TSL+LA  +I            W+N +  E
Sbjct: 446 LLGFGNGFLKFPARASIQAAAYTHKNLAIITSLFLALGSIGEGFGSSVAGAIWSNRMEVE 505

Query: 516 ISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGC 575
           +SK IS+ T  + AY SP  FI +Y W +PERI LV +Y +V  IL I+ +  C PL   
Sbjct: 506 LSKYISNQTAVSLAYESPTKFIKSYKWESPERIGLVQAYSHVTNILYIVTICLCIPLYVF 565

Query: 576 AFMLRNHKLTDSIA---LEGNDH-LESKNTFEIEEKEESFLKNK 615
           A +LR+ +L D +A   L+G D  ++ K T E+   +  F K K
Sbjct: 566 ALLLRDRELADVVAFEQLDGQDEIIQEKKTEEVPIGQTIFQKVK 609

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/596 (45%), Positives = 385/596 (64%), Gaps = 5/596 (0%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIA 81
           +L  +   + +    +TT+   P+   +   GV+N+EIYA+ Y  P  +  ++FSLF+I 
Sbjct: 30  ILSDKDATESNASEEITTNKLKPA---VSSTGVYNMEIYAKYYANPFQKFLIYFSLFVIY 86

Query: 82  YAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIV 141
           YAYGLDGN+R T+Q  ATSS+++HSL STV CI  V ++ GQI+FAR SDIF R   M++
Sbjct: 87  YAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASDIFSREFSMVI 146

Query: 142 SIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPA 201
           SI+FY +GTII SQA ++ ++AVG C Y +G  GI+L+ E+  +DFSNLNWR++A   P 
Sbjct: 147 SILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLNWRVVAENAPM 206

Query: 202 LPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKP 261
           LP IINTW+SGN+TS + + W+WG+GMWA I P +CIPL +C+ HMRY+A+K+  ++++ 
Sbjct: 207 LPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMAKKN-NEKIRK 265

Query: 262 EFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPE 321
            FE  +++ WK + IDI  WKLD IG++L+   F  +LVPFT +GGL  EW +A+ IVPE
Sbjct: 266 IFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHREWNSANFIVPE 325

Query: 322 VIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLV 381
           V+GWVV LP++ +WE K+SR+P+   DLI DRG               Y+   Y+YT L+
Sbjct: 326 VVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYVNDTYLYTFLL 385

Query: 382 VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYR 441
           VAV ++ KS TRI SL SFV+VI    LG  ++K+RRT+ FI+ G   W V +GL VHY 
Sbjct: 386 VAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWFVVYGLYVHYN 445

Query: 442 GDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXX 501
           G  G+ SGII + CL GFG G      +AS+QAS+ +H  +A+VT+L+LA  NI      
Sbjct: 446 GGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLAIGNIGTAFGA 505

Query: 502 XXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKIL 561
                 W+N+LP  + K I + TLA  A+ SP  FI  Y W T  R  LV SY  V +IL
Sbjct: 506 AVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLVSSYGSVWRIL 565

Query: 562 CIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFE-IEEKEESFLKNKF 616
            I+ LV   P+L  +F+LR+ KL++S+A +  D   +    E I +   S++ +++
Sbjct: 566 NIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRDFSPTDCEEENIGQDRRSYIGDRY 621

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/558 (46%), Positives = 366/558 (65%), Gaps = 15/558 (2%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  +EI  + YN    + A+FFSLFL+ + + LD  +R +  AYAT+SY QHSLLSTVN
Sbjct: 57  GVQKVEILNKQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVN 116

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
            +++V AA G   ++RLSD+FGR  +++VS++ Y  GTII +QA ++TR+A G   YQ G
Sbjct: 117 VVRSVAAACGLPLYSRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFG 176

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKW-GIGMWAF 231
           L G+ ++ +VIA+DFSNLNWR+    I A PFIINTW+SG++  AI  NW W GIG+WA 
Sbjct: 177 LCGLAILFKVIAADFSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAI 236

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
            LP+A IPL +C +HM+YLA+K    ++L+       +L +K F +++ FWKLDI G+L 
Sbjct: 237 CLPVATIPLVLCFIHMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLS 296

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           + +  G +L P TLAGG   EW+TA +IVP ++G+  + P++  WE + + HP+ P D+ 
Sbjct: 297 LMIILGLILTPLTLAGGETAEWRTAKVIVPLILGFCWI-PVFAFWENRIATHPIAPTDMF 355

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDY+YT+LVVA+HES+KSATRI SLYSF ++I G  +G
Sbjct: 356 RDRGVYCALGIGILIDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVG 415

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             + KVR+ K FI+FG+  W+V+FG+++ YRG S +H G+I S  LLGFG   FT+  QA
Sbjct: 416 LAISKVRKMKCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQA 475

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QA    H RMA +T+LY  +Y I            WT +LP EI KR ++ TLA  AY
Sbjct: 476 SLQAYVN-HERMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAY 534

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIAL 590
            +P +FI  YTWGTP R+ LV +YR+VQK+L I+G+ FC P+LG A  LR+  L      
Sbjct: 535 SAPLSFIKKYTWGTPLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLRDPVL------ 588

Query: 591 EGNDHLESKNTFEIEEKE 608
                + ++N  + E+KE
Sbjct: 589 -----ISAQNIVDAEDKE 601

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 274/579 (47%), Positives = 374/579 (64%), Gaps = 14/579 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI  E Y +  ++  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IKQTEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I ++I Y +GTII+SQA ++ R+A G  FY  G 
Sbjct: 123 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+GN+TS  +   NW W IGMWAF
Sbjct: 183 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAF 242

Query: 232 ILPLACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+CIP+ +CMLHM+++ARK    HA    K  ++    +K     ++  FWKLD+IG
Sbjct: 243 IFPLSCIPIVLCMLHMQWIARKTPEWHALKDEKSYYQEHGFVK----VLEQLFWKLDVIG 298

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE + +R P+ P+
Sbjct: 299 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWVWEYRVARDPIIPY 357

Query: 348 DLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L++DRG              +YM  DY+YTV++VAV+ESIKSATRI++L SFVSV+   
Sbjct: 358 KLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASP 417

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
             G I+ +  R KPFI+FG   W+++ GLL  YRG   +HSGIIG+LC+ G G   FTY 
Sbjct: 418 FFGLIMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYP 477

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D TLA 
Sbjct: 478 VTVSVQ-SAVSHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLAT 536

Query: 528 QAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R+ALV +Y+YVQ++  I+ LVFC PL+  +  LR+ KLTD+
Sbjct: 537 AAYTSPYTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDT 596

Query: 588 IALEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSKDR 626
           +A+E  +  E  +T + +   + F   KF + F+SSK  
Sbjct: 597 VAVENIEEGEYVDTKDNDPILDWF--KKFTSKFSSSKKE 633

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  525 bits (1351), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 270/565 (47%), Positives = 369/565 (65%), Gaps = 14/565 (2%)

Query: 53  GVHNI-----EIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           GV NI     EI AE+Y++  Y   L F+ F+  Y YGLDGN RY +  YATSSY+QHSL
Sbjct: 69  GVKNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSL 128

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGC 167
           LST+N I  VI+A  QI +ARLSD++GRF++  VSI+ YS+GTII+SQA ++ R+A G  
Sbjct: 129 LSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSI 188

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWG 225
           FY  G  G+IL+L +I SDFS+L WRL+  F+P  PFIINTWISGNVTS  +   NW W 
Sbjct: 189 FYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWD 248

Query: 226 IGMWAFILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLD 284
           IGMWAFI PL+C+PL   M+HM +LARK  +   L  E     K   K   +++ FWK+D
Sbjct: 249 IGMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVEL-FWKID 307

Query: 285 IIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPL 344
            +G+ ++T+  GC+LVP TLAGG K +W  +H+I P V+G+V++ P+ +LWE K++R P+
Sbjct: 308 AMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLI-PILVLWEYKFARDPI 366

Query: 345 TPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVI 404
            P+ L++DRG              +YM  DY+YTVL+V V+ES+KSATRI+SL +FVS +
Sbjct: 367 IPYKLVKDRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTV 426

Query: 405 VGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSF 464
              I   ++ +  R KPFII G   W+++ GLL HYRG + +HSGIIG+LC+ G G   F
Sbjct: 427 GSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLF 486

Query: 465 TYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPT 524
           TY    S+QA A +H  MA VT+L    Y I            WT  L K++ KR+ D  
Sbjct: 487 TYPVNVSVQA-ATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAA 545

Query: 525 LAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKL 584
           LA +AY SP+ FI TYTW TPER A+V +YRYVQ++  I+ LVFC PLL  +  LR+ +L
Sbjct: 546 LATEAYASPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARL 605

Query: 585 TDSIALEG---NDHLESKNTFEIEE 606
           TD +A +     +++++K+   I E
Sbjct: 606 TDKVAHDNIAEGEYVDAKDDDPIYE 630

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  522 bits (1344), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 265/560 (47%), Positives = 366/560 (65%), Gaps = 4/560 (0%)

Query: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYAE Y     R   FF LFL+AYAYGLD  +R TF   ATSSY +H+L+ST
Sbjct: 47  DAGVRNIEIYAEYYTSKFSRFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170
           V CIKT+I+A GQI FAR  DIFGR SI + SII Y++GTI+ESQA  I+++A G   Y 
Sbjct: 107 VTCIKTIISAAGQIGFARSCDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYS 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230
           LG +GI+L+ EV+ +DFSNLNWR++A   P LP +INTWISGN+ + +  +WKWGIG+WA
Sbjct: 167 LGHSGIVLVSEVLIADFSNLNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWA 226

Query: 231 FILPLACIPLGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGML 289
            + P+ CIPL   +LHM+YLA+ K  +  LK  +     +    + I+  FW++D++G++
Sbjct: 227 IVFPVCCIPLLFILLHMKYLAQYKDKRPELKRIWTLPKGMTKVQYLIETLFWRVDVVGLI 286

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDL 349
           L+   FG +L+PFTLA     +WK A  IVPEV+GW V LPLY +WE  ++R PLTP   
Sbjct: 287 LLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLAT 346

Query: 350 IQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           ++DRG              +YMQ  Y+YTVL VA + +  +ATRI +LYSFV VI    L
Sbjct: 347 VKDRGIYGALLVSLFIDFVYYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFL 406

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           GF+++++++ K FI+FGI+ WI+++GL + YR    ++ G I ++C+LGFG G      +
Sbjct: 407 GFVVVRLKKVKKFILFGIAVWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPAR 466

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
           ASIQAS  +H +MAV+TSL+LA  +I            W N +  EI KR+S+ T AA A
Sbjct: 467 ASIQASVGSHQKMAVITSLFLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALA 526

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA 589
           Y SP  F+  Y WGT  R+ +V +YR V  IL ++G+  C PLL C+F+LR+ KL + I+
Sbjct: 527 YDSPTKFVKKYKWGTATRMEVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVIS 586

Query: 590 LE-GNDHLESKNTFEIEEKE 608
            +    + ESK+  EI EKE
Sbjct: 587 YDMMGSNSESKD--EIIEKE 604

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  517 bits (1332), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 271/585 (46%), Positives = 375/585 (64%), Gaps = 28/585 (4%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI    YN+   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 62  IKQTEIIGTAYNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINV 121

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I ++I Y +GTII+SQA ++ R+A G  FY  G 
Sbjct: 122 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 181

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+GN+TS  +   NW W +GMWAF
Sbjct: 182 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 241

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKL 283
           I PL+CIP+ +CMLHM++ A K       PE++ L     KS+         ++  FWKL
Sbjct: 242 IFPLSCIPIVLCMLHMQWRAGK------TPEWQELKGQ--KSYYQEHGLMKILEQLFWKL 293

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHP 343
           D+IG+LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE  Y+R P
Sbjct: 294 DVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWVWEYSYARDP 352

Query: 344 LTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           + P+ L++DRG              +YM  DY+YTV++VAV+ESIKSATRI++L SFVSV
Sbjct: 353 ILPYKLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSV 412

Query: 404 IVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGS 463
           +     G ++ +  R KPFI+ G S W+++ GLL  +RG S +HSGIIG+LC+ G G   
Sbjct: 413 VASPFFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTL 472

Query: 464 FTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D 
Sbjct: 473 FTYPVTVSVQ-SAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDV 531

Query: 524 TLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHK 583
            LAA AY SP+ FI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ +
Sbjct: 532 ALAASAYDSPYVFIETYTWGTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPR 591

Query: 584 LTDSIALEG---NDHLESKNTFEIEEKEESFLKNKFFTHFTSSKD 625
           LTD++A+E     +++++K++  I E  E     K  + FTS +D
Sbjct: 592 LTDTVAVENIKDGEYVDTKDSDPILEWFE-----KIPSKFTSKQD 631

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  515 bits (1326), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 244/555 (43%), Positives = 367/555 (66%), Gaps = 2/555 (0%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV NIEIY+E YN P+ R+ LF S+FL+ Y+Y LD  +R TF+  AT+S+S+HSL+S VN
Sbjct: 38  GVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSFVN 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
           C   +++A+G++FFAR +DIFGR SI  + ++FY +GTII + +  I++FA G C Y  G
Sbjct: 98  CFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYSFG 157

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
            +GI ++++++ SDFS+LNWRL+A  IP LP +IN W SG + S    NW+WGIGM+A I
Sbjct: 158 ESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPNVINAWASGTIVSDFSDNWQWGIGMFAII 217

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
           +P+ACIPL +C+ HMRY+A+K+ K+ LK  + + N+L W  F  +  FW+LD++G++ + 
Sbjct: 218 VPVACIPLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLITLG 277

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQD 352
              GC+LVPFTL     ++W  A  IVPEVIGW V LPLY++WE  Y+++PLTP  LI+D
Sbjct: 278 ASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLRLIRD 337

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + M+ +YM TVL VA + +  +ATRI + Y FVSV+   ILGF 
Sbjct: 338 RGVYAALVAVFLYEFIYVMEANYMVTVLQVAFNNTSAAATRINNSYEFVSVLTAFILGFF 397

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           ++ +R+TK  I+FG + + VS+GL + YRG  G ++G I +LC+ GF  G   Y T+ S+
Sbjct: 398 VVFIRKTKRLILFGGTLFFVSYGLFIRYRGGHGCYAGSIAALCVFGFANGFIKYPTRTSL 457

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGS 532
           QASA +H RMA++T+L+ A  ++            W+ ++P  +S RIS+  +AA+AY S
Sbjct: 458 QASAGSHKRMAMITALFTAIGSVGKAMAAAIAGAIWSGLMPGALSSRISNSKVAAKAYSS 517

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           P T I TY W +  R  ++ +YRYV K+L I+ +  C PLL  +F+LR+ +L + +A + 
Sbjct: 518 PLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIVAICLCVPLLIASFLLRDRRLENKVAYDS 577

Query: 593 NDHLESKNTFEIEEK 607
           +   +  +  + E+K
Sbjct: 578 DS--DDPSVLDEEKK 590

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  516 bits (1330), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 269/583 (46%), Positives = 368/583 (63%), Gaps = 21/583 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ ++ Y++   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 63  IRKTELLSKSYDKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 122

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSDI+GR S+++V+I+ Y++GTII+ QA ++ R+A G  FY  G 
Sbjct: 123 INAVVSAASQIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGY 182

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRL   F+P  PFIINTWISGN+T   +   +W W IGMWAF
Sbjct: 183 VGVILILLLILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAF 242

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK-------WKSFCIDIAFWKLD 284
           I PL+C+P+  CM+HM      H + R  PE++ L   K       WK   +   FWKLD
Sbjct: 243 IFPLSCVPILCCMIHM------HWRVRNDPEWKELQGEKTYFQIHGWK-VTLKTLFWKLD 295

Query: 285 IIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPL 344
           ++G+LL+    GC+LVP TLAGG+  +W  ++II P V+G+V++ P++  WE +++ +PL
Sbjct: 296 VVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVLI-PIFSYWEARWATNPL 354

Query: 345 TPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVI 404
            P+ L++DRG              +YM  DY+YTVL+VAVHES+KSATRI+SL SFVS +
Sbjct: 355 VPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTV 414

Query: 405 VGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSF 464
              I+   L +V R KP II G S W+++ GLL H+RG   +HSGIIG+LC+ G G   F
Sbjct: 415 ASPIVALALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLF 474

Query: 465 TYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPT 524
           TY    S+QA A  H  MA VT+L    Y I            WT  L K++ KRI +  
Sbjct: 475 TYPVTVSVQA-ATNHDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSE 533

Query: 525 LAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKL 584
           LA +AY SP+TFITTYTWGTPER A+V +YRYVQ++  I+ +VFC PL+  +  LR+ KL
Sbjct: 534 LATKAYASPYTFITTYTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKL 593

Query: 585 TDSIALEG---NDHLESKNTFEIEEKEESFLKNKFFTHFTSSK 624
           TD +A E     +++E  +   I E      K        SSK
Sbjct: 594 TDEVAHEDISEGEYIEKASGDPIGEFFAKLFKKTKNKTLKSSK 636

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  514 bits (1323), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 268/581 (46%), Positives = 371/581 (63%), Gaps = 20/581 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI+   YN+   +V L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIFGAAYNKWYLQVFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I ++I Y +GTII+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+GN+TS  +   NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+CIP+ +CMLHM++ A+K    H     K  ++    +K     I   FW LDIIG
Sbjct: 238 IFPLSCIPIVLCMLHMQWRAKKTPEWHTLKGQKSYYQEHGFIK----IIKQLFWMLDIIG 293

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PVLWIWEYRFARDPILPY 352

Query: 348 DLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L++DR               +YM  DY+YTV++VAV+ES+KSATRI++L SFVS +   
Sbjct: 353 KLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG S W+V+ GLL H+RG S +HSGIIG+L + G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ KLT++
Sbjct: 532 AAYDSPYTFIETYTWGTPQRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNA 591

Query: 588 IA---LEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSKD 625
           +A   +E  +++++K+   I E  E     K  + FTS +D
Sbjct: 592 VAVEYIEDGEYVDTKDNDPILEWFE-----KIPSKFTSKRD 627

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 263/572 (45%), Positives = 367/572 (64%), Gaps = 16/572 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI    YN+   +  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIIGSAYNKWYLQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I ++I Y +GTII+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F+P  PFIINTWI+GN+TS  +   NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+C+P+ +CMLHM++ ARK    HA    K  ++    +K     +   FW LD++G
Sbjct: 238 IFPLSCVPIVLCMLHMQWRARKTPEWHALKGQKSYYQEHGFIK----ILKQLFWMLDVVG 293

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWIWEYRFARDPILPY 352

Query: 348 DLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L++DR               +YM  DY+YTV++VAV+ES+KSATRI +L SFVS +   
Sbjct: 353 RLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG + W+V+ GLL H+RG S +HSGIIG+LC+ G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
            AY SP+TFI TYTWGTP+R AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ KLTD+
Sbjct: 532 TAYESPYTFIETYTWGTPQRNALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPKLTDT 591

Query: 588 IA---LEGNDHLESKNTFEIEEKEESFLKNKF 616
           +A   +E  +++++K+   I +  E  L +KF
Sbjct: 592 VAVEYIEDGEYVDTKDNDPILDWFEK-LPSKF 622

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 267/621 (42%), Positives = 374/621 (60%), Gaps = 23/621 (3%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNI------------EIYAEMYNRPIY 69
           ++EK   A V  K +   S   P     +D  + N+            EI +  Y +   
Sbjct: 10  IVEKNTAAIVSSKKS---SDEEPMDYNEVDEELQNVLQTNKSIVIKKAEIISASYAKWYE 66

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++   F  FL  Y YGLD NIRY +  YATSSYS+HSLLSTV  I  V++A  QI +ARL
Sbjct: 67  KLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARL 126

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGRF + +V+I+ YSMGTII+ QA ++ R+A G  FY  G  G+IL+L +I SD S 
Sbjct: 127 SDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMST 186

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAFILPLACIPLGICMLHM 247
           L WRL   F+P  P+IINTWISGN+TSA +   NW W +GMWAFI PL+C+P+  CM+HM
Sbjct: 187 LRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPILACMIHM 246

Query: 248 RYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAG 306
           ++ ARK  +   LK +     +       + + FWK+DIIG+LL+    GC+LVP TLAG
Sbjct: 247 QWRARKTQEWKDLKTQKTYYQQHGLMKSLVSL-FWKIDIIGVLLMAASLGCILVPLTLAG 305

Query: 307 GLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXX 366
           G   +W+ + II   V+G+V++ P++ +WE K++  P+ P+ L++DRG            
Sbjct: 306 GTSSKWRDSRIIGVFVLGFVLI-PIFFIWEKKFATDPIVPYKLVKDRGVWASLGISFLID 364

Query: 367 XXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFG 426
             +YM  DY+YTVL+VAV+ES+ +ATRI+SLYSFVS +    +   L +  R KPFIIFG
Sbjct: 365 FIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKPFIIFG 424

Query: 427 ISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVT 486
              W ++ GLL H+RG + +HSGIIG LC+ G G+  FTY    S+QA A +H +MA V+
Sbjct: 425 CCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQA-AVSHEQMATVS 483

Query: 487 SLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPE 546
           +L    Y I            WT  L K++   + D TLA  AYGSP+TFI TYTWGTPE
Sbjct: 484 ALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYGSPYTFIVTYTWGTPE 543

Query: 547 RIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEE 606
           R A+V +YRY+Q++  ++ LVFC PL+  +  LR+ +LTD++A +     E  +T   + 
Sbjct: 544 REAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAHDDMSSGEFIDTKSDDP 603

Query: 607 KEESFLKNKFFTHFTSSKDRK 627
             E F+    +   T  K+ K
Sbjct: 604 LAEFFV--GLWRRVTGKKENK 622

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  501 bits (1290), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/577 (45%), Positives = 364/577 (63%), Gaps = 13/577 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI   +Y++  Y V L FS F+  Y YGLDGNIRY +  YATSSY++HSLLST+N 
Sbjct: 96  IRETEIMKSVYDKWYYHVILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINV 155

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V +A  QI +AR SD+FGR S+ IVS++FY++GTII+ QA ++ R+  G  FY +G 
Sbjct: 156 INAVASAASQIVYARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGY 215

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+IL+L +I SDFS+L WRL   F P  P+IINTWISGN+TSA +   +W W IGMWAF
Sbjct: 216 VGVILVLLLILSDFSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAF 275

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDR-LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL+ IP+ +C++HMR++A K  + + LK E   + +  + S   D+ FW+LD+IG+LL
Sbjct: 276 IFPLSSIPIILCLIHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDL-FWRLDVIGVLL 334

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +    GC+LVP TLAGG   +W   +II P  +G+V++ P++  WE K+S+ PL P  L+
Sbjct: 335 MGASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLI-PIFTFWEWKFSKSPLIPSKLV 393

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DR               +YM  DY+YTVL+V V+ES+KSATRI+SL SFVS +   I  
Sbjct: 394 KDRAVWSSMAISFLIDFIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFA 453

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            ++ +  R KPFI+ G + W++S GLL HYRG + +H+GII SLC+ G G   FTY    
Sbjct: 454 LLITRFTRLKPFIVAGCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINV 513

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QA A +HA MA VT+L    Y I            WT  L K++ KR+ D TLA  AY
Sbjct: 514 SVQA-AVSHADMATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAY 572

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA- 589
            SP++FI  YTWGT  R  +V +YRYVQ++  I+ LVF  PLL  +  LR+ +LTD++A 
Sbjct: 573 SSPYSFIVNYTWGTTVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVAS 632

Query: 590 --LEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSK 624
             +E   H+   ++  I +    FL   F   F  +K
Sbjct: 633 DDIEEGQHINKTDSDPIAD----FLSKPFKGLFKKNK 665

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  500 bits (1287), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 264/578 (45%), Positives = 363/578 (62%), Gaps = 16/578 (2%)

Query: 24  EKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83
           EK++    +    +T  SP P    +I       E+ A +Y++  Y V L  S F+  Y 
Sbjct: 29  EKDIETN-ETDDDITIRSPPPKKSLVI----KQTEVMASVYDKWYYHVVLLVSAFICGYG 83

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143
           YGLDGNIRY +  YATSSY++HSLLSTV  I  V++A  QI ++RLSD FGRF + +++I
Sbjct: 84  YGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAI 143

Query: 144 IFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           + Y +GTII+SQA ++ R+A G  FY  G  G++LIL +I SDFS+L WRL   F P  P
Sbjct: 144 VLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWP 203

Query: 204 FIINTWISGNVTSAID--ANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKP 261
           FIINTWISGN+T A +   +W W +GMWAFI PL+CIP+ +CM+HM++ A K  + +   
Sbjct: 204 FIINTWISGNITLAANPLVHWSWDVGMWAFIFPLSCIPMLLCMIHMQWKASKTEEWKELK 263

Query: 262 EFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPE 321
           + ++  +       +   FW+LDIIG+LL+  + GC+LVP TLAGG+K +W    II P 
Sbjct: 264 KEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIGPF 323

Query: 322 VIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLV 381
           V+G+V+V P++  WE  ++R PL P+ LI+DRG              +YM  DY+YTVL+
Sbjct: 324 VLGFVLV-PIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLYTVLI 382

Query: 382 VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYR 441
           VAVHES+KSATRI+SL SFVS +       +L +  R KPFI+ G S W++S GLL H+R
Sbjct: 383 VAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVGCSLWMLSMGLLYHFR 442

Query: 442 GDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXX 501
           G   +HSGIIG+LC+ G G   FTY    S+Q SA +H  MA VT++    Y +      
Sbjct: 443 GGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQ-SATSHENMATVTAINYTCYRLGSAIGA 501

Query: 502 XXXXXXWTNILPKEISKRISD-------PTLAAQAYGSPFTFITTYTWGTPERIALVMSY 554
                 WT  L  +I KR+++        T+A +AY SP+TFIT YTWGTP R A+V SY
Sbjct: 502 AVSGAIWTQKLYPDILKRVTEVVGATEAVTIATEAYSSPYTFITKYTWGTPVRDAVVESY 561

Query: 555 RYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEG 592
           RY+Q++  I+ LVFC PL+  +  LR+ KLTD IA E 
Sbjct: 562 RYIQRLETIVALVFCVPLIIFSLCLRDAKLTDEIAHEN 599

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  487 bits (1254), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 273/628 (43%), Positives = 386/628 (61%), Gaps = 37/628 (5%)

Query: 23  LEKEVGAKVDVKPTLTTSSPAPSYIELIDPG------------VHNIEIYAEMYNRPIYR 70
           +EKE    V        +    S+ EL + G            +   EI A  Y+   YR
Sbjct: 3   IEKETATGVQSSAYPIEADDKDSHRELNEYGLPDKLRVTRHIVIKKTEILAAQYDSWYYR 62

Query: 71  VALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           V L F+ F+  Y YGLDGNIRY +  YAT++YS+HSLLST+  +  VI A  Q+ +ARL+
Sbjct: 63  VILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLA 122

Query: 131 DIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNL 190
           D FGR S+ I +I+FY++GTII+SQA ++ R+A G  FY +G  G+IL+L ++ SDFS+L
Sbjct: 123 DTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDFSSL 182

Query: 191 NWRLLALFIPALPFIINTWISGNVTSAI--DANWKWGIGMWAFILPLACIPLGICMLHMR 248
            WRLL   +P  PFIINTWISGN+TSA   + NW W IGMWAFI PL+C+PL  CM+HMR
Sbjct: 183 RWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSCVPLIACMIHMR 242

Query: 249 YLARKHAKDRLKPEFEALNKLK--------WKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
             ARK       PE+ AL + K        W +  +++ FWKLD++G+LL+    GC+LV
Sbjct: 243 IKARK------TPEWIALKQEKSYFQTNGLWDTL-VEL-FWKLDVVGVLLLIATLGCILV 294

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           P TLAGG   +W   HII P V+G+V+V P+ M WE++++R PL P+ LI+DRG      
Sbjct: 295 PLTLAGGYNSKWNNPHIIGPFVLGFVLV-PILMFWEMRWARDPLVPYGLIKDRGVWSALA 353

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   + +   Y+Y +L+VAV ES+KSATRI+SL SFVSV+   I    + + ++ K
Sbjct: 354 ISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIFSLFITRQKKLK 413

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           P+I+ G + W+V  GLL HYRG S AHSGIIG+LC+ G G+  +TY    S+Q SA +H 
Sbjct: 414 PYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYPVNISVQ-SATSHE 472

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
            +A VT+L    Y I            WT  L K++ KR+ D  LAA AY SP+TFI +Y
Sbjct: 473 NLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAAAAYASPYTFIVSY 532

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
            WGTP+R A+V +YR+VQ+   I+ LVFC PL+  A  LR+  LTD +A  G +    K 
Sbjct: 533 AWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDEVAHSGLE----KG 588

Query: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628
            + ++++ +  + + F + ++  ++RK+
Sbjct: 589 EYIVKDQTDP-ISDWFSSKWSRLRERKE 615

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  484 bits (1245), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 254/538 (47%), Positives = 341/538 (63%), Gaps = 4/538 (0%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+   +R+ L F  F+  Y YGLD NIR+ + +Y T+S+S+HSLLSTVN 
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR ++ I +++FYSMGT+I+SQ+ NI  +A G  FY LG 
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G++L+L +I SDFS+L WRL   F P  PFIINTWISGN+TS  +   NW W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I PL+C+PL  CMLHM + AR+  + ++  E +   K       I   FWKLD IG  ++
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIM 318

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           TV  GC+LVP TLAGG   +W  + II P V+G VV+LP+ +++E+K++R P+ PW LI+
Sbjct: 319 TVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLIK 377

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DR               +YM  DY+YTV++VAV ES+KSATRI+SL +FVS +       
Sbjct: 378 DRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFAL 437

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
            + +V R KP+II G   W+V+ GLL H+RG   +HSGIIG LC+ G G   FTY    S
Sbjct: 438 YITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVS 497

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
           +Q SA +H  MA VTSL    Y I            WT  L  EI KR+ D  +A+ AY 
Sbjct: 498 VQ-SATSHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYE 556

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA 589
            P+ FI  YTWGTP R  +V +Y +VQK+  ++GLVFC PLL  +  LR+ +LTD IA
Sbjct: 557 QPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIA 614

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  479 bits (1233), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 251/548 (45%), Positives = 346/548 (63%), Gaps = 14/548 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  YN+  + + L F+ F+  Y YGLDGNIRY +  YATSSY++HSLLSTV  
Sbjct: 57  IRKTEIMAAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTV 116

Query: 114 IKTVIAAVGQIFFARLSDIFGR-FSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
           I  V++AV QI+      +FGR + I +V+I+ YS+GTII+SQA ++ R+A G  FY  G
Sbjct: 117 INAVVSAVSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAG 176

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWA 230
            +G++ IL +I SDFS+L WRL   F P  PFIINTWISGN+TSA +   NW W IGM A
Sbjct: 177 YSGVLFILLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRA 236

Query: 231 FILPLACIPLGICMLHMRYLARKHA--KDRLKPE--FEALNKLKWKSFCIDIAFWKLDII 286
           FI+PL+C+P   CM+HM + ARK    K+ LK +  +E  N L W +  +++ FW+LD+ 
Sbjct: 237 FIIPLSCLPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGL-WGTL-VEL-FWRLDVA 293

Query: 287 GMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTP 346
           G++L+    GC+LVP TLAGG   +W   ++I P ++G+V++ P + LWE  ++R PL P
Sbjct: 294 GLILMGSSLGCILVPLTLAGGTSSKWNHGNVIGPFILGFVLI-PFFALWEKFFARDPLLP 352

Query: 347 WDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVG 406
             L++DRG              +YM  DY+YTVL+VAV ES+KSATRI+SL SFVS +  
Sbjct: 353 AKLVKDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVAS 412

Query: 407 TILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTY 466
                 L +  R KP+I+ G S W+++ GLL ++RG   +HSGIIG+LC+ G G   FTY
Sbjct: 413 PFFALYLTRCSRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTY 472

Query: 467 VTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLA 526
               S+QA A +H  MA VT+     Y I            WT  L K++ K + D  LA
Sbjct: 473 PVTVSVQA-AVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALA 531

Query: 527 AQAYGSPFTFITTYTWGT-PERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
             AY SP+TF T Y WGT PER A+V +YRYVQ++  ++ LVFC PL+  +  LR+ +LT
Sbjct: 532 TAAYSSPYTFTTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLT 591

Query: 586 DSIALEGN 593
           D +A  GN
Sbjct: 592 DEVA-HGN 598

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  473 bits (1218), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 255/585 (43%), Positives = 363/585 (62%), Gaps = 25/585 (4%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  Y+   YR  L FS FL  Y YGLDG++RY +  YAT+SY++HSLLST+  
Sbjct: 46  IRKTEILAAQYDTWFYRSILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAV 105

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  VI+A  QI +ARL+D+FGR  + I ++IFY +GTII+SQA ++ R+A G  FY  G 
Sbjct: 106 INAVISAAAQIVYARLADVFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGY 165

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G++L+L +I SDFS+L WRL   F+P  PFIINTWI+G++TS  +   NW W I MWAF
Sbjct: 166 VGVVLVLLLILSDFSSLKWRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAF 225

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKL 283
           I PL+ +P+  CMLHMR  ARK       PE++ L++   KSF         +   FWKL
Sbjct: 226 IFPLSALPIICCMLHMRIKARK------TPEWQVLSEE--KSFYQTHGFIQTLVQLFWKL 277

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHP 343
           D+IG+L++TV  GC+LVP TLAGG   +W+ + II P V+G+V++ P+Y+ WE K+++ P
Sbjct: 278 DVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVLGFVLI-PMYIYWESKWAKEP 336

Query: 344 LTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           + P+ L++DRG              +YM  DY+Y VL++ V++S+KSA+RI+SL SFVS 
Sbjct: 337 MAPFKLLKDRGVWAALGISFLIDFIFYMAADYLYAVLLIGVNQSVKSASRISSLSSFVST 396

Query: 404 IVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGS 463
           +       I+ +  R KP+II G S W+++ GLL H+RG S ++SGI+G+LC+ G G   
Sbjct: 397 VASPFFALIITRSTRLKPYIITGCSLWMLAMGLLYHFRGGSESYSGIVGALCVWGIGTTM 456

Query: 464 FTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDP 523
           FTY    S+Q S  +H  MA VT+L    Y I            WT  L K++  R+ D 
Sbjct: 457 FTYPVNVSVQ-SVTSHENMATVTALNYTLYRIGAAVGAAVSGAIWTQTLYKDLLNRLDDA 515

Query: 524 TLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHK 583
            LA  AY  P++FI T+TW TPER A+V SYRYVQ++  I+ LVF  PLL  +F LR+  
Sbjct: 516 ALAMSAYSEPYSFIITHTWNTPERDAMVQSYRYVQRLETIVALVFTVPLLVFSFFLRDPP 575

Query: 584 LTDSIALEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSKDRKD 628
           LTD +A    D++E      +   +   + + F + F   + +K+
Sbjct: 576 LTDKVA---QDNIEEGEYINVNHNDP--ITDWFSSRFERLRGKKE 615

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  473 bits (1217), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 255/575 (44%), Positives = 358/575 (62%), Gaps = 9/575 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A+ Y+   ++  L FS+FL +Y YGLDG++R  +  YAT+SYS HSLLST++ 
Sbjct: 51  LRKTEILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISI 110

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  VI A  Q+FFARLSD+FGR +++IV+ +FYS+GTII+SQA ++ R+A G  FY +GL
Sbjct: 111 INLVIGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGL 170

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G++L + +I SDFS+L WRL   F+P+ PFIIN W+SGNV +A +   NW W IGMWAF
Sbjct: 171 VGVVLQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAF 230

Query: 232 ILPLACIPLGICMLHMRYLARK-HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL C+PL  C+LHMRY A K  A   L+ E             I + FWKLD++G+LL
Sbjct: 231 IFPLTCLPLVCCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQL-FWKLDVVGVLL 289

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +TV  GC+LVP TLAGG+ ++W   H+I P V+G+ V+LP++++WE K++  P+ P++L+
Sbjct: 290 LTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGF-VLLPIFVVWESKWALDPIAPFELL 348

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              + M   Y+YT+LV+AV ES  SATRITS+YSF + +      
Sbjct: 349 KDRGVWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFA 408

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            ++ + +R KP+II G S W+V+ G+L H+R    +  GIIG L L G  +  FTY    
Sbjct: 409 LVVTRSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPVTV 468

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPTLAAQA 529
           S+Q S  +H  MA VT+L    Y I            WT +L K++ K ++ D TLA  A
Sbjct: 469 SLQ-SITSHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLATAA 527

Query: 530 YGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA 589
           YGSPF FI  Y WGTP R A+V SYRYVQK   ++ L+F  P+   +  LR+  LTD  A
Sbjct: 528 YGSPFDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDDQA 587

Query: 590 LEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSK 624
            E     E  NT E ++   +++ +K +T  T  K
Sbjct: 588 QENLKEGEYINT-EHDDPILAWMDDK-WTRITGGK 620

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  466 bits (1199), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 244/589 (41%), Positives = 349/589 (59%), Gaps = 14/589 (2%)

Query: 28  GAKVDVK---PTLTTSSPAPSYIELIDP-GVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83
           G  VD K   PT       P Y++      +   EI AE Y+   +RV L FS FL  Y 
Sbjct: 34  GVGVDEKQAGPTDLNEYGIPDYLKSSKSLTIRKTEILAEQYSSWQWRVVLLFSAFLCGYG 93

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143
           YGLDGN+R  +  +AT+SYS HSLLST+  +  V+ A  QI +ARLSD++GRF++ + +I
Sbjct: 94  YGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGAASQIVYARLSDVYGRFTLFVTAI 153

Query: 144 IFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           +FY +GTIIESQA ++ R+A G  FY +G  G+ILI+ +I SDFS+L WRL   F+P  P
Sbjct: 154 VFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIVLLILSDFSSLKWRLFYSFVPTWP 213

Query: 204 FIINTWISGNVTSAI--DANWKWGIGMWAFILPLACIPLGICMLHMRYLARK-HAKDRLK 260
           FIINTWISGN+      + NW W I MWAFI PL+C+PL  CMLHM++ AR+  A   L 
Sbjct: 214 FIINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSCLPLLGCMLHMKWRARQTEAWKELS 273

Query: 261 PEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVP 320
            +             + + FWKLD+IG+  + +  GC+LVP TLAGG+  +W   HII P
Sbjct: 274 SQKTYYQTHGLVQSLVQL-FWKLDVIGVFFMIIILGCILVPLTLAGGISNKWNNPHIIAP 332

Query: 321 EVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVL 380
            ++G+V++ P ++ WE K++R P+ P+ L++DRG              + M   Y+YT+L
Sbjct: 333 FILGFVLI-PFFIAWESKWAREPIAPFKLLRDRGIWAALCIAFLINFIFTMAAGYLYTIL 391

Query: 381 VVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHY 440
           +VAV+ES+ SATRI+S+ +F S +        + +  R KPFII G S W+V+ G+L H+
Sbjct: 392 MVAVNESVTSATRISSVSTFTSTVFSPFFALFITRFTRLKPFIIAGCSLWMVAMGILFHF 451

Query: 441 RGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXX 500
           R    +  GIIG+L + G G   FTY    S+Q S  +H  MA VT+L    Y I     
Sbjct: 452 RSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQ-SVTSHENMATVTALSYTMYRIGSAVG 510

Query: 501 XXXXXXXWTNILPKEISKRIS-DPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQK 559
                  WT +L K++ + +  D TLAA  YGSP T+I  Y WGTP R  +V +YRYVQK
Sbjct: 511 SAVSGAIWTQLLYKQLLQHLDGDATLAASFYGSPLTYIAQYPWGTPVRDGVVQAYRYVQK 570

Query: 560 ILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKNTFEIEEKE 608
              ++ LVF  PL   +  LR+  LT+ +A   +++++     ++E+ +
Sbjct: 571 YEVLVALVFTAPLFVFSLCLRDPPLTNEVA---HENIKQGEYVDVEDDD 616

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  454 bits (1169), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 249/547 (45%), Positives = 340/547 (62%), Gaps = 16/547 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  Y+   YRV L FS F+  + YGLD NIRY +  YATSSY+QHSLLSTV  
Sbjct: 47  IRKTEILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAI 106

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  +++A  QIF+ARLSD+FGR S+ +VS++FY +GTII+SQA ++ ++A G  FY +G 
Sbjct: 107 INNLLSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGY 166

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ LIL +I SD S+L WRL   + P  PFII TWISGN+ S  +   NW WGIGMWAF
Sbjct: 167 VGLFLILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAF 226

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSFCIDIA----FWKLDI 285
           I PL C+P+  CMLHMR+ ARK       PE++ L+  K  +++  I  A    FWKLD+
Sbjct: 227 IFPLTCLPILFCMLHMRFKARK------TPEWQDLSSQKSFFQTHGIVQALVQLFWKLDV 280

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLT 345
           +G+ ++T+  GC+LVP TLAGG   +W+ + II P V+G+V+V P+++ WE K+++ PL 
Sbjct: 281 VGIFIMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLV-PVFIYWESKWAKDPLA 339

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
           P++L++DRG              + M   Y+Y VL+VAV ES KSATRITSL SFVS + 
Sbjct: 340 PFELLKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTVA 399

Query: 406 GTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFT 465
              +G+ + +  R KP+I+ G   W ++ GLL HYR    +HSGIIG L LLG G     
Sbjct: 400 SPFMGYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSI 459

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
           Y    S Q S  +H  MA VT+L    Y I            WT  L  ++ KR+ D TL
Sbjct: 460 YPINVSAQ-SLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRLGDATL 518

Query: 526 AAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
           A  AY +P++F+ TY W TP R A+V +YR VQ++  +I L+F  PLL  +  LR+  LT
Sbjct: 519 AMSAYSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLFLRDPPLT 578

Query: 586 DSIALEG 592
           D +  E 
Sbjct: 579 DQVGQEN 585

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  451 bits (1161), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/564 (42%), Positives = 342/564 (60%), Gaps = 16/564 (2%)

Query: 47  IELIDPG----------VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQA 96
           +E + PG          +   EI A  Y+R  +   + FS F+  Y YGLDG++RY + +
Sbjct: 21  VEKVTPGCTLKTTKSLVIRKTEIMAAQYDRWYHHAIILFSAFICGYGYGLDGSVRYVYTS 80

Query: 97  YATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQA 156
           YA SSYS H L+ST+  +  +I+A  QI FARLSD+FGR S+ I +++FY++GTII+SQA
Sbjct: 81  YAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRLSLFITALLFYAVGTIIQSQA 140

Query: 157 VNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTS 216
            ++ ++A G  F+  G  G++LIL +I SDFS+L WRL+  F P+ P+IINTW +G VT+
Sbjct: 141 TDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVYQFAPSWPYIINTWFAGTVTA 200

Query: 217 AID--ANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKS 273
             +   +W W I MWAFI+PL+ +P+  CMLHMR+ ARK  +   +K E           
Sbjct: 201 RANPQEHWSWDIAMWAFIVPLSALPMIFCMLHMRFKARKTEQWAAIKDEKSFFQSHGLIR 260

Query: 274 FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYM 333
             +++ FWKLDI+G+LL+T+  GC+L P TLAGG+K +W   H+I P V+G+ V+LPL+M
Sbjct: 261 TLVEL-FWKLDIVGVLLMTISVGCILAPLTLAGGVKSKWSNPHLIGPLVLGF-VLLPLFM 318

Query: 334 LWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATR 393
           +WE K +++P+ P+ LI+DR               +     Y+YT+L+VAV+ES+KSAT 
Sbjct: 319 IWESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVAGYIYTILIVAVNESVKSATV 378

Query: 394 ITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGS 453
           I+SL SFVS +  T     + +  + K +II G   W+++ GL  HYRG   AHSGI+G+
Sbjct: 379 ISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLAMGLFYHYRGGEFAHSGIVGA 438

Query: 454 LCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILP 513
           + + G G     Y T  S+Q SA +H  MA VT+L    Y I            W+  L 
Sbjct: 439 MVIWGLGDTLLIYPTTISVQ-SATSHDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLY 497

Query: 514 KEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLL 573
           K +  R+     A+ AY +PF FI TYTWGTPER A+V +YR+VQ+   I+ LVF  PLL
Sbjct: 498 KALLSRLQSVEQASAAYSTPFEFILTYTWGTPERNAMVDAYRHVQRYESIVALVFTVPLL 557

Query: 574 GCAFMLRNHKLTDSIALEGNDHLE 597
                LR+  LTD +A E  D  E
Sbjct: 558 FFGLCLRDPPLTDKVAQEDIDDGE 581

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  451 bits (1161), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 241/539 (44%), Positives = 333/539 (61%), Gaps = 6/539 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+R  + V L F+ FL  Y YGLDGNIR  + +YA +SY+ H L+ST++ 
Sbjct: 41  IRKTELMASCYDRWYHHVFLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSV 100

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           +  V++A  QIFFARLSD+FGR S+ + +I FY +GTII+SQA +I R+AVG  F+ +G 
Sbjct: 101 VTGVMSAASQIFFARLSDVFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGY 160

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT--SAIDANWKWGIGMWAF 231
            GI+L+L +I SDFS+L WRLL  F P+ P IINTWI+G +T  S     W W IGMWAF
Sbjct: 161 VGILLMLILIVSDFSSLRWRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAF 220

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I+PL C+P+ +CMLHMR+ AR+  +   L+ E             I++ FWK+D++G+LL
Sbjct: 221 IIPLTCLPMILCMLHMRFKARRTEQWAELRNERSYYQTHGLIKTLIEL-FWKVDVVGILL 279

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +T   GCVL P TLAGG   +W+   +I P V+G+ V+LP++++WE K++R P+ P+DLI
Sbjct: 280 MTASIGCVLAPLTLAGGTGSKWQNPRVISPFVLGF-VLLPIFLIWEKKWARDPIIPYDLI 338

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DR               + M   Y+Y +L+V V+ESIKSAT IT L SFV+        
Sbjct: 339 KDRAVWASLNSQFLIGFIYMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFC 398

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             + +  R K +I+ G   W+++ GL  HYRG   AH GI+ ++ + G G     Y    
Sbjct: 399 LWITRCTRMKGYIVAGCGLWMLAMGLFYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPITV 458

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+Q SA +H  MA+VT+L   TY I            WT  L KE+ KR+ D TLA  AY
Sbjct: 459 SVQ-SATSHDNMAMVTALNYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAY 517

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA 589
             PF FITTYTWGTPER A+V +YR+VQ+   I+ LVF  PLL     LR+  LTD +A
Sbjct: 518 SDPFKFITTYTWGTPEREAVVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVA 576

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  451 bits (1159), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 242/563 (42%), Positives = 345/563 (61%), Gaps = 18/563 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    FS FL ++ YGLDGNIR  +  YA +SYS HSL+STV  
Sbjct: 54  IRKAELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGV 113

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  VI+AV Q+ +A LSD+FGR S+ IVSI+FY +GTII+SQA ++ R+A G  FY +GL
Sbjct: 114 ISMVISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGL 173

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNV--TSAIDANWKWGIGMWAF 231
            G++L + ++ SD S+L WRL   F+PA P II TW+SGNV  T+  + NW W I MWAF
Sbjct: 174 VGVMLQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAF 233

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDI 285
           I PL+CIPL  CMLHMR+      K R +PE++ L   K  ++S      +   FWKLD+
Sbjct: 234 IFPLSCIPLIACMLHMRW------KVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDV 287

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLT 345
           +G++L+TV  GC+LVP TLAGG+  +W++A +I P V+G+V++  +++ WE K +  P+ 
Sbjct: 288 VGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVLI-AIFIYWESKLALAPIA 346

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
           P+ +++DRG              + M   Y+YT+L+VAV E+  SATRITSLYSFVS I 
Sbjct: 347 PFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIF 406

Query: 406 GTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFT 465
             +LGFI+ +  R KP+++ G S + V+ GL   YR    AH G+IG++ + G  +  F 
Sbjct: 407 APVLGFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFD 466

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
           Y    SIQ S  +H  MA VT+L    ++I            WT +L  ++ + I D  L
Sbjct: 467 YPVTVSIQ-SVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADL 525

Query: 526 AAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
           A  AY SP TF   Y WGTP R A+V +Y++VQK   +I LVF  P+    F LR+  LT
Sbjct: 526 AEAAYSSPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLT 585

Query: 586 DSIALEGND--HLESKNTFEIEE 606
           D +A + ND  ++E+ +   I E
Sbjct: 586 DDVAQKLNDGEYVETSHDDPISE 608

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  433 bits (1114), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 223/537 (41%), Positives = 330/537 (61%), Gaps = 6/537 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI A  YN    +V      FL AY Y LD +IRY +  YAT+SY+ HSLLST++ 
Sbjct: 57  IRKTEIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISI 116

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  +I+AV Q+FFA LSD+FGR  +MIV+I+FY +GT+I+SQA +I R+A G  FY +G+
Sbjct: 117 INMMISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGV 176

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G++L + +  +D S+L WRLL  F+PA P IIN W+SGN+  A +   NW W I MWAF
Sbjct: 177 VGVMLQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAF 236

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           ILPL+C+PL  C++HMR+ A K  +   L+ E     K  +    +++ FWK+DI+G+LL
Sbjct: 237 ILPLSCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHGFVHTIVEV-FWKVDIVGLLL 295

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
           +T   GC+LVP T+AGG+ E+W    II P V+G V ++PL + WE  +++ P  P+ L+
Sbjct: 296 LTASMGCILVPLTIAGGISEQWNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLL 354

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              + M   Y+YT+L+V+++++  SATRI +LYSFV+ I   I G
Sbjct: 355 KDRGIWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFG 414

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F++ +  R K F++ G   + +  GL   YRG  GA SGIIG++ + G  +  +TY    
Sbjct: 415 FVVARTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTT 474

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S Q S  +H  MA VT++ L  + I            WTN+L  ++ + + D  LA+ AY
Sbjct: 475 SAQ-SVTSHENMATVTAMLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAY 533

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
            +P TFI ++ W T  R A++ +YR+VQK   ++GL+F  P+L   F LR+ +LTD 
Sbjct: 534 TAPLTFIVSHPWNTEVRTAMIDAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTDD 590

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  430 bits (1106), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 224/551 (40%), Positives = 327/551 (59%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +     + F+ ++AYGLD  IR  +  YA   Y++HSLLSTVN 
Sbjct: 53  IRKSELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           +  +I+AVGQIFFA LSD+FGR S+ +V+IIFY +GTII+SQA ++ R+  G  FY +GL
Sbjct: 113 VSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G I  + +I SD S+L WRL   F+PA P  +  WISGNV    +   NW WGIGMW F
Sbjct: 173 VGAIFQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGF 232

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P +C+PL  CMLHMR+  +   + +   E ++  +       +   FWKLD+ G+LL+
Sbjct: 233 IFPASCLPLIACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLL 292

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           T   GC+LVP T+AGG+  +W++A +I P V+G+ +V P+++ WE + +  PL P+ +++
Sbjct: 293 TACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFALV-PVFLYWESRIALVPLAPFKMLK 351

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YTVL+VA +ES  SATRITSLYSFV+ I   ILG 
Sbjct: 352 DRGIWAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGV 411

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ + G S + V+ GL  HYRG   A  GIIG++ + G  +  + Y    S
Sbjct: 412 LVARSTRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISIS 471

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+L L  + I            WT  L  ++ K + DP +AA+AY 
Sbjct: 472 MQ-TVTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAYD 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA-- 589
            P TFI  Y WGT  R A V +YRYVQK   ++GL+F  P+    F LR+  LT+     
Sbjct: 531 EPLTFIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTEEYGQN 590

Query: 590 LEGNDHLESKN 600
           LE +++++  +
Sbjct: 591 LEDDEYVKEND 601

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  427 bits (1097), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 218/551 (39%), Positives = 327/551 (59%), Gaps = 6/551 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    F++F+ ++AYGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 53  IRKAELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  VI+AVGQIFFARLSD+FGR S+ IVSI+ Y +GT+I+SQA ++ R+A G  FY +GL
Sbjct: 113 ISMVISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G +  + +I SD S L WRL   F+PA P II  WISGNV    +   NW WGI MWAF
Sbjct: 173 VGAMFQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P++CIP   C+LHMR+  R   + R   E ++  +           FW+LD++G++L+
Sbjct: 233 IFPVSCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILL 292

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           +VF GC+ VP T+AGG+  EW++  +I P V+G+ ++ P ++ WE + +R PL P+ +++
Sbjct: 293 SVFTGCICVPLTVAGGVSTEWRSGKVIAPFVLGFSLI-PAFVYWESRLARFPLAPFLMLK 351

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M  +Y+YT+L+VA +ES  SA RITSLYSFV+ I   I+G 
Sbjct: 352 DRGIWAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGL 411

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ +  R KP+ + G S + V+ GL  HYRG + A  G+IG++ + G  +  + Y    S
Sbjct: 412 LVARSSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPISVS 471

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
           IQ +  +H  +A V++L    + I            WT  L  ++ K + D  +A  A+ 
Sbjct: 472 IQ-TVTSHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAAFN 530

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA-- 589
           SP  FIT Y WGTP R A V +++YVQK   ++GL+F  P+    F LR+  L +     
Sbjct: 531 SPLDFITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLNEEFGQN 590

Query: 590 LEGNDHLESKN 600
           L G ++++  +
Sbjct: 591 LNGEEYVKEND 601

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/568 (38%), Positives = 334/568 (58%), Gaps = 8/568 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  + +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ IV+I+FY +GT+I+SQA ++ R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI--DANWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  F+PA P ++  WISGNV      + NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P  C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           +V  GC+L+P T+AGG    W++A +I P V+G ++V P ++ WE K +  PL P+ +++
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA-- 589
            P +F+  + WGTP R A++ +YRYVQK   ++GL+F  P+    F LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 590 LEGNDHLESKN--TFEIEEKEESFLKNK 615
           LE +++++  +  T  I E+  SF K++
Sbjct: 593 LEDDEYVKHDDPITDWIAERFSSFKKHE 620

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  422 bits (1086), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 221/568 (38%), Positives = 334/568 (58%), Gaps = 8/568 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  + +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKAELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ IV+I+FY +GT+I+SQA ++ R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI--DANWKWGIGMWAF 231
            G +  + ++ SD S+L WRLL  F+PA P ++  WISGNV      + NW WGI MWAF
Sbjct: 175 VGSMFQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAF 234

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I P  C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL 
Sbjct: 235 IFPATCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           +V  GC+L+P T+AGG    W++A +I P V+G ++V P ++ WE K +  PL P+ +++
Sbjct: 295 SVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLK 353

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G 
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
            + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINIS 473

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
           +Q +  +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY 
Sbjct: 474 MQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYN 532

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA-- 589
            P +F+  + WGTP R A++ +YRYVQK   ++GL+F  P+    F LR+  LT+     
Sbjct: 533 MPLSFMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQK 592

Query: 590 LEGNDHLESKN--TFEIEEKEESFLKNK 615
           LE +++++  +  T  I E+  SF K++
Sbjct: 593 LEDDEYVKHDDPITDWIAERFSSFKKHE 620

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  421 bits (1083), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 223/572 (38%), Positives = 334/572 (58%), Gaps = 16/572 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+    +    FS F+ A++YGLD  IR  +  YA +SYS HSLLSTV+ 
Sbjct: 53  IRKTELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR S+ IV+I+FY +GTII+SQA ++ R+A G  FY +GL
Sbjct: 113 ISLTISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G +  + +I SD S+L WRL   F+PA P ++  WISGNV S  +   NW WGI MWAF
Sbjct: 173 VGSMFEITLILSDCSSLKWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAF 232

Query: 232 ILPLACIPLGICMLHMRYLARKHAK----DRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I P +C+P+  C+LHMR+  R + +       K  F+    ++     +   FWKLD++G
Sbjct: 233 IFPASCLPIIGCLLHMRWKLRNNPEWIELQEEKTYFQTHGLVQ----TLKQLFWKLDVVG 288

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPW 347
           +LL ++  GC+LVP TLAGG   +W++A +I P V+G+++V P+++ WE K +  PL P+
Sbjct: 289 VLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLGFLLV-PVFIYWESKLALVPLAPF 347

Query: 348 DLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            +++DRG              + M   Y+YT+LVVA +ES  SATRITSLYSFV+ +   
Sbjct: 348 KMLKDRGIWAPLVITFLICYIYMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSP 407

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
           ++G  + +  R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y 
Sbjct: 408 VVGIFVARFTRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYP 467

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q +  +H  MA VT+  L  + I            WT  L   + K + DP +A 
Sbjct: 468 INISMQ-TVTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAI 526

Query: 528 QAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS 587
           +AY  P +F+  + WGT  R  +V +YRYVQ+   ++GL+F  P+    F LR+  LT+ 
Sbjct: 527 EAYSMPLSFVLKHEWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPLTED 586

Query: 588 IA--LEGNDHLESKN--TFEIEEKEESFLKNK 615
               L+ N++L+  +  T  + E+   F K+ 
Sbjct: 587 YGQKLDDNEYLKQDDPITDWLAERFSRFKKHD 618

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  421 bits (1082), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 230/558 (41%), Positives = 325/558 (58%), Gaps = 8/558 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A+ Y+    +    FS F+  +AYGLD +IR T+  YA +SYS HSL+STV+ 
Sbjct: 53  IRKSELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSV 112

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I  +I+AV Q+ F  LSDIFGR ++ +VSI+ Y +GTII+SQA ++ R+A G  FY +GL
Sbjct: 113 IVLMISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGL 172

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G++L + ++ SD S+L WRL    IP+ P II TW+SG+V  A +   NW W I MWAF
Sbjct: 173 VGVMLQVVLMLSDNSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAF 232

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL CIPL +CMLHMR+  R   +   L+ E             + + FWKLD++G+LL
Sbjct: 233 IFPLCCIPLILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQL-FWKLDVVGVLL 291

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350
            T   GC+LVP TLAGG+   W+ + II P V+G+V+V P ++ WE + +  P  P+ L+
Sbjct: 292 FTAGVGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVLV-PGFIYWESRLALVPFAPFKLL 350

Query: 351 QDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              + M   Y+YT+LVVAV ES  SATRI +LYSFV+ +V   LG
Sbjct: 351 KDRGVWAPLGIMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLG 410

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            I+ +  R K +IIFG S + ++ GL   YR    A  GII  + + G  +  F Y T  
Sbjct: 411 LIVTRSSRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIV 470

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQ S  +H  MA VT+L    + I            WT  L  ++   + D  LA  AY
Sbjct: 471 SIQ-SVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAY 529

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA- 589
           GSP TFI +  WGTP R A+V +YR+VQK   I+ LVF  P+    F +R+ +LT+  A 
Sbjct: 530 GSPLTFILSNPWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFAQ 589

Query: 590 -LEGNDHLESKNTFEIEE 606
            L   +++++K    I +
Sbjct: 590 KLPDREYVQTKEDDPIND 607

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  421 bits (1082), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 228/574 (39%), Positives = 334/574 (58%), Gaps = 20/574 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+    +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ 
Sbjct: 55  IRKSELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR SI IV+I FY +GTII+SQA ++ R+A G  FY +GL
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G +  + ++ SD S+L WRL   F+PA P ++  WISGNV    +   NW WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAF 234

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDI 285
           I P AC+P+  C+LHMR+      K R  PE++ L + K  +++      +   FWKLD+
Sbjct: 235 IFPAACLPIIGCLLHMRW------KLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLDV 288

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLT 345
           +G+LL +V  GC+L+P T+AGG    W++A +I P V+G V+V P ++ WE K +  PL 
Sbjct: 289 VGVLLFSVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVLV-PAFIYWESKLALVPLA 347

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
           P+ +++DRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ + 
Sbjct: 348 PFKMLKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVF 407

Query: 406 GTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFT 465
             ++G  + +  R KPF +FG S + V+  L  H+RG      G+IG++ + G  +  F 
Sbjct: 408 SPVVGIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFN 467

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
           Y    S+Q +  +H  MA VT+L L  + I            WT  L   + K + DPT+
Sbjct: 468 YPINISMQ-TVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTM 526

Query: 526 AAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
           A +AY  P +F+  + WGT  R A+V SYRYVQ+   ++GL+F  P+    F+LR+  LT
Sbjct: 527 ATEAYNMPLSFMLKHEWGTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPLT 586

Query: 586 DSIA--LEGNDHLESKN--TFEIEEKEESFLKNK 615
           +     LE N++++  +  T  I E+   F K+ 
Sbjct: 587 EDYGQRLEDNEYVKHDDPITDWIAERFSRFKKHD 620

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  419 bits (1078), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 224/557 (40%), Positives = 331/557 (59%), Gaps = 18/557 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   E+ A  Y+  + +    FS F+ +++YGLD  IR  +  YA ++Y  HSLLSTVN 
Sbjct: 55  IRKSELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNV 114

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I   I+AV QIFFA LSD+FGR SI IV+I+FY +GTII+SQA ++ R+A G  FY +GL
Sbjct: 115 ISMTISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G +  + ++ SD S+L WRL   F+PA P ++  WISG+V +  +   NW WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAF 234

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDI 285
           I P  C+P+  C+LHMR+      K +  PE++ L + K  +++      +   FWKLD 
Sbjct: 235 IFPATCLPIIGCLLHMRW------KLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDA 288

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLT 345
           +G+LL +V  GC+LVP T+AGG+  +W++A II P V+G V+VL +++ WE K +  PL 
Sbjct: 289 VGVLLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLA 347

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
           P+ +++DRG              + M  DY+YT+L+VA +ES  SATRITSLYSFV+ ++
Sbjct: 348 PFKMLKDRGIWAPLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVL 407

Query: 406 GTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFT 465
               G ++ +  R KPF  FG + + V+  L   +RG      G+IG++ + G  +  F 
Sbjct: 408 SAAAGILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFD 467

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
           Y    S+Q +  +H  MA VT+L LA + I            WT  L   + K + DP +
Sbjct: 468 YPINISMQ-TVTSHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDM 526

Query: 526 AAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
           A +AY  P +F+  + WGTP R A+V SYRYVQK   ++GLVF  P+    F LR+  LT
Sbjct: 527 AIEAYDMPLSFMLEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLT 586

Query: 586 DSIA--LEGNDHLESKN 600
           +     LE N++++  +
Sbjct: 587 EDYGQRLEDNEYVKHDD 603

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  409 bits (1052), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 244/616 (39%), Positives = 348/616 (56%), Gaps = 26/616 (4%)

Query: 23  LEKEVGAKVDVKPTLTTSSPAPSY---IELIDPG--VHNIEIYAEMYNRPIYRVALFFSL 77
           +E++   K +     +T    P Y    E  D    +  IEI   +Y+   +   L F  
Sbjct: 61  IEQKNNEKFNTIEHTSTEGTNPKYDTTYEEFDSKRIIKEIEIMKSVYDTWYFHALLLFGA 120

Query: 78  FLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFS 137
           F+ +Y Y LD  +R  ++ YA SSY +HSL+ST+N I +V +A  Q+ ++R SDIFGR S
Sbjct: 121 FICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVASATSQVVYSRASDIFGRLS 180

Query: 138 IMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLAL 197
           +++V+II Y +GTII+SQA +I R+  G  FY LG  G+ L++ +I SD+S+L WR    
Sbjct: 181 LLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSLLMTLILSDYSSLKWRFFYQ 240

Query: 198 FIPALPFIINTWISGNVTSAID--ANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHA 255
            I A P IIN WISG +    +   +W W IGMWAFI PL+CIP+  C++HM++LA +  
Sbjct: 241 AILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLSCIPILCCLIHMQWLASQTD 300

Query: 256 K-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKT 314
           +  +LK          +K   ID+ FW+ D++G++L+  F G +L+P TLAGG K  W  
Sbjct: 301 EWKQLKKGKSYFKYYGYKDSLIDM-FWRFDVVGVILLAAFIGLILIPLTLAGGTKSRWSE 359

Query: 315 AHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGD 374
             +I P VIG V+V P + +WE  +++HP+ PW LI+DR               + +  D
Sbjct: 360 GKLIAPFVIGCVMV-PCFAIWEKWFAKHPIMPWRLIKDRSIWAALTLSLVYKFVFAVAQD 418

Query: 375 YMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSF 434
           YMY++L+VAV ESIKSAT I  ++SFVS +      +    V R KPFI  G   +++S 
Sbjct: 419 YMYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFSYGTTFVGRLKPFIFLGTLLYMLSL 478

Query: 435 GLLVHYRGDSGAHSGIIGSLCLLG-----FGAGSFTYVTQASIQASAKTHARMAVVTSLY 489
           GLL +YRG   AHSGIIG+LC++G     F     T +TQAS+ +     A MA VT+L 
Sbjct: 479 GLLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLTVITQASVSS-----ADMANVTALI 533

Query: 490 LATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIA 549
           L   NI            WT  L KE+ KR+ + TLA +AY SP +FI  Y+WGTP R  
Sbjct: 534 LTFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTLAKKAYSSPLSFIANYSWGTPVRNI 593

Query: 550 LVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSI--ALEGNDHLESKNTFEIEEK 607
           +V SYR VQ+   I+ + FC PL+   F LR+  L  S    LE   H++  ++  I + 
Sbjct: 594 MVESYRSVQRYEIIVAISFCAPLVLLTFALRDINLNRSTDADLEDGKHVKMTDSDPIFD- 652

Query: 608 EESFLKNKFFTHFTSS 623
              F  N F   F SS
Sbjct: 653 ---FFANIFNKIFHSS 665

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  395 bits (1015), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 211/445 (47%), Positives = 285/445 (64%), Gaps = 24/445 (5%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIA 81
           +  KE+ ++ D      T S  P +       +   EI + +Y++  + V L FS F+  
Sbjct: 22  IFTKEIESQND-----DTQSSVPDFAVKRSLVIKKTEIMSAVYDKWYHHVILLFSAFVCG 76

Query: 82  YAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIV 141
           YAYGL+ NIRY +  YATSSY++HSLLSTVN I  V++A  QI ++RLSD FGR ++ I+
Sbjct: 77  YAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLSDFFGRLTLFII 136

Query: 142 SIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPA 201
           +I+ Y +GTII+SQA ++ R+A G  FY  G  GIILIL +I SDFS+L WRL   F P 
Sbjct: 137 AIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDFSSLKWRLFYQFAPT 196

Query: 202 LPFIINTWISGNVTSAID--ANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRL 259
            PFIINTWISGNVTS+ +   +W W +GMWAFI PLACIP+  CM+HM++ A K      
Sbjct: 197 WPFIINTWISGNVTSSANPLVHWSWDVGMWAFIFPLACIPMIGCMIHMQWKASK------ 250

Query: 260 KPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEE 311
            PE+ AL     KSF         +   FWKLDIIG LL T   GC+LVP TLAGG   +
Sbjct: 251 TPEWHALRSE--KSFYQANGFYKTMTELFWKLDIIGTLLFTACLGCILVPLTLAGGTNSK 308

Query: 312 WKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYM 371
           W  + +I P V+G+V++ P+  +WE K++R PL P+ L++DRG              +YM
Sbjct: 309 WNNSRVIGPFVLGFVLI-PILGVWEYKWARDPLIPYKLVRDRGVWAALGISFLIDFIFYM 367

Query: 372 QGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWI 431
             DY+YTV+VVAVHES+KSATRI++L SFVS +       ++ +  R KPFIIFG S W+
Sbjct: 368 AADYLYTVMVVAVHESVKSATRISTLSSFVSTVASPFFALLMTRCTRLKPFIIFGCSLWM 427

Query: 432 VSFGLLVHYRGDSGAHSGIIGSLCL 456
           +S GLL ++RG   +HSGIIG+LC+
Sbjct: 428 LSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  398 bits (1022), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/551 (38%), Positives = 321/551 (58%), Gaps = 18/551 (3%)

Query: 44  PSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYS 103
           P+ +E    G    EI A  ++ P YR  +  + FL  + Y LD  +R T+  YAT+SY+
Sbjct: 30  PANVEFSKLG--ESEIIAVQFDTPKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYA 87

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFA 163
           +HSLLST+  I  V++   Q+ F+RLSD FGR  + + + I Y +GTI++SQA +++ +A
Sbjct: 88  EHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYA 147

Query: 164 VGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAI--DAN 221
            G  FY  G  G+ L+L +I SDFS+L WR+L  ++P  PFII  WISGN+ +A   + +
Sbjct: 148 AGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPFIIIPWISGNIVTAANPEKD 207

Query: 222 WKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCID 277
           W W I MWAFI PL+ +P+   +++M Y + K       PE++AL +     K + F  +
Sbjct: 208 WSWDIAMWAFIFPLSALPMICLLVYMMYKSSK------TPEWKALKERTHIKKNQGFLKN 261

Query: 278 IA--FWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLW 335
               FW+LD IG++LITV  GCVLVP TLA G+ ++W ++ II   V G V+   +++ W
Sbjct: 262 TVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFC-IFVFW 320

Query: 336 EIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRIT 395
           E  Y+++PL P+ L+ DRG              +++  D++Y VL+V+++ES  +ATRI 
Sbjct: 321 ETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFFIACDFLYPVLLVSMNESSTTATRIL 380

Query: 396 SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
           +L  FV   +    G ++ K RR K  ++ G + W++S GL   YRG S +H G I +  
Sbjct: 381 NLPDFVGATLSPFYGILVAKARRLKFSVVGGCAAWMISMGLFYQYRGGSESHGGAIAASV 440

Query: 456 LLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKE 515
           ++G      +     S+QA   TH RMAV+TS+Y     +            WT I+P +
Sbjct: 441 IMGMSGLLCSNSVIVSLQA-MTTHGRMAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQ 499

Query: 516 ISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGC 575
           + K  S+ TLA  AY SP+TFI  Y WG+PERIA+V +YRYVQ+I+  IGLV   P    
Sbjct: 500 LRKAFSNDTLADAAYESPYTFIYEYPWGSPERIAVVEAYRYVQRIMMTIGLVCTIPFFAF 559

Query: 576 AFMLRNHKLTD 586
              +R+ +L D
Sbjct: 560 TLFMRDPELID 570

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 209/571 (36%), Positives = 314/571 (54%), Gaps = 8/571 (1%)

Query: 58  EIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  ++   Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +V+ IFY MGTII+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISGN+ +A +   NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLITV  
Sbjct: 227 STLPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGX 355
           GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  +I G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFT 535
             TH+RMAV+T +      +            WT  +P ++ K + + TLA  AY SP+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDH 595
           FI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +RN +L D      ++ 
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRNPELIDKAT---HEE 581

Query: 596 LESKNTFEIEEKEESFLKNK-FFTHFTSSKD 625
                   + ++E  F + K  F H  S+K 
Sbjct: 582 FTEDGLVVLPDEENIFSQIKALFRHNRSNKK 612

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  377 bits (969), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 208/571 (36%), Positives = 314/571 (54%), Gaps = 8/571 (1%)

Query: 58  EIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  ++   Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +V+ IFY MGTII+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISGN+ +A +   NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLITV  
Sbjct: 227 SALPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGX 355
           GC+LVP TLA    ++W  + II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  +I G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFT 535
             TH+RMAV+T +      +            WT  +P ++ K + + TLA  AY SP+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDH 595
           FI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +R+ +L D      ++ 
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRDPELIDKAT---HEE 581

Query: 596 LESKNTFEIEEKEESFLKNK-FFTHFTSSKD 625
                   + ++E  F + K  F H  S+K 
Sbjct: 582 FTEDGLVVLPDEENIFSQIKALFRHNRSNKK 612

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  377 bits (967), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 198/558 (35%), Positives = 308/558 (55%), Gaps = 15/558 (2%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +  +EI  + Y          F+ FL      L+  +R  +  YAT+SY  HSLLST+  
Sbjct: 65  IRKMEIMRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGV 124

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           + ++I+A     +ARLSD+FGR  + + +++F+ +GTII+SQA N+ ++A G  FY LG 
Sbjct: 125 VSSIISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGT 184

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            GI +++ +I SDFS+L WRL   F P  P +   WI+G++   +D    W WGIGMWAF
Sbjct: 185 AGIQVMMFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAF 244

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I PL+ +P    +L +RY A K  + ++    +   +       +   FWK+D++G+LL 
Sbjct: 245 IYPLSSVPFVAYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLF 304

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
             F GC+LVP TLAGG+  +W    I+ P ++G+ +V P ++LWE KY+R P+ P+ +++
Sbjct: 305 VAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCLV-PAFILWETKYARLPIAPFKMLK 363

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              +Y+   Y+ T+L+VAV++S   A  I +++S V         +
Sbjct: 364 DRGIWSALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSY 423

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
            +++VRR KPFII G   W+VS GLL +YR    +  GIIG++ L G G+   T  T  S
Sbjct: 424 FVVRVRRLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVIS 483

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYG 531
            Q S   H  MA +T++ LA   I            WT  L  ++ + I DP +A + Y 
Sbjct: 484 SQ-SITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQ 542

Query: 532 SPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDS---- 587
           SP + I  Y WGTP R A+V +YR+VQ+   ++ ++   PL   +  LR+ +LTD     
Sbjct: 543 SPLSAIRVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVAHT 602

Query: 588 -------IALEGNDHLES 598
                  IA++GND + +
Sbjct: 603 DIKDGEFIAVDGNDAIAN 620

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  373 bits (957), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 208/571 (36%), Positives = 317/571 (55%), Gaps = 13/571 (2%)

Query: 28  GAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLD 87
           G     KP+LT         + +   V  +EI  ++ +  + RV L  S FL  +AY LD
Sbjct: 23  GGSSSEKPSLTKGDKGRQQYDYMK--VKEMEIIKDVCSGNLARVFLLASAFLCGFAYYLD 80

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
              R  +  YA +SY +HSLLST+  I +V+    QI FARLSD+FGR  + +V  I Y 
Sbjct: 81  MVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYV 140

Query: 148 MGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIIN 207
           +GTII+SQA ++  +AVG  FY  G  G+ L+L ++ SD S L WRL   F  + P II 
Sbjct: 141 VGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLFYQFTASFPCIII 200

Query: 208 TWISGNVTSAID--ANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAK---DRLKPE 262
           +WISG++  A +   NW W IGMWAFI PL+ +P    + +  +++ K  K    R K E
Sbjct: 201 SWISGDIVEAANPMKNWSWDIGMWAFIFPLSSLPFITYLFYATHISSKTKKWKDLRNKVE 260

Query: 263 FEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEV 322
               N +      +   F ++DI+G +L+T   G +LVP TLAGG+ E W    II   V
Sbjct: 261 THKRNII----LVVKDIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLV 316

Query: 323 IGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVV 382
           IG + +L +++ WE K++++   P++L++DRG              + M  DY+Y VL+V
Sbjct: 317 IG-IALLLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLV 375

Query: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRG 442
           +V+E+ KSATRI  L +F++ +     G +++ V+R K F I G   WI+S GL   +RG
Sbjct: 376 SVNETNKSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLWIISIGLFYQFRG 435

Query: 443 DSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXX 502
              +HSGIIG+  +LGFG+  FT     ++QA A +H  MA +T LY     +       
Sbjct: 436 GESSHSGIIGASIVLGFGSAIFTQSIIVTLQAMA-SHDNMASITGLYFMFAQVGAATGAS 494

Query: 503 XXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILC 562
                WT  + K++ K++ D  L    + SP+ FI +Y WGT ER  ++ +YR+VQK+  
Sbjct: 495 ISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYEFIASYAWGTKERDLVIQAYRHVQKVTM 554

Query: 563 IIGLVFCFPLLGCAFMLRNHKLTDSIALEGN 593
           ++ L+   PLL      ++ KL+DS++ + +
Sbjct: 555 LVSLILTVPLLVSVLFTKDRKLSDSVSSDAS 585

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  365 bits (936), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 204/552 (36%), Positives = 309/552 (55%), Gaps = 17/552 (3%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           V  +EI +   +    R AL  S FL  + Y LD   R  +  YATSSY++H+LLST+  
Sbjct: 61  VKEMEIMSSTCSGKSARAALLASAFLCGFGYYLDYITRSVYTGYATSSYNEHALLSTIQV 120

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I +VI+   QI FA+LSDIFGR  + +V  + Y +GTII+ +A +I  +AVG  FY  G 
Sbjct: 121 INSVISIAAQIIFAQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGY 180

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
            G+ ++L ++ SD S   WRLL  F  + P II  WISG++  + +   NW++ IGMWAF
Sbjct: 181 VGVSILLIIVLSDLSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAF 240

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFW------KLDI 285
           + P++ +P  I +L   Y  R+ +K     E +  NK       + I +W       +D+
Sbjct: 241 LFPISALPFIIFLL---YFTRQASKTAEWKEIQGDNKEP----SVRIVYWIKSIYSNIDV 293

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLT 345
           +G  L+TV  GC+LVP TLAGG+ ++W    II   V+G+V  +  ++ W+IK++++ + 
Sbjct: 294 VGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFM-FFLAWDIKFAKNAVL 352

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
           P+ L++DRG              +    DY+Y VL+V+V+ES KSATRI  L +FV+   
Sbjct: 353 PFKLLKDRGVWASLAAALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACTG 412

Query: 406 GTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFT 465
               G ++++ +R K + I G+  WI+S GL  HYRG + +HSGIIG+  +LG G+  FT
Sbjct: 413 SIFFGLLVVRTKRLKIYSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFT 472

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
                ++Q +  +H  MA +T LY     I            WT  + K++ KR+ D +L
Sbjct: 473 QSLIVNLQ-TMTSHKNMASITGLYFMFAQIGSASGASISGAIWTQTMYKQLYKRLEDSSL 531

Query: 526 AAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLT 585
           AA A+ SP+ FI  Y WGTPER  ++ +YR VQK   ++ LV   PL       ++ KL 
Sbjct: 532 AATAFSSPYEFIELYPWGTPERTQMIYAYREVQKKTMLVSLVLTGPLFLLILFTKDRKLG 591

Query: 586 DSIALEGNDHLE 597
           D++  E     E
Sbjct: 592 DNVTAETTQSDE 603

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  349 bits (896), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/579 (35%), Positives = 322/579 (55%), Gaps = 11/579 (1%)

Query: 54  VHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +  +EI +       ++  L  +  +  ++Y LD  +R T+  YAT+S+SQHSLL+T+N 
Sbjct: 64  MKELEIVSSFCKEWHFQSILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATINV 123

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
           I +V++   Q+FFARLSD FGR  +     + Y +GTI++SQ+ N++ +A G  FY  G 
Sbjct: 124 INSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAGY 183

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGIGMWAF 231
           TG+ L++ ++ SDFS L WR   +  P   +II TW+SGN+    +   NW W I MWAF
Sbjct: 184 TGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWAF 243

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I PL  IPL   +++M Y A +   D  K E  ++ K       I   FW LDI G+LLI
Sbjct: 244 IFPLTTIPLVGFLVYMFYKASR--TDEWK-ELRSVTKKMPTPVYIKEVFWNLDIPGVLLI 300

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
            +  GC+L+P T++GG  EEWK +  I    +G  V+ P+++LWE K ++ P+     ++
Sbjct: 301 AISLGCILIPLTVSGGETEEWKDSRNIGVLCLG-SVLFPIFLLWEGKIAKRPVLALTYLK 359

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              + +  DY+Y VL+V  ++S  ++ RIT L SF  V++    G 
Sbjct: 360 DRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFTGL 419

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
           ++ + +  K   I G   + ++FGL   YRG S   +GII     +GFG+G  TY    S
Sbjct: 420 LITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMVS 479

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRI-SDPTLAAQAY 530
           +QA   +H ++A+VT+L+     +            WT ++ KEISKR+  +P +A  AY
Sbjct: 480 LQA-VSSHTKIAIVTALFYTFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALAAY 538

Query: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKL-TDSIA 589
            SP+TF+T Y W T +R+A+V +Y +VQKIL ++ L+   PL   A M+R+ +L T  +A
Sbjct: 539 ASPYTFVTKYGWETSQRMAVVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSDVA 598

Query: 590 LEGNDHLESKNTFEIEEKEESFLKNKFFTHFTSSKDRKD 628
           L  +D      +   ++  E+F   KFF+  T  +  ++
Sbjct: 599 LSSSDDSHVIISKHEDKIYEAFC--KFFSFSTKKEGSRE 635

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  304 bits (778), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 247/439 (56%), Gaps = 5/439 (1%)

Query: 123 QIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
           Q+  ARLSD FGR  I + S + Y   +I+ES A NI+ +  G   Y +G   + ++L V
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDA--NWKWGIGMWAFILPLACIPL 240
           + SDFS+L WR+L  F P    ++  WISG+V ++I    +W WGIG WAF  PLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
             CM++M Y  RK  + +L  + + LN+ K  +  + I F ++D IG L+ +V  GCVLV
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRI-FHQVDFIGTLIFSVALGCVLV 180

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           P TLAGG   +W  +  IVP V+G  V+   Y++WE   + +P  P+ L++DRG      
Sbjct: 181 PLTLAGGYSSKWSHSDSIVPLVVG-SVLFVFYIVWESFMASYPALPFKLLKDRGIWIPIL 239

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   +Y   DYMY VL+VA++ES KSAT I SL  FV+ +       +L    R K
Sbjct: 240 AGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLK 299

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            + I G + W+VS GL   YR   G+H G++ ++ LLG G     +    ++QA A  H 
Sbjct: 300 WYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARAP-HT 358

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
           +MA VT L+    ++            WT  +PK++ K +    LA  AY SP+TFI +Y
Sbjct: 359 KMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIISY 418

Query: 541 TWGTPERIALVMSYRYVQK 559
            WGT ER+A+V++Y+ VQK
Sbjct: 419 PWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  290 bits (742), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 164/441 (37%), Positives = 253/441 (57%), Gaps = 15/441 (3%)

Query: 153 ESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISG 212
            S   +++ +A G  FY  G  G+ LIL +I SDFS L WR+   +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 213 NVTSAI--DANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK 270
           N+ +A   + NW W I MWAFI PL+ +PL  C++   YL  K  K    PE++AL +  
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPL-YCLI--IYLKMKSVKT---PEWKALKERA 121

Query: 271 W---KSFCIDI--AFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGW 325
               + F  +I   FW+LD+IG++LITV  GC+LVP TLA G  E+W+++ II   V G 
Sbjct: 122 HSVKRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGG 181

Query: 326 VVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVH 385
           V+ L ++M WE  Y+ +PL P+ L++DRG              +Y+  D++Y VL+V+++
Sbjct: 182 VLFL-IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMN 240

Query: 386 ESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSG 445
           ES  SA RI +L  FV+         ++ K +R K  +I G + W++S GL   +RG  G
Sbjct: 241 ESSTSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYG 300

Query: 446 AHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXX 505
           +H G+I +  ++GF +G     +   +  +  TH+RMAV+T ++     I          
Sbjct: 301 SHGGVISASVIMGF-SGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGASVSG 359

Query: 506 XXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIG 565
             WT  +P  + K + + TLAA+AY SP++FI +Y WGT ER A+V +Y+YVQ+I+ I+G
Sbjct: 360 GVWTQTMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVG 419

Query: 566 LVFCFPLLGCAFMLRNHKLTD 586
           L+   PL   +  +R+ +L D
Sbjct: 420 LICTIPLFAFSLFMRDPELID 440

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  264 bits (675), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/554 (29%), Positives = 285/554 (51%), Gaps = 23/554 (4%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           + AL  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 63  KTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARI 122

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    I +++ Y++G II +     +    G    Q G +G  L+   +  D S 
Sbjct: 123 SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG 182

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIDAN-----WKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SGN+ S++  N     W+WG G++  I+P++ + L +  
Sbjct: 183 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPY 242

Query: 245 LHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVP 301
           ++ +Y++ +  K    +LK + + L +  WK F  DI     ++IG++L T F   VL+P
Sbjct: 243 VYAQYISWRSGKLPPLKLKEKGQTLRQTLWK-FADDI-----NLIGVILFTAFLVLVLLP 296

Query: 302 FTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXX 361
            T+AGG   +W+  HII   V+G  +   ++++WE+K++++P  P   + D         
Sbjct: 297 LTIAGGATSKWREGHIIAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVALLM 355

Query: 362 XXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      K 
Sbjct: 356 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHPKV 415

Query: 422 FIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH  
Sbjct: 416 FVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THNE 474

Query: 482 MAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYT 541
           MA VT L ++ Y I            WT  L KE+ +R+   +L    Y SP  ++  Y 
Sbjct: 475 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKKYP 533

Query: 542 WGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600
            G+  R+ ++ SY  +Q++L I+ + F  F  + C F LR   +    +L   +  + K 
Sbjct: 534 IGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNKKQSLSAEEREKEK- 591

Query: 601 TFEIEEKEESFLKN 614
              ++ K++S+L+ 
Sbjct: 592 ---LKIKQQSWLRR 602

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  230 bits (587), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 273/554 (49%), Gaps = 33/554 (5%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++ L  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 62  KITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARM 121

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y++G II +          G    Q G +G  L+   +  D S 
Sbjct: 122 SDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSG 181

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIDA-----NWKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SGN+ S++       NW+WG G++  I+P + + L +  
Sbjct: 182 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPY 241

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK----LDIIGMLLITVFFGCVLV 300
            + +Y+  ++    L P      KL+ K   +    WK    +++IG++L + F   +L+
Sbjct: 242 AYAQYIGWRNGT--LPPY-----KLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLLL 294

Query: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXX 360
           P T+AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D        
Sbjct: 295 PLTIAGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALL 353

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                     ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K
Sbjct: 354 MEFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHPK 413

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH 
Sbjct: 414 LFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THN 472

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540
            MA VT L ++ Y I            WT  L KE+ +R+    L    Y SP  ++  Y
Sbjct: 473 EMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGS-NLGMSIYKSPLNYLKKY 531

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCAFMLRNHKLTDSIALEGNDHLESK 599
             G+  R  +V SY  +Q++L I+ + F  F  + C F LR   +              K
Sbjct: 532 PIGSEVRDQMVESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNK------------K 578

Query: 600 NTFEIEEKEESFLK 613
            +F  EE+E+  L+
Sbjct: 579 QSFSTEEREKEKLR 592

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  224 bits (570), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 169/556 (30%), Positives = 274/556 (49%), Gaps = 33/556 (5%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++AL  +LFL  Y  GL G I  + Q YA +++ +   + ++N +K+V+AA   + +ARL
Sbjct: 61  KIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYARL 120

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    I +++ Y++G II +          G    Q G +G  L+   + +D S 
Sbjct: 121 SDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADISG 180

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIDA-----NWKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SGN+  ++        W+WG G++  I+P + + L +  
Sbjct: 181 LRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILPY 240

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLK-WKSFCIDIAFWKL----DIIGMLLITVFFGCVL 299
            + +YLA +  +    P+FE   + + WK      A WKL    ++IG++L T F   VL
Sbjct: 241 AYAQYLAWREGR---LPQFEFRKQGQSWKQ-----ALWKLTEDVNLIGIVLFTAFLVLVL 292

Query: 300 VPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXX 359
           +P TLAGG   +WK  HII   V+G    + L+ +WE+  ++ P  P   + D       
Sbjct: 293 LPLTLAGGASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYVAL 351

Query: 360 XXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRT 419
                      ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      
Sbjct: 352 LMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPHP 411

Query: 420 KPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTH 479
           KPFI+ G    ++  GLL  YR      SG+IG+  ++G  AGS       ++  ++ +H
Sbjct: 412 KPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGI-AGSMVRFPMWTLVHASTSH 470

Query: 480 ARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITT 539
             MAV T L ++ Y I            WT  L KE+ KR+      A  Y SP +++T 
Sbjct: 471 EEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYLTK 529

Query: 540 YTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESK 599
           Y  G+  R  ++ SY  +Q++L I+ + F        F L  + +++            K
Sbjct: 530 YPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPGYTVSE------------K 577

Query: 600 NTFEIEEKEESFLKNK 615
            +F  EE+E+  L+ K
Sbjct: 578 QSFTQEEREKKKLEMK 593

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  218 bits (555), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 145/486 (29%), Positives = 245/486 (50%), Gaps = 17/486 (3%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           +  L  +LFL  Y  GL G I  + Q YA + + +HS + ++N +K+++++V  + +AR+
Sbjct: 58  KTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARM 117

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    I +++ Y++G II +   N      G    Q G +G  L+   +  D S 
Sbjct: 118 SDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSG 177

Query: 190 LNWRLLALFIPALPFIINTWISGNVTSAIDAN-----WKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SGN+ S++  +     W+WG G++  I+P + + L +  
Sbjct: 178 LRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPY 237

Query: 245 LHMRYLARKHAKD---RLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVP 301
            + +Y++ ++      +LK + + L +  WK F  DI     ++IG++L T F   VL+P
Sbjct: 238 AYAQYISWRNGTLPPFKLKEKGQNLRQTIWK-FAEDI-----NLIGIILFTAFLVLVLLP 291

Query: 302 FTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXX 361
            T+AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D         
Sbjct: 292 LTIAGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLM 350

Query: 362 XXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K 
Sbjct: 351 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKV 410

Query: 422 FIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH  
Sbjct: 411 FVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKE 469

Query: 482 MAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYGSPFTFITTYT 541
           MA VT L ++ Y I            WT  L KE+ +R+    L    Y SP  ++  Y 
Sbjct: 470 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGY-DLGMSIYKSPLNYLKKYP 528

Query: 542 WGTPER 547
            G+  R
Sbjct: 529 IGSEVR 534

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  189 bits (481), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 155/570 (27%), Positives = 260/570 (45%), Gaps = 28/570 (4%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E  +  +  + L  S+ L A+   LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 62  GVTRIEVVKEKMSTKVTWI-LAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLT 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     V +I Y +G II + +  I  + VG  F  +G
Sbjct: 121 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVG 180

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIDANWKWGIGMWAF 231
            +GI L+  VI +D ++L WR     + ++P+++ TWISG  V + I +NW+WG GM+A 
Sbjct: 181 QSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAI 240

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRL--KPEFEALNKLKWKSFCIDIAFWKL------ 283
           I P+A  P  + M ++ + A K  +  +   P  E   +++         +W+L      
Sbjct: 241 ITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLI 300

Query: 284 --DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341
             D  G++L+   F  +L+P +L    +  WK   +I  EVIG + ++  Y+++E+ ++ 
Sbjct: 301 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLIS-YVIFEVFFAP 359

Query: 342 HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S K+   +++  +  
Sbjct: 360 FPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMG 419

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     I+ +L +  F
Sbjct: 420 LCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAALIVTNF 479

Query: 460 GAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WTN LP  + K 
Sbjct: 480 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELPGALLKY 538

Query: 520 ISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFML 579
           + D   A   + S  T I    WG+  R   + +Y+ V   L  +GL     +   A   
Sbjct: 539 VPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMFIVALFQ 597

Query: 580 RNHKLTDSIALEGNDHLESKNTFEIEEKEE 609
            N  L D            +N  E E+KE+
Sbjct: 598 TNFYLGD-----------QQNCVEGEQKED 616

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  188 bits (478), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 147/570 (25%), Positives = 263/570 (46%), Gaps = 28/570 (4%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E  +  + R  L  S+FL +    LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 61  GVTRIEVVREKMSTRV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLT 119

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     V ++ Y +G +I + +  I  + VG  F  +G
Sbjct: 120 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIG 179

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIDANWKWGIGMWAF 231
            +GI L+  VI +D + L WR     + ++P+++ TWISG  V   I++NW+WG GM+A 
Sbjct: 180 QSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAI 239

Query: 232 ILPLACIPLGICMLHMRYLARKH----------AKDRLKPEFEALNKLKWKSFCIDIAFW 281
           I P+A  P  + M ++ + A K           +K R++     ++  +     + ++  
Sbjct: 240 ITPVALTPAILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLI 299

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341
           ++D  G++L+   F  +L+P +L    +  W    +I  EV+G + ++  Y+++E+ ++ 
Sbjct: 300 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLIS-YVVFEVFFAP 358

Query: 342 HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S ++   +++  +  
Sbjct: 359 FPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMG 418

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     ++ +L +  F
Sbjct: 419 LCFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTNF 478

Query: 460 GAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WT+ LP  +SK 
Sbjct: 479 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKY 537

Query: 520 ISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFML 579
           + D   AA A+    T +    WG+  R   + +Y+ V   L  +GL     +   A   
Sbjct: 538 VPDREKAA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVALFQ 596

Query: 580 RNHKLTDSIALEGNDHLESKNTFEIEEKEE 609
            N+ L D            +N  E E++E+
Sbjct: 597 TNYYLGD-----------QQNCVEGEQRED 615

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  187 bits (475), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 145/559 (25%), Positives = 262/559 (46%), Gaps = 19/559 (3%)

Query: 53  GVHNIEIYAE-MYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTV 111
           GV  IE+  E M  + I+ + L  S+FL ++   LD    Y +Q YATSS+++HS+LST+
Sbjct: 61  GVTRIEVVREKMSTKVIWILGL--SIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTL 118

Query: 112 NCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQL 171
               +VI AV + F A++SD+  R     V ++ Y +G +I + + NI+ + +G  F  +
Sbjct: 119 TIANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAV 178

Query: 172 GLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN-VTSAIDANWKWGIGMWA 230
           G +GI L+  VI +D + L WR     + ++P+++ TWISG  V   I++NW+WG GM+A
Sbjct: 179 GQSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFA 238

Query: 231 FILPLACIPLGICMLHMRYLARKHAK-----DRLKPEFEALNKLKWKSF-----CIDIAF 280
            I P+A  P  + M ++ + A K  +     D L  +   + + + + F      + ++ 
Sbjct: 239 IITPVALTPAILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSL 298

Query: 281 WKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYS 340
            ++D  G++L+   F  +L+P +L    +  W    +I  EV+G ++++  Y+++E+ ++
Sbjct: 299 IEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLIS-YVVFEVFFA 357

Query: 341 RHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSF 400
             PL P  ++ +R                Y    +  +   V ++ S +    +++  + 
Sbjct: 358 PFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTM 417

Query: 401 VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLG 458
                G + G +     R K F + GI+  ++  GL V      G+     ++ +L +  
Sbjct: 418 GLCFFGVVWGALFRGFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAALVVTN 477

Query: 459 FGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISK 518
           FG  +    TQ + QA A  H  MA   S+     +I            WT+ LP  + K
Sbjct: 478 FGDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGALFK 536

Query: 519 RISDPTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFM 578
            + D   A  A+    T I    WG+  R   + +Y+ V   L  +GL     +   A  
Sbjct: 537 YVPDKEKAV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSSIMFVVALF 595

Query: 579 LRNHKLTDSIALEGNDHLE 597
             N+ L D       + +E
Sbjct: 596 QTNYYLGDQQNCVEGEQIE 614

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  139 bits (349), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 227/500 (45%), Gaps = 37/500 (7%)

Query: 78  FLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-- 135
           F++A++ G+ G    T   Y TSS+ QHSL +   C         QI   +  DI+GR  
Sbjct: 76  FVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALCQSIDIWGRAQ 131

Query: 136 -FSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRL 194
            F+ M++SI   ++GTI+ +   N+  +     FY +G  GI   + +  +D + L  R 
Sbjct: 132 GFAFMVLSI---TIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADTTKLKNRA 188

Query: 195 LALFIPALPFIINTWISGNVTSAI--DANWKWGIGMWAFILPLACIPL-GICMLHMRYLA 251
             L   +  +I   W  G    +I     ++WG G+WA I+P+ C PL G+    + Y  
Sbjct: 189 FILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPLFGL----LYYYQ 244

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFW--KLDIIGMLLITVFFGCVLVPFTLAGGLK 309
           +K  K  L P+ E   +  W+S    + F+  + D+IG+ ++ +     L+ F L    K
Sbjct: 245 QKAVKVGLIPKREKSGRTFWQS----VVFYGKEFDVIGIFILALGLALFLLGFNLYSYQK 300

Query: 310 EEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXW 369
            EW++  II   +IG ++++  + +WE  ++     PW+L+ +R               +
Sbjct: 301 NEWRSPLIICFLIIGGLLIIS-FGIWEY-FAPVSFIPWELLTNRTVIFTYSMAAAMYCSF 358

Query: 370 YMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIF-GIS 428
           Y+   Y +       + S   AT IT++YS  S     ++G I+    R K   +F G+ 
Sbjct: 359 YIWDSYFFR-HHCRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIALFWGVP 417

Query: 429 CWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA-SAKTHARMAVVTS 487
             ++  GL++ YR        I+     + FG G+     Q ++ A SA+ H  +  V +
Sbjct: 418 ITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVSAQQH--IPAVLA 475

Query: 488 LYLATYNIXXXXXXXXXXXXWTNILPKEISK----RISDPTLAAQAYGSPFTFITTYTWG 543
           +      I            WT I PK++++     + D  L+   YGS  T   +Y  G
Sbjct: 476 MEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLS--IYGS-LTVQISYPRG 532

Query: 544 TPERIALVMSYRYVQKILCI 563
           T  R A+  SY   Q+++CI
Sbjct: 533 TAAREAIDRSYGDTQRLMCI 552

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  111 bits (277), Expect = 9e-28,   Method: Composition-based stats.
 Identities = 61/130 (46%), Positives = 78/130 (60%), Gaps = 2/130 (1%)

Query: 464 FTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-D 522
           FTY    S QA A +H  MA VT+L    Y I            WT  L  EI KR+  +
Sbjct: 2   FTYPVTVSCQA-ATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGN 60

Query: 523 PTLAAQAYGSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNH 582
            ++A  AY SP+TFITTYTWGT ER A+V +Y+YVQK+  ++ LVFC PLL  +  LR+ 
Sbjct: 61  VSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDA 120

Query: 583 KLTDSIALEG 592
           KLTD +A +G
Sbjct: 121 KLTDKVAHDG 130

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score =  107 bits (268), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/121 (39%), Positives = 76/121 (62%)

Query: 58  EIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ +  +N   YR+ +  + FL  + + LD  +R T+  YAT+SY++HSLLST+  I  V
Sbjct: 45  ELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAV 104

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ F+RLSD FGR  +  V+ I Y +GTI++SQA +++ +A G  FY  G  G+ 
Sbjct: 105 VSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGYVGVS 164

Query: 178 L 178
           L
Sbjct: 165 L 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/347 (22%), Positives = 148/347 (42%), Gaps = 30/347 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++S++ + +G++I + +  +     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDA--NWKWG------IGMWAF 231
             V+ +     N+R + +   A+ ++I   +   +  A +   +W+W       IG +AF
Sbjct: 117 AFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I    C   G   L  ++L  K         +E      WK     I  +KLD+IG++L 
Sbjct: 177 ISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKK-VFQILVFKLDMIGIILS 235

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVV----------VLPLYML-WEIKYS 340
           +  F  +++  +  GG    W ++ II    +G ++          +LPL  + ++ KY+
Sbjct: 236 SAGFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYA 294

Query: 341 RHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLY-- 398
           R PL  W +  + G              + +Q  Y    LV      +K  + + S++  
Sbjct: 295 R-PLLTWKIASNAGIFTSSITGFFSCFAYELQSAY----LVQLYQLVLKRNSMLASIHLW 349

Query: 399 --SFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGD 443
             S  ++I      ++  K    KP I+FG+ C IV  G+     G+
Sbjct: 350 ELSIPAMITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGIFTLINGE 396

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 83/377 (22%), Positives = 151/377 (40%), Gaps = 24/377 (6%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++S+I + +G++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDA--NWKWG------IGMWAF 231
             V+ +     N R   +   A  ++I   +   +  A +   +W+W       IG +A 
Sbjct: 117 AFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAL 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G  +  +  L++  +    K + E      WK     +  +KLD+IG+ L 
Sbjct: 177 IILAFCNTSGESLPKVSLLSKIKSIMSYKYD-EVFKASFWKK-AFKVFVFKLDMIGVTLS 234

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVV----------LPLYMLWEIKYSR 341
           +  F  +++  +  GG    W ++ II    +G +++          LPL  L       
Sbjct: 235 SAGFTLLMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRT 293

Query: 342 HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401
            PL  W +  + G              + +Q  Y+  +  + +      A+      S  
Sbjct: 294 KPLLTWSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIP 353

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGA 461
           ++I    + ++  K    KP I+FG+ C IV  GL     G S   S  IG   L G   
Sbjct: 354 AIIATMAIAYLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKS---SQSIGYSILPGLAF 410

Query: 462 GSFTYVTQASIQASAKT 478
           GS    T  S Q   K+
Sbjct: 411 GSIFQATLLSSQVQIKS 427

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 82/377 (21%), Positives = 160/377 (42%), Gaps = 34/377 (9%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIIL 178
           +A+  + + R++ + G  + +++S++ + +G++I + + ++     G      G +GI  
Sbjct: 91  SALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQS 150

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACI 238
           ++ ++ +   +   R + + +    F+ +      +  A++ +  W    W F + L   
Sbjct: 151 LVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASW---RWCFFINL--- 204

Query: 239 PLGICMLHMRYL----ARKHAKDRLKPEFEALNKLKWKSFC--------IDIAFWKLDII 286
           P+G     M +L    + K     L  + EA    ++ + C        +D+  ++ DII
Sbjct: 205 PIGGAAAFMLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDII 264

Query: 287 GMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIG--WVVVLPLY-------MLWEI 337
           G  L +  F  +L+  T  G  K  W +   I    +G   +VV  LY       +   +
Sbjct: 265 GFALSSAGFVLLLLGLTFGG-RKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSL 323

Query: 338 KYSRH--PLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRIT 395
            YS    PL PW +I   G              + MQ  Y+     V  +ES  +A+   
Sbjct: 324 AYSSEVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHM 383

Query: 396 SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
              S  +++V  +LG I  K    KP  + G +C  +  GLL   +G + +   I    C
Sbjct: 384 WALSIPALVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYC 441

Query: 456 LLGFGAGSFTYVTQASI 472
           +L  GAG F+ V Q+++
Sbjct: 442 ILA-GAG-FSAVMQSTL 456

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 80/377 (21%), Positives = 151/377 (40%), Gaps = 34/377 (9%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++S+I + +G++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDA--NWKWG------IGMWAF 231
             V+ +     N R + +   A+ ++I   +   +  A +   +W+W       IG +AF
Sbjct: 117 AFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G    H +       K  +  ++  L K  +     ++  +KLD++G++L 
Sbjct: 177 IILAFCNTSG--EPHQKMWLPSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILS 234

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRH--------- 342
           +  F  +++  +  GG    W +  II    +G     P+ +L    Y  H         
Sbjct: 235 SAGFTLLMLGLSF-GGNNFPWNSGIIICFFTVG-----PILLLLFCAYDFHFLSLSGLHY 288

Query: 343 ------PLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITS 396
                 PL  W++  + G              + +Q  Y+  +  +   +    A+    
Sbjct: 289 DNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLW 348

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
             S  ++I    + ++  K    KP I+FG+ C IV  GL     G+    S  IG   L
Sbjct: 349 ELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGE---LSQSIGYSIL 405

Query: 457 LGFGAGSFTYVTQASIQ 473
            G   GS    T  S Q
Sbjct: 406 PGIAFGSIFQATLLSSQ 422

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 90/384 (23%), Positives = 159/384 (41%), Gaps = 47/384 (12%)

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    M+ +I+ + +G++I + A ++     G     +G  GI  +  VI S+
Sbjct: 132 GRIATPIGFKRTMLFAIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSN 191

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIDANWKWGI-------GMWAFILPL 235
               + R + + I +  F    ++  ++ G  TS +   W+W         G+  F+  +
Sbjct: 192 LVEESNRGVLIAILSCSFAIASVVGPFLGGVFTSRV--TWRWCFYINLPIGGLTFFLFLM 249

Query: 236 ACIP------------LGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWK 282
            C P            L I    + ++ +  H   ++K   E   +  WK    ++ F  
Sbjct: 250 FCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHLSKVK---ELGKRTSWKILLTELVFM- 305

Query: 283 LDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVL----------PLY 332
            DII  +L T  F  +L+ FT  GG +  W +A IIV  VIG ++V+          P +
Sbjct: 306 YDIIEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKF 364

Query: 333 MLWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSA 391
            + +      PL  W  I+  G              +  Q  Y+     +  ++S  K+A
Sbjct: 365 DVVKTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAA 424

Query: 392 TRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGII 451
             + +     +VI   + G I  K R+ KP I+      +V  GLL     +S ++S  I
Sbjct: 425 VHLVACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLN-NSASNSAHI 482

Query: 452 GSLCLLGFGAGSFTYVTQASIQAS 475
           G L L G    +F  + Q+S+ AS
Sbjct: 483 GLLILPGI---AFGGLMQSSMLAS 503

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 165/384 (42%), Gaps = 46/384 (11%)

Query: 122 GQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILE 181
           G+I F+ L    G  + M+ +I+ + +G++I + A ++     G     +G +GI  +  
Sbjct: 114 GRIAFSFL----GFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSF 169

Query: 182 VIASDFSNLNWR-LLALFIPA---LPFIINTWISGNVTSAIDANWKWGIGMWAFILPLAC 237
           VI S   +   R  +  F+ A   +  +I  +I G  TS +   W+W    W   LP+  
Sbjct: 170 VIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHV--TWRWC--FW-INLPVGA 224

Query: 238 IPLGICMLHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
           + L I         +K        LK   E + K+++K     + F KLDII  +LI+  
Sbjct: 225 VALVIFTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLF-KLDIIEFMLISAG 283

Query: 295 FGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWV----------VVLPLYMLWEIKYSRH-P 343
             C+L+ FT  GG + +W +  II+  VIG            V+ P   + +  Y ++ P
Sbjct: 284 IVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQP 342

Query: 344 LTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           L  W  ++ RG              +  Q     TV  V   + I +++   +    ++V
Sbjct: 343 LISWKNLRIRGIFTASMTTFFFCIGYMSQ-----TVYYVQFFQLIYNSSPWKASIHLIAV 397

Query: 404 IVGTIL-----GFILIKVRRTKPFIIFGISCWIVSFGL--LVHYRGDSGAHSGIIGSLCL 456
           ++ T+L     GF+  K    KP  + G+   ++  GL  L+    +S  H   IG L L
Sbjct: 398 MIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQH---IGLLIL 454

Query: 457 LG--FGAGSFTYVTQASIQASAKT 478
            G  FGA +   +  A I+   K+
Sbjct: 455 PGVAFGACNQCTMMAAQIELDKKS 478

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 94/386 (24%), Positives = 158/386 (40%), Gaps = 51/386 (13%)

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G  + M+ +I+ + +G++I + A ++     G     +G  GI  +  VI S 
Sbjct: 117 GRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGST 176

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIDANWKW------GIGMWAFILPLA 236
               + R + + I +  F    ++  ++ G  TS++   W+W       IG  AF L + 
Sbjct: 177 LVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSV--TWRWCFYINLPIGGLAFFLFVL 234

Query: 237 CIPLGICMLH--MRYL----------ARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKL 283
               G+      M+ +           RK A   LK   F   N   WK   I++ F   
Sbjct: 235 FYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSNS--WKKLFIELVFM-Y 291

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAH----------IIVPEVIGWVVVLPLYM 333
           D+I ++L +  F  +L+ FT  GG +  W +            +++  +I    V P + 
Sbjct: 292 DVIELVLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFN 350

Query: 334 LWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSAT 392
           L +   S  PL  W  I+  G              +  Q  Y+     +  ++S  K+A 
Sbjct: 351 LVKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAV 410

Query: 393 R-ITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGL--LVHYRGDSGAHSG 449
             IT + S  +VI   + G I  K R+ KP I+      +V  GL  L++    S AH  
Sbjct: 411 HLITCVIS--TVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNASSSAH-- 466

Query: 450 IIGSLCLLGFGAGSFTYVTQASIQAS 475
            IG L L G   G    + Q+S+ AS
Sbjct: 467 -IGLLILPGIAFGG---LAQSSMLAS 488

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 93/391 (23%), Positives = 155/391 (39%), Gaps = 52/391 (13%)

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R++ I G  S M+ +II + +G++I   A ++     G     +G +GI  +  VI
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVI 190

Query: 184 ASDFSNLNWRLLALFIPALPF----IINTWISGNVTSAIDANWKW------GIGMWAFIL 233
            S+  +   R L +   +  F    +I  ++ G  T+   A W+W       +G  AF L
Sbjct: 191 GSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTT--HATWRWCFYINLPVGGVAFAL 248

Query: 234 ------PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK----WKSFCIDIAFWKL 283
                 P      GI +L     + K   + L+ +   +  LK    WKS    + F + 
Sbjct: 249 FVVFYNPQRKSLEGISILS----SLKEFCNTLR-QITVIKNLKNWPTWKSIVYSLVF-RF 302

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWV----------VVLPLYM 333
           DII  +  +  F  VL+ FT  GG +  W +A IIV  VIG +          V+ P + 
Sbjct: 303 DIIEFIFCSAGFVLVLLAFTF-GGNQYNWSSASIIVMFVIGIILLIVSLLYDFVIFPRFK 361

Query: 334 LWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATR 393
             +      PL  W +    G              +  Q     TV ++   + ++  T 
Sbjct: 362 AVKENSLYQPLIKWSIFSHPGIFTANAALFFECTAYICQ-----TVYIIQFFQLVRGNTA 416

Query: 394 ITSLYSFVSVIVGTIL-----GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHS 448
             +    ++ +V T++     G    K    K     G+   +V  GLL     +S +  
Sbjct: 417 WKAAVHLIATVVPTVITTFSSGIANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNSSSAK 476

Query: 449 GIIGSLCL--LGFGAGSFTYVTQASIQASAK 477
             IG L L  +GFGA   + +  A IQ   K
Sbjct: 477 H-IGLLILPGIGFGATMQSTMIGAQIQLDKK 506

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 145/379 (38%), Gaps = 44/379 (11%)

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTII----ESQAVNITRFAVGGCFYQLGLTGIILI 179
           + + RL+ I G  + +  SI+ + +G++I     S  + I    V GC    G +GI  +
Sbjct: 60  LLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGC----GGSGIQSL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
           + V+ +       R + + +  L F +   +   +  A   N  W    W F + L    
Sbjct: 116 VFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGG 172

Query: 240 LGICMLHMRY-LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK---------LDIIGML 289
           + + ML   Y    K  ++ L      L   ++  + +  +FW+         LD IG  
Sbjct: 173 VALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQW-VTASFWRRAYNFLMFDLDFIGFA 231

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVL--------PLY--MLWEIKY 339
           L +  F   ++  T  GG    W +  II    +G ++VL         LY    W  K 
Sbjct: 232 LSSTGFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKR 290

Query: 340 SRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYS 399
              PL    L    G              + MQ     TV +V +++ + ++    +   
Sbjct: 291 EATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQ-----TVYIVQLYQLVFNSGPTAASMH 345

Query: 400 FVSVIVGTILGFILIKVRRT-----KPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSL 454
             + ++ T++  I+I          KP I+FG +C +V  GL+   R  S     +IG  
Sbjct: 346 LWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTS-TTGNVIGYC 404

Query: 455 CLLGFGAGSFTYVTQASIQ 473
            L G   GS    T  S Q
Sbjct: 405 ILPGAAFGSIMQGTLLSAQ 423

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 80/361 (22%), Positives = 142/361 (39%), Gaps = 29/361 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + RLS + G    +I  II +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
             VI     N   R L L +    F + + +   +  A   +  W    W F + L    
Sbjct: 153 SLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGICMLHMRYLARKHAKDRLKPEFEALNKL--------KWKSFCIDIAFWKLDIIGMLLI 291
           L I +    Y       D L+   +   KL          K   +D   +  DI+  +L 
Sbjct: 210 LAIAIFIFFY--NPEGADLLEKGSQTFKKLLSYRRANLSLKQL-LDQLLFGFDIVSFVLF 266

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRH--------P 343
           T  +   L+  T  GG    WK+  I++  +I  V+++ L ++++ +   H        P
Sbjct: 267 TAGWLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRP 324

Query: 344 LTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFVS 402
           L  W L+  R               + +Q  Y      +V    + K+   +  +   VS
Sbjct: 325 LLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVS 382

Query: 403 VIVGTIL-GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGA 461
            +V +I  G I+ K    KP ++FG +  ++  GL++     S  H+  IG L L G   
Sbjct: 383 TVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQ-IGVLILPGVAL 441

Query: 462 G 462
           G
Sbjct: 442 G 442

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 90/398 (22%), Positives = 171/398 (42%), Gaps = 39/398 (9%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R + IFG  + ++VSII + +G+++ + + ++     G      G +GI  +
Sbjct: 69  ALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTL 128

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINT----WISGNVTSAIDANWKWGIGMWAFILPL 235
           +  IA+   + + R   + + +L + + +    +I G +T  +   W+W    +   LP+
Sbjct: 129 VFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYV--TWRW---CFYINLPI 183

Query: 236 ACIPLGICMLHMRYLARK-------HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGM 288
             + LG+  L      RK         K     EF+ L  LK+    +    ++LD  G 
Sbjct: 184 GGLALGVFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQLLSLKFYRMLLKFLVFELDFFGF 243

Query: 289 LLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIG--WVVVLPLY------MLWEIKYS 340
              +V F  +L+     GG    W++  II   V+G  ++V+  +Y      M W+ + +
Sbjct: 244 TFCSVGF-VLLLLGLTFGGNLHPWQSGTIIAYLVVGSFFIVIFFVYEFVIFDMFWQSQRN 302

Query: 341 RH--PLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES-IKSATRITSL 397
            +  PL  W      G              + +Q  ++  +  +   +S  ++A+ + SL
Sbjct: 303 GNARPLISWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLWSL 362

Query: 398 Y--SFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
              +FVS+I+    G I  +    KP  +F     ++  GLL    G+S  +S  IG   
Sbjct: 363 LIPAFVSIIIS---GKITSRYGYVKPITLFAGISGVIGAGLLTLLNGES-TNSEQIGYAI 418

Query: 456 LLG--FGAGSFTYVTQASIQ---ASAKTHARMAVVTSL 488
           L G  FG  + + +  A IQ   +  K   +   VT+L
Sbjct: 419 LSGAAFGCINLSTLLSAQIQIDKSDPKYDEKFIEVTAL 456

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 75/376 (19%), Positives = 150/376 (39%), Gaps = 29/376 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R++ + G  + ++ SI+ +  G+++ + A ++     G      G +GI  +
Sbjct: 56  ALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
           +  + +   +   R   + I  + +++       +  A   +  W    W F + +    
Sbjct: 116 VFAVGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFINIPIGG 172

Query: 240 LGICMLHMRY-LARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLL 290
           + + +L   Y  A +   + L   +++  K  WK           + +  ++LDI+G+LL
Sbjct: 173 VALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLL 232

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEI-----------KY 339
            +  F  +++  T  GG K  W +A II    IG + +L ++ML++              
Sbjct: 233 SSGGFALIMLALTF-GGNKFAWNSASIICMFTIG-IALLGIFMLYDFVVLPYIGRRLENG 290

Query: 340 SRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYS 399
              PL PW L  +                + +Q  Y+     +  +E    A+      S
Sbjct: 291 EAMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMS 350

Query: 400 FVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGF 459
             ++I   +   I  K    KP I+ G+    +  GLL  + G + +    IG   L G 
Sbjct: 351 VPALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLF-GSNTSTGASIGYSMLAG- 408

Query: 460 GAGSFTYVTQASIQAS 475
              SF  V Q S+ +S
Sbjct: 409 --ASFGCVYQLSLLSS 422

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 90/215 (41%), Gaps = 13/215 (6%)

Query: 68  IYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFA 127
           I  +++F  +FL A    LDG I  T      S ++    +S +     + ++  Q  + 
Sbjct: 83  IIMISMFLGIFLAA----LDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYG 138

Query: 128 RLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDF 187
           +LSD  GR  +++ S + +S+G +I   + +I    VG     +G  G+  +  ++ SD 
Sbjct: 139 KLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDL 198

Query: 188 SNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHM 247
             L  R +   +    F + T  SG +  A   +W+      AF +    I L  C L +
Sbjct: 199 VPLRERAVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIV 251

Query: 248 RYLA--RKHAKDRLKPEFEALNKLKWKSFCIDIAF 280
            YL    +H  D+ +     L  L W      + F
Sbjct: 252 SYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCF 286

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 55/249 (22%), Positives = 104/249 (41%), Gaps = 27/249 (10%)

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R + I G  S M++SII + +G+++ + A ++     G     +G +G+  +  +I S 
Sbjct: 99  GRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIIST 158

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGI 242
             N   R +A+ + +  F    I+  ++ G  T+ +   W+W    +   LP+  +   +
Sbjct: 159 LVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHV--TWRW---CFYINLPIGGLAFLV 213

Query: 243 CMLHMRYLARKHAKDRLKP-------EFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
            +L          K+  K        +F  L K K      +   +K D +G  L +  F
Sbjct: 214 FVLSYNPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGF 273

Query: 296 GCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR----------HPLT 345
             +L+  T  GG +  W +  II   VIG V+ +  ++     ++R           PL 
Sbjct: 274 CLILLGLTF-GGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLV 332

Query: 346 PWDLIQDRG 354
            W++I   G
Sbjct: 333 SWNVISKPG 341

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 64/152 (42%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           P P  +E +      +E     YN  + +  + FSL+L ++   LDG I           
Sbjct: 12  PVPEEVETLP-----LEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR S ++ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAICGIGAGGLNAIGSIAVSDICTARER 158

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 69/259 (26%), Positives = 102/259 (39%), Gaps = 26/259 (10%)

Query: 248 RYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGG 307
           R LAR   + R  P    L    W+     + F +LDI G+ L +  F  V++  T  GG
Sbjct: 191 RALARFWVRARAFPYGTLLQAQFWRRAAALMVF-RLDIPGLALSSGGFALVMLALTF-GG 248

Query: 308 LKEEWKTAHIIVPEVIGWVVVLPLYMLWEI-----------KYSRHPLTPWDLIQDRGXX 356
            +  W++A I+   V G   +L L+ML++             Y   PL PW L  +    
Sbjct: 249 NQYAWRSATIVCMFVFG-AALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAANVPVL 307

Query: 357 XXXXXXXXXXXXWYMQGDYM--YTVLVVAVHESIKSATR-ITSLYSFVSVIVGTILGFIL 413
                       + +Q  Y+  Y  LVV    ++ S      SL + VSVI   ++    
Sbjct: 308 TSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSVIASAVVN--- 364

Query: 414 IKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQ 473
            +    KP ++ G+    V  GLL   R D+      IG   L G   G    ++  S Q
Sbjct: 365 ERFGVVKPLVLAGVVMGFVGSGLLTLVRSDTTLGQS-IGFSVLAGASFGCVYQLSLISAQ 423

Query: 474 ASAKT-----HARMAVVTS 487
              +      HAR   VTS
Sbjct: 424 LQVERDDPDFHARFIEVTS 442

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 136 FSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             ++I+S +F+ +G +I   + N+     G     +G  G+  +  + ASD   L  R L
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRAL 185

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           PAP   E++      +E     YN  + +  + FSL+L ++   LD  I           
Sbjct: 12  PAPEEAEVLP-----LEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR   ++ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAVCGIGAGGLNAISSIAVSDICTARER 158

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 57/130 (43%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  + +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S ++++  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASDFSNLNWR 193
            SD      R
Sbjct: 149 VSDICTARER 158

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 99/247 (40%), Gaps = 11/247 (4%)

Query: 53  GVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           G   IE   EM N  +    +  S++L  +   LD  +  T  A+  S ++Q   +  V 
Sbjct: 381 GTLPIEPSVEMSNMKMN--IIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVA 438

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLG 172
               + +AV Q  + +LSDIFGR +++I S + +  G II   + ++     G     +G
Sbjct: 439 TSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIG 498

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSA-IDANWKWGIGMWAF 231
             GI  +  +  SD   L  R +   I    F + T   G +    +D  + W +  W+ 
Sbjct: 499 GGGITSMTTITVSDIVPLRSRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQ 558

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           +       L IC     +L     K+        L ++ W    I +  W   +   LLI
Sbjct: 559 VPVSGLSTLLIC----SFLVVPRIKNYEVSLGRKLMRVDWLG-SISMILW---LTSFLLI 610

Query: 292 TVFFGCV 298
           T   G +
Sbjct: 611 TTMMGGI 617

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 98/212 (46%), Gaps = 21/212 (9%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L  +   +D  I  T  A+  S ++Q S +S +     + +A  Q  + ++SDI
Sbjct: 113 IMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDI 172

Query: 133 FGRFSIMIVSIIFYSMGTIIESQAVN-----ITRFAVGGCFYQLGLTGIILILEVIASDF 187
           FGR  +++ + + + +G ++   + +     I RF  G     +G  G+  +  +  +D 
Sbjct: 173 FGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAG-----VGGGGLTSMSSITITDL 227

Query: 188 SNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFIL--PLACIPLGICML 245
             L  R +   I  + + + T   G V      N K G  M AF++  PL+ I L + +L
Sbjct: 228 VPLRERAMYQGICNVFYGLGTACGGIVGGWFSDN-KGGWRM-AFLIQVPLSAISLLVIIL 285

Query: 246 HMRYLARKHAKDRLKPEFEALNKLKWKSFCID 277
           H++  +++  +++        N +K K   ID
Sbjct: 286 HLKLPSKRATRNQ-------DNSIKRKLLAID 310

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 122/284 (42%), Gaps = 16/284 (5%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182

Query: 133 FGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
           FGR  ++I   I + +G++I   + +      G     +G  GI  +  +  SD   L  
Sbjct: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRN 242

Query: 193 RLLALFIPALPFIINTWISGNVT---SAIDANWKWGIGMWAFILPLACIPLGICMLHMRY 249
           R L   I    F + T + G V    S     W+     +   LP+A     + +L +R 
Sbjct: 243 RALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298

Query: 250 LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLK 309
           L ++     L+ +    + +K +   +D   W    IG   + +F    ++  +L G  K
Sbjct: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASLGG--K 349

Query: 310 EEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDR 353
           E   T+H  +   +  V+   ++   E+K ++ P+ P   ++DR
Sbjct: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR 393

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 55/123 (44%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  + +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S ++ +  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASD 186
            SD
Sbjct: 149 VSD 151

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 107/443 (24%), Positives = 179/443 (40%), Gaps = 45/443 (10%)

Query: 71  VALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           ++L  S+FL A    LD  I  T        +  +S    +    ++ +A+  + + R++
Sbjct: 59  ISLILSIFLAA----LDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIA 114

Query: 131 DIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNL 190
            + G  S M+ +II + +G+++ + A ++     G     LG +GI  +  VI S     
Sbjct: 115 AVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEE 174

Query: 191 NWRLLALFIPALPF----IINTWISGNVTSAIDANWKW---------GIGMWAFILPLAC 237
           + R L +      F    ++  ++ G  T+ +   W+W         G+    FIL    
Sbjct: 175 SKRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFWINLPIGGLAFAFFILFYN- 231

Query: 238 IPLGICMLHMRYLAR--KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
            P G     + Y+    K     LK   + L    W+    ++  +K DII   L T   
Sbjct: 232 -PHGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHEL-IYKFDIIEFALCTT-- 287

Query: 296 GCVLVPFTLA-GGLKEEWKTAHIIVPEVIGWVVVLPLYMLWE------IKYSR-----HP 343
           G VL+   L+ GG K  W +   I   VIG +V + L ++++      +K  R      P
Sbjct: 288 GLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTI-LALVYDFAIFPRLKVVRENPRYQP 346

Query: 344 LTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           L P  + +                 +  Q +Y+     +  +E+   A+ I  +   V  
Sbjct: 347 LIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKAS-IHVIACVVPT 405

Query: 404 IVGTILGFIL-IKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG--FG 460
           ++  I   IL  K    KP  + GI+  IV  GLL      S  +S  IG L L G  FG
Sbjct: 406 VITVITSGILNSKFGIVKPINVLGITAAIVGAGLLTLLTNKS-TNSEHIGLLILPGVAFG 464

Query: 461 AGSFTYVTQASIQASAK-THARM 482
           A   + +  + IQ   K TH RM
Sbjct: 465 ATMQSTLIGSQIQLDKKSTHYRM 487

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 6/166 (3%)

Query: 33  VKPTLTTSS--PAPSYIELIDPGVHNIEI---YAEMYNRPIYRVALFFSLFLIAYAYGLD 87
           + P   TSS  PA S IE +  G + I +   Y E +N  + +V +  SL+L ++   LD
Sbjct: 1   MDPLDETSSLLPARSTIEEVPEGEYEISLEKKYHE-HNLSLPKVPILSSLWLGSFFSSLD 59

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
             I           +++      +     +     Q  + +LSDI GR   ++ +  F+ 
Sbjct: 60  STIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFG 119

Query: 148 MGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +G ++   A N+T+F++      +G  GI  +  +  SD      R
Sbjct: 120 LGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRER 165

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 90/193 (46%), Gaps = 15/193 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ ++ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARFADKLGRRLAIVIVVLV 145

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S +    ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 205

Query: 203 PF-IINTWISGNVTSAID--ANWKWGIG---MWAFILPLACIPLGICMLHMRYLARKHAK 256
            F I   + S   T   D  A W+  +G   +WA I+ +  +   +     RYL  +   
Sbjct: 206 TFGIFLGYCSVYGTRKYDDTAQWRVPLGLCFLWALIIIVGML---LVPESPRYLIEREKH 262

Query: 257 DRLKPEFEALNKL 269
           +  +     +NK+
Sbjct: 263 EEARISLAKINKV 275

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198

Query: 130 SDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SDIFGR  +++ S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258

Query: 190 LNWRLLALFIPALPFIINTWISGNV 214
           L  R L   I  + F + T   G V
Sbjct: 259 LRSRALYQGICNVFFGLGTACGGLV 283

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 76/164 (46%), Gaps = 19/164 (11%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +++ ++ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PF-IINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICML 245
            F I   + S   T   D   +W             +PLG+C L
Sbjct: 206 TFGIFLGYCSVYGTRKYDNTAQWR------------VPLGLCFL 237

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 89/193 (46%), Gaps = 15/193 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +++ ++ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PF-IINTWISGNVTSAID--ANWKWGIG---MWAFILPLACIPLGICMLHMRYLARKHAK 256
            F I   + S   T   D  A W+  +G   +WA I+ +  +   +     RYL      
Sbjct: 206 TFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWALIIIIGML---LVPESPRYLIECERH 262

Query: 257 DRLKPEFEALNKL 269
           +  +     +NK+
Sbjct: 263 EEARASIAKINKV 275

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 128/320 (40%), Gaps = 27/320 (8%)

Query: 38  TTSSPAPSYIELIDPGVHNIEI--YAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQ 95
           TT S   S  E  D G   +     AE Y      + + FS+FL  +   LDG I  T  
Sbjct: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110

Query: 96  AYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQ 155
            +  S ++     S +     + ++  Q  + +LSD  GR  +++ S   +++G +I   
Sbjct: 111 THIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170

Query: 156 AVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT 215
           + +I     G     +G  G+  +  +I SD   L  R +   +    F + T  SG + 
Sbjct: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLV 229

Query: 216 SAIDANWKWGIGMWAFIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273
            A   +W+      AFIL  P++ +  GI  L + YL        L P   A NK  W +
Sbjct: 230 GAYFRDWR-----LAFILQCPISVLS-GI--LIVVYL-------ELPPRASASNKDCWSA 274

Query: 274 FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYM 333
                   +LD  G   +  F    ++  ++ G        + +        +V   +++
Sbjct: 275 -----RLRRLDWAGATSLIAFLFLFMLTSSMGG--SSVAYGSRLFAAMCAATLVFGAVFV 327

Query: 334 LWEIKYSRHPLTPWDLIQDR 353
             E++ +  P+ P   ++DR
Sbjct: 328 YVELRVAADPVLPVTFLRDR 347

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 86/193 (44%), Gaps = 19/193 (9%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +++ ++ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFII---NTWISGNVTSAIDANWKWGIG---MWAFIL-------PLACIPLGICMLHMRY 249
            F I      + G    +  A W+  +G   +WA I+       P +   L  C  H   
Sbjct: 209 TFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWALIIIVGMLLVPESPRYLIECERHEEA 268

Query: 250 LARKHAKDRLKPE 262
                  D++ PE
Sbjct: 269 CVSIAKIDKVSPE 281

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/297 (21%), Positives = 119/297 (40%), Gaps = 36/297 (12%)

Query: 67  PIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFF 126
           P   + +  S++L  +    DG +  T  A+  S +++   +S +     + +A  Q  +
Sbjct: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-----TRFAVGGCFYQLGLTGIILILE 181
            +LSDIFGR  +++++ I + +G ++     +       RF  G     +G  G+  +  
Sbjct: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGGGGVTSMCS 189

Query: 182 VIASDFSNLNWRLLALFIPALPFIINTWISGNVT---SAIDANWKWGIGMWAFIL--PLA 236
           +  SD   L  R L   +    F + T   G V    S     W+      AF++  PL+
Sbjct: 190 ITISDIVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWR-----MAFLIQVPLS 244

Query: 237 CIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFG 296
            +   +  + M+   R     R+       NKL             +D IG   + VF  
Sbjct: 245 ALSSLLIAVFMKLPPRSK---RVNSPASIKNKL-----------LSVDWIGASALVVFLS 290

Query: 297 CVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDR 353
             LV  +L G  KE    +   V   IG  +    ++  E+  ++ P+ P   +++R
Sbjct: 291 LFLVTASLGG--KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR 345

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 89/198 (44%), Gaps = 28/198 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ I+ Y 
Sbjct: 101 GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G +I+  +V+   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  T +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKLK 270
               ++ +  F   NKL 
Sbjct: 268 VKKTEQARASFAKSNKLS 285

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++  AY  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ I+ Y 
Sbjct: 100 GNYSHSRNAYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCVGLIIVIVVYM 155

Query: 148 MGTIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           +G +I+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 156 VGIVIQIASVDKWYQYFIGRIVAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 215

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 216 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 266

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 267 VGRVEKAKASFAKSNKL 283

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 76/157 (48%), Gaps = 12/157 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +++ ++ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFII---NTWISGNVTSAIDANWKWGIG---MWAFIL 233
            F I      + G    +  A W+  +G   +WA I+
Sbjct: 209 TFGIFLGYCSVYGTRKYSNTAQWRIPVGLCFLWALII 245

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 19/164 (11%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ ++ 
Sbjct: 158 NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFARFADKLGRRLAIVIVVLV 217

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 218 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 277

Query: 203 PF-IINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICML 245
            F I   + S   T   D   +W             +PLG+C L
Sbjct: 278 TFGIFLGYCSVYGTRKYDNTAQWR------------VPLGLCFL 309

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ I+ Y 
Sbjct: 101 GNYNHSKDTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G II+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 157 VGIIIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ +  F   NKL
Sbjct: 268 VKKTEQARASFAKSNKL 284

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%)

Query: 48  ELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           + ID    +IE        P     +  S++L  +   LD  I  T  A+  S +++   
Sbjct: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPH 165

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGC 167
           +S +     + +A  Q  + ++SDIFGR  ++I S + +++G +I   +  +     G  
Sbjct: 166 ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLL 195
              +G  G+  +  +  SD   L  R L
Sbjct: 226 IAGIGGGGLTSMSSITTSDIVPLRNRAL 253

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 19/164 (11%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ ++ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFARFADKLGRRLAIVIVVLV 148

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 208

Query: 203 PF-IINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICML 245
            F I   + S   T   D   +W             +PLG+C L
Sbjct: 209 TFGIFLGYCSVYGTRKYDNTAQWR------------VPLGLCFL 240

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 53/192 (27%), Positives = 80/192 (41%), Gaps = 34/192 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S  +LL     + TVI   GQI F  ++DI GR  I  + +I     T+++     S AV
Sbjct: 96  STTTLLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAV 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR---LLALFIPALPFIINTWI 210
           +   F     FY+    +G+ G   +  +I S+FS   WR   + A+F       I+  I
Sbjct: 153 S---FVAVLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGI 209

Query: 211 SGNVTSA------IDANWKWGIG---------MWAFILPLACIPLGICMLHMRYLARKHA 255
              V  A      ID N     G         MW  ++ L C+P G+  L+ R    +  
Sbjct: 210 VALVLVAAYKNQLIDVNTGAECGIECAKACDQMWRILVGLGCVP-GVVALYFRLTIPESP 268

Query: 256 KDRLKPEFEALN 267
           + +L    EA N
Sbjct: 269 RYQLDVHVEAEN 280

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 73/170 (42%), Gaps = 44/170 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIES---QAVNI 159
           S  +LL     + TV   VGQ+ F  L+D+ GR  I    +I   + TI+++   QA  +
Sbjct: 99  STQTLLKVSTSVGTV---VGQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGL 155

Query: 160 TRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVT 215
           + F     FY+    LG+ G   +  +I S+F+   WR                  G + 
Sbjct: 156 S-FTAMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR------------------GAIM 196

Query: 216 SAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEA 265
            A+ AN  WG  +++ I+ + CI                 KD+LKP +++
Sbjct: 197 GAVFANQAWG-QIFSGIVSIVCIAA--------------YKDQLKPAYDS 231

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 89/196 (45%), Gaps = 26/196 (13%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ I+ Y 
Sbjct: 101 GNYSHSKNTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G +I+  +++   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFIL--PLACIPLGICMLHMRYLARK 253
              L +  N    G  T +    W+  +G+   WA I+   +  +P        R+L + 
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIMIGGMTFVP-----ESPRFLVQV 268

Query: 254 HAKDRLKPEFEALNKL 269
              ++ K  F   NKL
Sbjct: 269 GKIEQAKASFAKSNKL 284

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+  SL +  +   LDG I  T   Y  S +     +S +     + A + Q  + +LSD
Sbjct: 153 AIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSD 212

Query: 132 IFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           IFGR +I++ S + + +G ++   A  +     G     +G  G+  +  +I SD   L 
Sbjct: 213 IFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLR 272

Query: 192 WR 193
            R
Sbjct: 273 SR 274

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR + +I+ I+ Y 
Sbjct: 97  GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCTGLIIVIVVYM 152

Query: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           +G +I+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 153 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 212

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 213 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 263

Query: 253 KHAKDRLKPEFEALNKL 269
               +  +  F   NKL
Sbjct: 264 VKKTEEARASFAKSNKL 280

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 105/250 (42%), Gaps = 23/250 (9%)

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + I G  S ++VSI+ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 171 LLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVI 230

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R++ + + +  + +   +   +  A+  +  W    W F + L    L   
Sbjct: 231 ASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFV 287

Query: 244 MLHMRY--LARKHAKDRL---KPEF-EALNKLKWKSFCIDIAFW---KLDIIGMLLITVF 294
           +L M Y    RK  KD     K  +   + +L    F   I  W   ++D +G +L T  
Sbjct: 288 VLAMVYNPSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAG 347

Query: 295 FGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVV----------LPLYMLWEIKYSRHPL 344
           F  +L+  T  G +   W +  IIV  V+G +++           P +       S  PL
Sbjct: 348 FTLLLLGLTFGGSM-YAWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPL 406

Query: 345 TPWDLIQDRG 354
            PW ++   G
Sbjct: 407 LPWRVVSRPG 416

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 88/191 (46%), Gaps = 15/191 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  ++G + FARL+D  GR   +++ ++ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCSLGGVAFARLADTLGRRLAIVIVVLV 145

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++LF   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLVSLFQLNV 205

Query: 203 PF-IINTWISGNVTSAID--ANWKWGIG---MWAFILPLACIPLGICMLHMRYLARKHAK 256
            F I   + S   T   D  A W+  +G   +WA I+ +  +   +     RYL  +   
Sbjct: 206 TFGIFLGYCSVYGTRKYDNTAQWRIPVGLCFLWALIIIIGML---LVPESPRYLIERGKN 262

Query: 257 DRLKPEFEALN 267
           +  +     +N
Sbjct: 263 EEARISIAKIN 273

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 36/162 (22%), Positives = 64/162 (39%), Gaps = 1/162 (0%)

Query: 33  VKPTLTTSSPAPSYIELIDPGVHN-IEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIR 91
           + P   TSS  P    + D    N +E     YN  + +  +  SL+L ++   LD  I 
Sbjct: 1   MDPLDETSSLLPIRSSIEDGEEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIV 60

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTI 151
                     + +      +     +     Q  + +LSDI GR   ++ S  F+ +G  
Sbjct: 61  ANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCF 120

Query: 152 IESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +   A NIT+F++      +G  G+  +  +  SD  +   R
Sbjct: 121 LTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRER 162

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 69/163 (42%), Gaps = 12/163 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN------ITRFAVGGCFYQLGL 173
           AVG +   +L DI+GR   +I++ I + +G +IE  +V+      I R   G     + +
Sbjct: 127 AVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIAV 186

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIG---MWA 230
              +LI EV   +          L I    F+ N    G  + +  A W+ G+G   +W+
Sbjct: 187 LSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLWS 246

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273
            I+  A +         RYL +K   ++ K      NK+   S
Sbjct: 247 IIMVCAMM---FVPESPRYLIQKGKTEQAKISIARSNKVDIDS 286

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 61/146 (41%), Gaps = 36/146 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  V +I     T+++     S ++
Sbjct: 97  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSI 153

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N         FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 154 NFVAVLT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 192

Query: 214 VTSAIDANWKWG---IGMWAFILPLA 236
           +  A+ AN  WG    G+ A IL  A
Sbjct: 193 IMGAVFANQAWGQLSCGILALILVAA 218

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 84/363 (23%), Positives = 148/363 (40%), Gaps = 34/363 (9%)

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    +++SI+ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R +A+ + +  + +    S  + SA   +  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKL--DIIGMLLITVFFGC 297
           +L + Y  + H  +  +     L         + F  D+ + K+  +++       F  C
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDL-YLKMFNELVFGFDFIGFIFC 267

Query: 298 VL--VPFTLA---GGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEI----KYSR------- 341
            +  + F L    GG K  W +  IIV  V+G V +   ++L++     K+ R       
Sbjct: 268 SVGFILFRLGLTFGGDKYTWSSGAIIVYFVVG-VTISVAFLLYDFMVFPKFGRVRKNASF 326

Query: 342 HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSF 400
            PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 401 VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG-- 458
             +I   I G I       KP I  GI   +V  GLL     DSG+ S  IG L L G  
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGS-SKHIGLLILPGVA 444

Query: 459 FGA 461
           FGA
Sbjct: 445 FGA 447

>TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {ON}
           Anc_8.521 YBR207W
          Length = 455

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNIT 160
           S S+H     ++ I +VI +V  +FF R+  +  +F + + S+I+   G ++E QAVN +
Sbjct: 153 SVSEHYYEGILSIIASVIISVMGLFFLRMGKLREKFRVKLASMIYSEHGNLLERQAVNDS 212

Query: 161 RFAV 164
           +  V
Sbjct: 213 KNVV 216

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +++ I+ Y 
Sbjct: 98  GNYSHSKDVYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLVIVIVVYM 153

Query: 148 MGTIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           +G +I+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 154 VGIVIQIASVDKWYQYFIGRIVAGVGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 213

Query: 199 IPALPFIINTWISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 214 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 264

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 265 VGRVEKAKASFAKSNKL 281

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y +G +I
Sbjct: 93  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 149

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 150 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 209

Query: 204 FIINTWISGNVTSAIDANWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 210 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 269

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 270 SNKIDVEDP 278

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 64/150 (42%), Gaps = 36/150 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S ++LL     + TVI   GQI F  ++DI GR  I  + +I   + TI++     S ++
Sbjct: 113 STNTLLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSI 169

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N         FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 170 NFVAILT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 208

Query: 214 VTSAIDANWKWGI---GMWAFILPLACIPL 240
           +  A+ AN  WG    G+ A IL  A  P+
Sbjct: 209 IMGAVFANQAWGQILGGIVALILVAAYKPM 238

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y +G +I
Sbjct: 95  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 151

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 152 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 211

Query: 204 FIINTWISGNVTSAIDANWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 212 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 271

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 272 SNKIDVEDP 280

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 75  FSLFLIAYAYG-LDGNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFF 126
           F  F+  +  G + G +R T   + + T+  +  S LS V       I  +  A+G I  
Sbjct: 95  FGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTSYLSNVRTGLLVSIFNIGCAIGGIVL 154

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIAS 185
           +RL D++GR   +++ ++ YS+G II+  +++   ++ +G     LG+ GI ++  ++ S
Sbjct: 155 SRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLIS 214

Query: 186 DFSNLNWR 193
           + S    R
Sbjct: 215 EVSPKQLR 222

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 57/291 (19%), Positives = 116/291 (39%), Gaps = 31/291 (10%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  + ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 30  HNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQ 89

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSD+ GR   ++ +  F+ +G ++   A ++T+FA+      +G  GI  +  + 
Sbjct: 90  PLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSIT 149

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGIC 243
            SD      R +      + F +   +   +         W I    F L +  I L   
Sbjct: 150 VSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTLGWRI---LFGLQVPTILLCSS 206

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFT 303
           ++H      K+   +L        + KW +        ++DI+G           LV FT
Sbjct: 207 LVH------KNVNIKLSHLLPVEERFKWSNLS------RIDILG--------SSTLV-FT 245

Query: 304 LAGGL---KEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           ++G L     E   A + +  VI ++     ++L E+ YS+  + P++L++
Sbjct: 246 ISGVLFLCSTELNKALLSIFTVISFIA----FILIELYYSKERIMPFELLK 292

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y +G +I
Sbjct: 92  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 148

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 149 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 208

Query: 204 FIINTWISGNVTSAIDANWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 209 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 268

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 269 SNKIDVEDP 277

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 53/119 (44%), Gaps = 6/119 (5%)

Query: 51  DPGVHNI---EIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           D  VH+I   E + +  N P  +  +  SL+L ++   LDG I           + +   
Sbjct: 19  DNNVHSILEKEYHEQNLNLP--KTPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK 76

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIF-GRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
              +     +     Q  + +LSD+  GR    +V+  F+ +G +I   A N+T+FAVG
Sbjct: 77  KQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVG 135

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 69/165 (41%), Gaps = 12/165 (7%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   +I++   + +G +IE  +++      I R   G  
Sbjct: 123 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIG 182

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G  T +    W+ G+G
Sbjct: 183 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLG 242

Query: 228 M-WAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEALNKL 269
           + +A+ L   C+  G+  +    RYL  K   +  K      NKL
Sbjct: 243 LQFAWCL---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKL 284

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 64/145 (44%), Gaps = 34/145 (23%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSI----MIVSIIFYSMGTII-ESQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I    +I+ I+   + T   ES+A+
Sbjct: 88  STATLLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAI 144

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 145 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 183

Query: 214 VTSAIDANWKWGIGMWAFILPLACI 238
           +  A+ AN  WG  + A I+ L C+
Sbjct: 184 IMGAVFANQAWG-QIAAGIVALVCV 207

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 144/367 (39%), Gaps = 39/367 (10%)

Query: 127 ARLSDIFGRFSI-------MIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A LS ++GRF         M++SI+ + +G++I + A ++T    G     +G +GI  +
Sbjct: 124 ALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTMLIGGRVISGIGGSGIQTL 183

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
             VI S       R  A+ I +  F + +     +  A   +  W    W F + L   P
Sbjct: 184 CFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATHVTW---RWCFYINL---P 237

Query: 240 LGICMLHMRYLARKHAKDRLKPEFE-ALNKLKWKSFC--IDIAFW---------KLDIIG 287
           +G         +     +     F+  L ++K  S+   + ++F+         K D   
Sbjct: 238 IGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSFYRRLFRTLVFKFDFFE 297

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR------ 341
             L +  F  VL+  T  GG + +W +  II   V+G ++++  ++   + + R      
Sbjct: 298 FALSSAGFTLVLLALTF-GGNRYDWNSGTIIAYFVVGILLIIASFVYDFVVFDRVKPQTD 356

Query: 342 ----HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSL 397
                PL  W++I   G              + MQ  Y+     +   +S   A+ I  +
Sbjct: 357 RIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYFQLVWGDSAWKAS-IHLI 415

Query: 398 YSFVSVIVGTIL-GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
              +S ++  +  G I  K    K  ++ G     V+ G+L    G   + S  IG L L
Sbjct: 416 APVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILT-LLGPKSSSSAKIGLLIL 474

Query: 457 LGFGAGS 463
            G   GS
Sbjct: 475 PGISFGS 481

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 77/360 (21%), Positives = 140/360 (38%), Gaps = 27/360 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + +ARLS + G    ++  II +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
             VI     +   R L L +    F + + +   +  A   +  W    W F + L    
Sbjct: 153 SLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGICMLHMRY------LARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
           L I +    Y      L  K      K   F  + K   K   +    +  DI+  +  T
Sbjct: 210 LAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKK--VLQQLLFGFDILSFISFT 267

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKY--------SRHPL 344
             +   L+  T  GG    W +  +I   +IG V+++ + ++++ K         S  PL
Sbjct: 268 AGWLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPL 325

Query: 345 TPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFVSV 403
             W+++ +R               + +Q  Y      +V    + K+   +  +   VS 
Sbjct: 326 LSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVST 383

Query: 404 IVGTILGFILIK-VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAG 462
           +V +I   IL K     KP ++FG +  ++  GL+      S  H+  IG L L G   G
Sbjct: 384 VVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLILPGVALG 442

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 44/73 (60%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341
           K+D +G +L    FG +++ F         W++A+IIV  V+ +  ++ +++++E+KY++
Sbjct: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALV-IFVVYEVKYAK 326

Query: 342 HPLTPWDLIQDRG 354
            PL P  +  +RG
Sbjct: 327 TPLIPKAISSNRG 339

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 96/231 (41%), Gaps = 28/231 (12%)

Query: 123 QIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
           Q  + RLSDI GR    ++   F+ MG+ + + +  + +FA+      +G  GI  +  +
Sbjct: 118 QPLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSI 177

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGI 242
             SD   +  R +      + +     I   +   +     W   ++AF +P+  + +  
Sbjct: 178 AVSDICTVKERGMYQGYANIFYGAGQLIGAPIGGLLIDRIGWR-ALFAFQVPMVAVAM-- 234

Query: 243 CMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPF 302
             L   YL  K A   L P+ E   + KWK         KLDI G + + +  G  +V  
Sbjct: 235 -FLSFTYLNIKLA--HLPPKEE---RYKWKHLS------KLDIFGSITLVITIGICIVIL 282

Query: 303 TLAGGLKEEWKTAHIIVPEVIGWVVVLP--LYMLWEIKYSRHPLTPWDLIQ 351
           +  G           +   V+G + +L   L+++ E  Y++H + P   +Q
Sbjct: 283 SDNG-----------LNRMVLGAMGLLSFGLFLIIEKYYTKHQILPLKCLQ 322

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 37.7 bits (86), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 82/363 (22%), Positives = 144/363 (39%), Gaps = 34/363 (9%)

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    +++SI+ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R +A+ + +  + +       +  A   +  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKLDII-------GMLLIT 292
           +L + Y  + H  +  +     L         + F  D+     D +       G +  +
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCS 268

Query: 293 VFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEI----KYSR------- 341
           V F   L+  T  GG K  W +  IIV  ++G V +   ++L++     K+ R       
Sbjct: 269 VGFILFLLGLTF-GGDKYAWSSGAIIVYFIVG-VTISVAFLLYDFMIFPKFGRVRKNASF 326

Query: 342 HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSF 400
            PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 401 VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG-- 458
             +I   I G I       KP I  GI   +V  GLL     DSG+ S  IG L L G  
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGS-SKHIGLLILPGVA 444

Query: 459 FGA 461
           FGA
Sbjct: 445 FGA 447

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 77/190 (40%), Gaps = 37/190 (19%)

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG-RFSIMIVSIIFYSMGTIIE-SQAVNI 159
           Y  ++ +  +  I  +  AVG I  +RL D++G R  +MIVS+I Y +G II+ S     
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLI-YVVGIIIQISSNTKW 146

Query: 160 TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWI------SGN 213
            ++ +G     LG+ GI ++  ++ S+ S  + R     +     +I   I      +  
Sbjct: 147 YQYCIGRVISGLGVGGIAVLSPMLISETSPKHLR--GTLVSCYQLMITAGILLGYCANYG 204

Query: 214 VTSAIDANWKWGIGMWAFILPLACIPLGICML--------------HMRYLARKHAKDRL 259
             S  D + +W             IPLG+C L                RYL  K   +  
Sbjct: 205 TKSRYDDSRQWR------------IPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEA 252

Query: 260 KPEFEALNKL 269
           K      NK+
Sbjct: 253 KRSLATSNKV 262

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 78/340 (22%), Positives = 140/340 (41%), Gaps = 47/340 (13%)

Query: 127 ARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    M+ +I+ + +G++I + A +++    G     +G  GI  +  VI S 
Sbjct: 123 GRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGST 182

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGNVTSAIDANWKW------GIGMWAFILPLA 236
               + R + + + +  F    ++  ++ G  TS++   W+W       IG  AF L L 
Sbjct: 183 LVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSV--TWRWCFYVNLPIGGLAFFLFLF 240

Query: 237 CIPLGIC-----MLHMRY-------LARKHAKDRLKPE-FEALNKLKWKSFCIDIAFWKL 283
               G+      M ++R        + R  A   LK + F  LN   W+   +++ F   
Sbjct: 241 FYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNG--WRKPFMELIFM-Y 297

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAH----------IIVPEVIGWVVVLPLYM 333
           DII  +  +  F C+L+ FT  GG +  W +A           ++V   I   +V P + 
Sbjct: 298 DIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFN 356

Query: 334 LWEIKYSRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSAT 392
           + +      PL  W  I+  G              +  Q  Y+     +  ++S  ++A 
Sbjct: 357 IVKATPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAV 416

Query: 393 RITSLYSFVSVIVGTIL-GFILIKVRRTKPFI----IFGI 427
            + +    +S +V  IL G I  K R+ KP I    IFG+
Sbjct: 417 HLVA--CIISTVVTAILCGAITDKTRQIKPIIVISSIFGV 454

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 61/148 (41%), Gaps = 40/148 (27%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFS-------IMIVSIIFYSMGTIIESQ 155
           S  +LL     + TVI   GQ+ F  L+DI GR         IMIV  I  +  T+  S 
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQT--TVAHSP 156

Query: 156 AVNITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           A+N   F     FY+    +G+ G   +  +I S+F+   WR                  
Sbjct: 157 AIN---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------ 195

Query: 212 GNVTSAIDANWKWGI---GMWAFILPLA 236
           G +  A+ AN  WG    G+ A IL  A
Sbjct: 196 GAIMGAVFANQAWGQISGGIIALILVAA 223

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 55/134 (41%), Gaps = 37/134 (27%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-------FSIMIVSIIFYSMGTIIESQ 155
           S  +LL     + TVI   GQ+ F  L+DI GR         IMIV  I  +  T+  S 
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQT--TVAHSP 156

Query: 156 AVNITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           A+N   F     FY+    +G+ G   +  +I S+F+   WR                  
Sbjct: 157 AIN---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------ 195

Query: 212 GNVTSAIDANWKWG 225
           G +  A+ AN  WG
Sbjct: 196 GAIMGAVFANQAWG 209

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 99/229 (43%), Gaps = 13/229 (5%)

Query: 49  LIDPGVHNIEIYAEMYNRPIYRVAL-FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           L+D G  +   ++E+   P  +V +   +L + ++   LD  I  T      S     S 
Sbjct: 21  LVDTGEESTTSHSEL---PPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQ 77

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQ--AVNITRFAVG 165
           +S +     +  +  Q  + +LSDIFGR  ++I+S + +++G  I       N+   + G
Sbjct: 78  MSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTG 137

Query: 166 GCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWG 225
                +G  G   +  +  SD   L  R +   +  + F +    SG+V  A+    + G
Sbjct: 138 RFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGC-ASGSVLGAV---LQQG 193

Query: 226 IG-MWAFI--LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKW 271
           IG  WAF+  +P+A +   +  + +   A    +  L  E +   +LKW
Sbjct: 194 IGWRWAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKW 242

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 292 TVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQ 351
           T   G +L  F       + W +A++IV  VI  V+ L  + ++E++Y+ +PL P ++I+
Sbjct: 258 TGVLGLILFNFVWNQAPADGWNSAYLIVLLVIS-VIALIAFGIYELRYAENPLLPSEIIR 316

Query: 352 DR 353
           +R
Sbjct: 317 NR 318

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 36/146 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR---FSIMIVSIIFYSM--GTIIESQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR   + + ++ +IF ++   T+  S A+
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAI 158

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 159 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 197

Query: 214 VTSAIDANWKWGI---GMWAFILPLA 236
           +  A+ AN  WG    G+ A IL  A
Sbjct: 198 IMGAVFANQAWGQISGGIIALILVAA 223

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341
            +D IG +L    FG +++ F         W++A+IIV  V+ +   L +++++E+KY++
Sbjct: 294 SMDWIGAIL--GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAK 350

Query: 342 HPLTPWDLIQDRG 354
            PL P  +  +RG
Sbjct: 351 TPLIPKAISSNRG 363

>Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081W
           (REAL)
          Length = 588

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 15/193 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +++ ++ 
Sbjct: 104 NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 163

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 164 YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 223

Query: 203 PF-IINTWISGNVTSAID--ANWKWGIG---MWAFILPLACIPLGICMLHMRYLARKHAK 256
            F I   + S   T   D  A W+  IG   +WA I+ +  +   +     RYL      
Sbjct: 224 TFGIFLGYCSVYGTRKYDNTAQWRIPIGLCFLWALIIIIGML---LVPESPRYLIESEKH 280

Query: 257 DRLKPEFEALNKL 269
           +  +     +NK+
Sbjct: 281 EEARTSIAKVNKV 293

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/216 (20%), Positives = 88/216 (40%), Gaps = 13/216 (6%)

Query: 123 QIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
            + + R + + G  S M++SI  + +G+I+ + A ++    VG     +G +G+  +  +
Sbjct: 127 SLIWGRATSLLGFQSSMLISIFIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMI 186

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGNVTSAID--ANWKWGI-------GMWAFIL 233
           I         R + + +    F +++ I   +  A    A W+W         G  AF+ 
Sbjct: 187 IGCSLVEERNRTIVIAVIMSAFAVSSLIGPFIGGAFTTHATWRWCFWISLPVGGSAAFLF 246

Query: 234 PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITV 293
                P  + +        K  K     +F+ +    +K+   ++ F + D+IG  L   
Sbjct: 247 FFTYNPERLSITARLVRCLKLVKAIPLKQFQYVE--TYKTIVRNLVF-RFDLIGFTLNCT 303

Query: 294 FFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVL 329
                L+  T  G     WK A ++   VIG ++V+
Sbjct: 304 GICLFLLGLTF-GSEDNSWKRAFVVCFLVIGGLLVV 338

>Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072W
           (REAL)
          Length = 487

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 89/193 (46%), Gaps = 15/193 (7%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +++ ++ 
Sbjct: 3   NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 62

Query: 146 YSMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y +G II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 63  YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 122

Query: 203 PF-IINTWISGNVTSAID--ANWKWGIG---MWAFILPLACIPLGICMLHMRYLARKHAK 256
            F I   + S   T   D  A W+  IG   +WA I+ +  +   +     RYL      
Sbjct: 123 TFGIFLGYCSVYGTRKYDNTAQWRIPIGLCFLWALIIIIGML---LVPESPRYLIESEKH 179

Query: 257 DRLKPEFEALNKL 269
           +  +     +NK+
Sbjct: 180 EEARTSIAKVNKV 192

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   +IV+ + + +GT+I+  +V    ++ +G     LG  
Sbjct: 128 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCG 187

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 188 LIAILSPMLISEVSPKNMR 206

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 56/131 (42%), Gaps = 1/131 (0%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  + ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 33  HNLALPKIPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQ 92

Query: 124 IFFARLSDIF-GRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
             + +LSD+  GR    +++  F+ +G II   A N+T+FA+G     +G  G+  +  +
Sbjct: 93  PLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSI 152

Query: 183 IASDFSNLNWR 193
             SD      R
Sbjct: 153 AVSDICTAKER 163

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 82/367 (22%), Positives = 148/367 (40%), Gaps = 38/367 (10%)

Query: 123 QIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
            + + R + + G  + M +SI  + +G+I+ + A ++    VG     +G +G+  +  V
Sbjct: 110 SLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLV 169

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGI 242
           I S       R + + I    F   + I   V  A   +  W    W F + L   P+G 
Sbjct: 170 IGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVIW---RWCFWINL---PIGA 223

Query: 243 CMLHMRYLA----RKHAKDRLKPEFEALNKLK------WKSF-CIDIAF-WKLDIIGMLL 290
               + Y      R  A  R    F+++  L       W+++ C+     ++ DI+G   
Sbjct: 224 VTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVG--F 281

Query: 291 ITVFFG-CVLVPFTLAGGLKEEWKTAHIIVPEVIGWV-----VVLPLYMLWEI-----KY 339
            T   G C+L+     GG  + WK+A +I   ++G++     VV   Y+  +I       
Sbjct: 282 ATGCAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNL 341

Query: 340 SRHPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTV---LVVAVHESIKSATRITS 396
           S  P+    L+ +R               +   G  +Y+V    +V    +  +   +  
Sbjct: 342 SFRPMLVKGLLNNRFILLPNLVTCASAIAF--SGYMLYSVQFFQLVMGSSAWNAGLHLIP 399

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
           L    S++   I G I+ K  + KP +I  +S  ++  G+       SG +S  IG   L
Sbjct: 400 LV-IASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSG-NSMQIGVWIL 457

Query: 457 LGFGAGS 463
            GFG G+
Sbjct: 458 PGFGLGA 464

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/174 (23%), Positives = 79/174 (45%), Gaps = 22/174 (12%)

Query: 42  PAPSYIELIDPGVHNIE-IYAEMYNRPIYRVA---LFFSLFLIAYAYG----------LD 87
           P  SY+    P    +E +  E+ N+   +     LF S+  +  A+G          + 
Sbjct: 49  PVSSYVSHEGPPKDELEELQKEVDNQLESKSKSDLLFVSICCLMVAFGGFVFGWDTGTIS 108

Query: 88  GNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMI 140
           G +R T   + + ++     S LS V       I  +  A+G I  +RL D++GR   ++
Sbjct: 109 GFVRQTDFIRRFGSTRADGTSYLSDVRTGLMVSIFNIGCAIGGIVLSRLGDMYGRKIGLM 168

Query: 141 VSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
             ++ YS+G II+  +++   ++ +G     LG+ GI ++  ++ S+ S    R
Sbjct: 169 SVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQLR 222

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 67/160 (41%), Gaps = 12/160 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN------ITRFAVGGCFYQLGL 173
           A+G +   RL DI+GR   +I++   + +G +IE  +++      I R   G     + +
Sbjct: 130 AIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAI 189

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGM-WAFI 232
              +LI EV   +          L I    F+ +    G  T +    W+ G+G+ +A+ 
Sbjct: 190 LSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGLQFAWC 249

Query: 233 LPLACIPLGICML--HMRYLARKHAKDRLKPEFEALNKLK 270
           L   C+  G+  +    RYL  K   +  K      NKL 
Sbjct: 250 L---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLN 286

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 48/104 (46%)

Query: 62  EMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
           + +NR + +  +  SL+L ++   +D +I           + +      +     +  A 
Sbjct: 35  QEHNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAA 94

Query: 122 GQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
            Q  + R SDI GR   ++++  F+ +GT++   A N+T FA+ 
Sbjct: 95  FQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIA 138

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 77/375 (20%), Positives = 145/375 (38%), Gaps = 27/375 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + R + I G    +I++++ +  G+++ + A ++    VG     +G +G+  +
Sbjct: 94  AVLSLLWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTL 153

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIP 239
             VI     +   R L + I +  F +   +   +  A   +  W    W F + L    
Sbjct: 154 CFVIGCTMVDERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINLPIGG 210

Query: 240 LGICMLHMRYLAR-----KHAKDRLKP----EFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           L + M  + Y A+     +  K  L+     EF  L K       I+   +K D  G  L
Sbjct: 211 LAVIMFLLTYDAKNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFAL 270

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVV-----VLPLYMLWEIKYSRHPLT 345
            +      L+  T  GG K  W +  +I   V+G V+     V   ++  +    R  ++
Sbjct: 271 SSTGLVLFLLGLTF-GGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNIS 329

Query: 346 PWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
              L   R                   G     +  V   + I +++   +    + +++
Sbjct: 330 YRPLFLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVI 389

Query: 406 GTIL-----GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFG 460
             ++     G I  K+   KP +IFG    ++  GL+   + +S   S  IG L L GF 
Sbjct: 390 TNVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNS-TSSTQIGVLILPGFS 448

Query: 461 AGSFTYVTQASIQAS 475
            G   +  QAS+ ++
Sbjct: 449 LG---FALQASLMSA 460

>Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp,
           53 aa] {OFF}  YCL073C (HSP)
          Length = 53

 Score = 32.3 bits (72), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 94  FQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSII 144
           F  Y TS+YS+H   S+ +   ++++   QI F+ LSD F R  +  V+ I
Sbjct: 5   FTGYTTSAYSEH---SSQHFNPSILSEFSQITFSSLSDYFRRLELSAVATI 52

>SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P53387 Kluyveromyces lactis
           KHT2 Hexose transporter 2
          Length = 571

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 51/246 (20%), Positives = 102/246 (41%), Gaps = 39/246 (15%)

Query: 55  HNIEIYAEMYNRP--------IYRVALFFSLFLIAYAYGL------DGNIRYTFQAYATS 100
              EI AE+  +P        I  + + F  F++ +  G         + +  F  Y+ S
Sbjct: 49  EETEIVAEIPKKPASAYITVSIMCLCVAFGGFVVGWDTGTISGFVNQTDFKRRFGEYSHS 108

Query: 101 S---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAV 157
               Y  +  +  +  I  V  AVG +  ++L DI+GR   ++   I Y +G +I+  +V
Sbjct: 109 KDEYYLSNVRVGLIVSIFNVGCAVGGLVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSV 168

Query: 158 NI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALFIPALPFIINT 208
           +   ++ +G     LG+ G+ ++  ++ S+ +  +        W+L+  F   L +  N 
Sbjct: 169 DKWYQYFIGRIVSGLGVGGVCVLAPMLISETAPKHLRGTLLACWQLMVTFAIFLGYCANY 228

Query: 209 WISGNVTSAIDANWKWGIGM---WAFILPLACIPLGICML--HMRYLARKHAKDRLKPEF 263
              G  +      W+  +G+   WA I+      +G+C +    R+L +    +  K   
Sbjct: 229 ---GTKSYDNSVQWRVPLGLCFAWAIIM-----VVGMCFVPESPRFLVKVGRVEDAKRSV 280

Query: 264 EALNKL 269
              NK+
Sbjct: 281 AKSNKI 286

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 54/121 (44%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  SL+L      +DG I  T      S + + SL++ V     +     Q  + + SD+
Sbjct: 53  VLLSLWLNTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDL 112

Query: 133 FGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
            GR   ++ + + + +G ++   A  +   A+      +G +G+  +  +I SD + L+ 
Sbjct: 113 LGRKKCLLFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQ 172

Query: 193 R 193
           R
Sbjct: 173 R 173

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/142 (19%), Positives = 59/142 (41%), Gaps = 5/142 (3%)

Query: 29  AKVDVKPTLTTSSPAPSYIEL-----IDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYA 83
           A  D +  L   +  P  + L      +    ++E     +N  + ++ + FSL++ ++ 
Sbjct: 4   ATADERTNLLPDTLDPQSLSLNLEDEFNRKNSSLEEEYHKHNLDLPKLPIVFSLWMGSFL 63

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSI 143
             LDG I           + +      +     +     Q  + +LSDI GR   ++V+ 
Sbjct: 64  GALDGTIVANIMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAH 123

Query: 144 IFYSMGTIIESQAVNITRFAVG 165
            F+ +G ++   A N+T F++ 
Sbjct: 124 TFFCLGCLLTCFARNVTEFSIA 145

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 50/108 (46%)

Query: 86  LDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIF 145
           LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   ++   I 
Sbjct: 117 LDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIV 176

Query: 146 YSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +++G  +   + +I + A+      +G +G   +  +I SD + L+ R
Sbjct: 177 FAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSER 224

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 67/168 (39%), Gaps = 18/168 (10%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   +I++ + + +G +IE  +++      I R   G  
Sbjct: 124 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIG 183

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G+ T +    W+ G+G
Sbjct: 184 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLG 243

Query: 228 M---WAFILPLACIPLGICML---HMRYLARKHAKDRLKPEFEALNKL 269
           +   W   +      +G  M      R+L  K   +  K      NKL
Sbjct: 244 LQFAWCLFM------VGGMMFVPESPRFLIEKGKLEEAKRSVATSNKL 285

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   +IV+ + +  GTII+  ++    ++ +G     LG  
Sbjct: 131 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCG 190

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 191 LIAILSPMLISEVSPKNMR 209

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 32  DVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVA-LFFSLFLIAYAYGLDGNI 90
           +++P L   SP P   +L D   H+  +       P+  V  + F+LF+ +Y   LD  I
Sbjct: 4   ELQPLL---SPVP---QLPDQAAHDKNV------EPLRDVNWIVFALFVGSYLAALDTTI 51

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGT 150
             T      S     + +S +     +  +  Q  + +LSD+FGR  ++I S + +  G 
Sbjct: 52  VTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGC 111

Query: 151 II 152
           I+
Sbjct: 112 IL 113

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 35.4 bits (80), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCF 168
           S V+ +  + A  G I     S++ GR + +++S  FY+MG II + A+N+     G  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

>NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON}
           Anc_8.858
          Length = 571

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 54/129 (41%), Gaps = 33/129 (25%)

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII-----ESQAVNIT 160
           +LL     + TVI   GQ+ F  L+D+ GR  I  + +I   +  I+     ES+A+N  
Sbjct: 90  TLLKVSTSVGTVI---GQLGFGTLADVVGRKKIYGLELIIMIITAILQCTTGESKAINFV 146

Query: 161 RFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTS 216
                  FY+    +G+ G   +  +I S+F+   WR                  G +  
Sbjct: 147 AILT---FYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GAIMG 185

Query: 217 AIDANWKWG 225
           A+ AN  WG
Sbjct: 186 AVFANQAWG 194

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 79/183 (43%), Gaps = 28/183 (15%)

Query: 107 LLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-SQAVNITRFAVG 165
           LL  +  I  V  A+G +  A++ D  GR   + VS++ Y  G +IE ++  +  +F +G
Sbjct: 106 LLGLIIGIFNVACALGGLTLAKVGDFKGRKVGIAVSLLVYVFGVVIELAKPTHWGQFFIG 165

Query: 166 GCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWG 225
             F  +G+  + +++ +  ++ S +  R   + +    F +N  +   V + ++   K G
Sbjct: 166 RIFTGVGVGSLTVLVPMYVAEISPVRIRGSMVVL----FQLNITVGVLVGNFVNYGCKKG 221

Query: 226 IG----------------MWAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEALN 267
            G                MWA     A + LG+ M+     YLA K      +  F  +N
Sbjct: 222 FGDILSKKHWQVPIALGPMWA-----AVVLLGLVMIPESSHYLASKDKIKEAERSFAVMN 276

Query: 268 KLK 270
            L+
Sbjct: 277 ALE 279

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 78/187 (41%), Gaps = 23/187 (12%)

Query: 25  KEVGAKVDVKPTLTTS-----SPAPSYIELIDPGVHNIEIY-AEMYNRPIYRVALFFSLF 78
           K V      +P+ + S     +P+    E  + G +++ I  AEM  +P         L 
Sbjct: 15  KRVNNDFQSQPSESGSHSIMEAPSNKGEEEENKGFNDVNIPPAEMPKKPASEYVTVSILC 74

Query: 79  LI----AYAYGLD-GNI-----------RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVG 122
           L+     Y YG D G I           R+  Q    + Y        +  I  +  A+G
Sbjct: 75  LMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNIGCAIG 134

Query: 123 QIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILE 181
            + F+RL DI+GR   ++   I Y +G +I   +++   ++ +G     +G+ GI +   
Sbjct: 135 GLAFSRLGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGIAVYSP 194

Query: 182 VIASDFS 188
           ++ S+ S
Sbjct: 195 LLISEVS 201

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 56/126 (44%), Gaps = 13/126 (10%)

Query: 81  AYAYGLDGNIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D      F+A       + ++S S    LS V       +  V  A+G  F  R
Sbjct: 74  GYISGWDSGTIGGFEAQTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGSFFLGR 133

Query: 129 LSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDF 187
           L DI+GR   +IV+   + +GT+I+  +V    ++ +G     LG   I ++  ++ S+ 
Sbjct: 134 LGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLISEV 193

Query: 188 SNLNWR 193
           S  N R
Sbjct: 194 SPKNMR 199

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 59/146 (40%), Gaps = 40/146 (27%)

Query: 105 HSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-------FSIMIVSIIFYSMGTIIESQAV 157
            +LL     + TVI   GQ  F  L+DI GR         IMIV  I  +  T+  S A+
Sbjct: 104 QTLLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQT--TVAHSPAI 158

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 159 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 197

Query: 214 VTSAIDANWKWGI---GMWAFILPLA 236
           +  A+ AN  WG    G+ A IL  A
Sbjct: 198 IMGAVFANQAWGQISGGIIALILVAA 223

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 35.0 bits (79), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/101 (20%), Positives = 47/101 (46%)

Query: 65  NRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQI 124
           N  + +  +  SL+L ++   LDG +         + +++      +     +     Q 
Sbjct: 36  NMALPKGPILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQP 95

Query: 125 FFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
            + +LSDI GR   +I +  F+++G ++   A N+T+F++ 
Sbjct: 96  LYGKLSDITGRKVAVITAHFFFALGCLLTCFAQNVTQFSIA 136

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 55/132 (41%), Gaps = 33/132 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I   + TI++     S  +
Sbjct: 136 STATLLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGI 192

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 193 N---FVAVLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 231

Query: 214 VTSAIDANWKWG 225
           +  A+ AN  WG
Sbjct: 232 IMGAVFANQAWG 243

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 71  VALFFSLFLIAYAYGLD-GNIRYTFQAYATS-----SYSQHSLLSTVNCIKTVIAAVGQI 124
           V L F   L  + +G D G I    Q+  T      +Y     +++   +  +IAA+G  
Sbjct: 67  VMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGAG 126

Query: 125 FFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL 173
             A   D+FGR   ++ S I + +GT+++  A N  +  VG      G+
Sbjct: 127 ICA---DLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGI 172

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 54/132 (40%), Gaps = 33/132 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I     TI++     S  +
Sbjct: 103 STQTLLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQTTIGRSPGI 159

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 160 N---FPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 198

Query: 214 VTSAIDANWKWG 225
           +  A+ AN  WG
Sbjct: 199 IMGAVFANQAWG 210

>CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {ON}
           highly similar to uniprot|P38695 Saccharomyces
           cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3
          Length = 588

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 77/189 (40%), Gaps = 16/189 (8%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGT 150
           R+  Q    + Y  +     +  I  +  A+G I  ++L DI+GR   ++  ++ Y++G 
Sbjct: 116 RFGQQRSDGTYYLSNVRTGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGI 175

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPF 204
           +I+  +++   ++ +G     LG+ GI ++  ++ S+ S    R        L I    F
Sbjct: 176 VIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIF 235

Query: 205 IINTWISGNVTSAIDANWKWGIGM---WAF--ILPLACIPLGICMLHMRYLARKHAKDRL 259
           +      G    +    W+  +G+   WA   I  + C+P        RYL      +  
Sbjct: 236 LGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIFGVMCVP-----ESPRYLVEVGKLEEA 290

Query: 260 KPEFEALNK 268
           K      NK
Sbjct: 291 KRSLARANK 299

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 46/93 (49%), Gaps = 10/93 (10%)

Query: 71  VALFFSLFLIAYAYGLDGNIR--YTFQAYATSSYSQHS--------LLSTVNCIKTVIAA 120
           +A+ F+ F + +  G  G +    +FQ    +SY            LL  +  I  +  A
Sbjct: 61  IAIAFAGFTLGWDIGTIGGMTSMESFQNRFGTSYDSQRGVQYFPDLLLGLIISIFNIGCA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE 153
           VG +  A+L+D FGR + + V++I Y +G +I+
Sbjct: 121 VGSVTLAKLADWFGRKTGLYVTVIIYVIGLLIQ 153

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 120 AVGQIFFARLSDIFG-RFSIMIVSIIFYSMGTIIE-SQAVNITRFAVGGCFYQLGLTGII 177
           AVG IF ++ +D++G R  +MIV+++ Y +G +++ S      ++ +G     LG+ GI 
Sbjct: 111 AVGGIFLSKFADMYGRRIGLMIVTLV-YVIGIVVQISSTDKWYQYCIGRVISGLGVGGIA 169

Query: 178 LILEVIASDFSNLNWR 193
           ++  ++ S+ S  + R
Sbjct: 170 VLSPMLISETSPKHLR 185

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 54/134 (40%), Gaps = 37/134 (27%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII-----ESQAV 157
           S  +LL     + TV    GQ+ F  L+D+ GR  I  + +I   + TI+     +S AV
Sbjct: 90  STTTLLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAV 146

Query: 158 NIT------RFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           N        R  +G     +G+ G   +  +I S+FS   WR                  
Sbjct: 147 NFVAILTTYRIVMG-----IGIGGDYPLSSIITSEFSTTKWR------------------ 183

Query: 212 GNVTSAIDANWKWG 225
           G +  A+ AN  WG
Sbjct: 184 GAIMGAVFANQAWG 197

>Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON}
           (55476..57182) [1707 nt, 569 aa]
          Length = 568

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 55/132 (41%), Gaps = 33/132 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I     TI++     S AV
Sbjct: 103 STQTLLKVSTSVGTVI---GQVGFGIIADIVGRKKIYGLELIIVITATILQCTTGHSPAV 159

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I ++F+   WR                  G 
Sbjct: 160 N---FPAILTFYRIVMGIGIGGDYPLSSIITAEFATTKWR------------------GA 198

Query: 214 VTSAIDANWKWG 225
           +  A+ AN  WG
Sbjct: 199 IMGAVFANQGWG 210

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G + F+RL DI+GR   ++   + Y +G II   +++   ++ +G     +G+ GI +
Sbjct: 131 AIGGLLFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMGVGGIAV 190

Query: 179 ILEVIASDFS 188
              ++ S+ S
Sbjct: 191 YSPLLISEVS 200

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 38/202 (18%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           GN     Q Y  S      ++S  N    +  A+G +   RL D++GR   ++  I+ Y 
Sbjct: 102 GNFDVGEQKYVLSDVRTGLIVSIFN----IGCAIGGLTLGRLGDMYGRRLGLMAVILVYV 157

Query: 148 MGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFII 206
           +G II+  + N   ++ +G     LG+ GI ++   + S+ +  + R   +    L   +
Sbjct: 158 VGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITL 217

Query: 207 NTWIS-----GNVTSAIDANWKWGIGMWAFILPLACIPLGICML--------------HM 247
             ++      G  T +    WK              +PLG+C L                
Sbjct: 218 GIFMGYCTNYGTKTYSNAVQWK--------------LPLGLCFLWAIFMIAGMIFVPESP 263

Query: 248 RYLARKHAKDRLKPEFEALNKL 269
           RYL  K   +  K      NKL
Sbjct: 264 RYLIEKGNFEEAKRSIAKSNKL 285

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWE 336
           ++  +K+D IG  +    FG +L  F         W +A+IIV  ++  VV L  ++ +E
Sbjct: 240 NVNEYKMDWIGSAIGV--FGLILFNFVWNQAPIAGWGSAYIIVLLIVA-VVALIAFITYE 296

Query: 337 IKYSRHPLTPWDLIQDR 353
           I++++ PL P  ++ +R
Sbjct: 297 IRFAKQPLLPHSVLFNR 313

>ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON}
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123C PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
           regulated by Pho4p and Spt7p mutation confers resistance
           to arsenate exit from the ER during maturation requires
           Pho86p
          Length = 604

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 87/221 (39%), Gaps = 44/221 (19%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+   + ++ Y Y  DGNI            S  +LL     + TVI   GQ  F  L+D
Sbjct: 77  AINLGVSMMTYVYWKDGNI----------PSSSETLLKVSTSVGTVI---GQFGFGILAD 123

Query: 132 IFGRFSIMIVSIIFYSMGTIIE-----SQAVNITRFAVGGCFYQLGLTGIIL----ILEV 182
           + GR  I  V +I      I++     S AVN T       F+++ +   I     +  +
Sbjct: 124 VLGRKKIYGVELIIMIAACIMQCVIGASPAVNFTAIMT---FFRIIMGIGIGGDYPLSSI 180

Query: 183 IASDFSNLNWR---LLALF-----------IPALPFI---INTWISGNVTSAIDANWKWG 225
           I S+FS   WR   + A+F           I AL  +    +   +    S    + K  
Sbjct: 181 ITSEFSTTKWRGAIMSAVFANQAFGQVAAGIVALILVEGYKDDLKAAKSGSTCGPSCKRA 240

Query: 226 IG-MWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEA 265
              MW  ++ + C+P G   L+ R    +  +  L  EF+A
Sbjct: 241 CDQMWRILIGMGCVP-GCIALYFRLTIPESPRYTLDVEFDA 280

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 50/109 (45%)

Query: 85  GLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSII 144
            LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   ++   +
Sbjct: 74  ALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEV 133

Query: 145 FYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +++G ++ + A  I + A+      +G +G   +  ++ +D   L+ R
Sbjct: 134 IFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVR 182

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 46/102 (45%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           +N  + ++ +  SL+L ++   LDG I           +S+      +     +     Q
Sbjct: 28  HNLSLPKLPILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQ 87

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
             + +LSD+ GR   ++++  F  +G ++   A N+T FAV 
Sbjct: 88  PLYGKLSDVTGRKFALLMAYFFLVIGCLLTCLARNVTEFAVA 129

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 21/102 (20%), Positives = 44/102 (43%)

Query: 64  YNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           YN  + +  +  SL+L ++   +D  I           + +      +     +     Q
Sbjct: 27  YNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQ 86

Query: 124 IFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
             + +LSDI GR   ++ ++ F+ +G  + S + NI +FA+ 
Sbjct: 87  PLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNIKQFAIA 128

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 58/133 (43%), Gaps = 2/133 (1%)

Query: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           +++ +R I+ ++   S+FL  +   LD  I  T   +  S  +    +S V        A
Sbjct: 73  SDLMSRRIFMISA--SMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCA 130

Query: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           + Q  F + SD+FGR  ++I S + +  G +    +  I    +G     +G  G+  + 
Sbjct: 131 IFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTSMC 190

Query: 181 EVIASDFSNLNWR 193
            +I +D   L  R
Sbjct: 191 TIIINDIVPLRNR 203

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 49/121 (40%), Gaps = 5/121 (4%)

Query: 125 FFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIA 184
           F   L+D  GR  +++ SI+ Y    I  + + N T+  V  C    G++ +I I   I 
Sbjct: 155 FMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGIC 214

Query: 185 SDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICM 244
            D +    R   +   +   +I +     + + + + W W    W        I  GIC+
Sbjct: 215 GDITTRAERGAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWFLT-----IGSGICL 269

Query: 245 L 245
           +
Sbjct: 270 M 270

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWE 336
           ++  + +D IG +L  +  G +L  F    G    W+ A+IIV  ++  V+ L  + ++E
Sbjct: 266 NVNGFTMDWIGSVLGVI--GLILFNFVWNQGPIVGWEKAYIIVLLIVS-VIFLIAFFVYE 322

Query: 337 IKYSRHPLTPWDLIQD 352
           IKY++ PL P  + Q+
Sbjct: 323 IKYAKVPLLPKAVTQN 338

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 5/153 (3%)

Query: 41  SPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATS 100
           S  PS+     P     E   + +  P     +  SL+L      +DG I  T      S
Sbjct: 23  STVPSF-----PDTGEEEDLEKDFRDPNTFPYILLSLWLNTSICAVDGTIISTTMNEIAS 77

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNIT 160
            + + S ++ V     +     Q  + + SD+ GR   ++ + + + +G ++   A  I 
Sbjct: 78  IFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMCGAARTIE 137

Query: 161 RFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
              V      +G +G+  +  +I SD + L+ R
Sbjct: 138 ELIVARAICGVGGSGLGAMCNIILSDLAPLSQR 170

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A G +   +L DI+GR   +++ I+ Y +GTII+  A +   ++ +G   Y  G+ G+ +
Sbjct: 129 AFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSV 188

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 189 LAPMLISE 196

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   +I++ I + +GTII+  +V    ++ +G     LG  GII 
Sbjct: 131 AIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLG-CGIIA 189

Query: 179 I 179
           I
Sbjct: 190 I 190

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 312 WKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDR 353
           W  A+IIV  +I  V+ L L+ ++EI +++ PL P  +++DR
Sbjct: 303 WNQAYIIVLLIIS-VLFLVLFGVYEIHFAKSPLLPQAVMKDR 343

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTI 151
           + ++S S    LS V       +  V  A+G  F  RL DI+GR   +IV+ + + +G++
Sbjct: 102 FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGCFFLGRLGDIYGRRIGLIVASVIFIIGSV 161

Query: 152 IESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           I+  +V    ++ +G     +G   I ++  ++ S+ S  N R
Sbjct: 162 IQIASVKAWYQYMIGRIVAGIGCGLIAILSPMLISEVSPKNMR 204

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 100 SSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI 159
           S Y  +  +  +  I  V AA+G +  AR  D++GR   +I  +  Y++G +I+  +++ 
Sbjct: 125 SHYLSNVRMGLLVSIFNVGAAIGGVMLARTGDMWGRRLGLITVVSIYTVGIVIQIASIDK 184

Query: 160 -TRFAVGGCFYQLGLTGIILILEVIASD 186
             ++ +G     LG+ GI ++  ++ S+
Sbjct: 185 WFQYFIGRIISGLGVGGIAVLAPMLISE 212

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 71/187 (37%), Gaps = 39/187 (20%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G I  +R+ D++GR   +I  +I Y +G +I+  + +   ++ +G     LG
Sbjct: 122 IFNVGCAIGGIILSRIGDVYGRRVGLITVVIIYVVGILIQICSFDKWYQYFIGRIISGLG 181

Query: 173 LTGI-----ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIG 227
           + GI     +LI EV   +          L I    F+      G  T +    W+    
Sbjct: 182 VGGISVLSPMLISEVSPKEMRGAMVSSYQLMITLGIFLGYCCNYGTKTYSDSTQWR---- 237

Query: 228 MWAFILPLACIPLGIC----------MLHM----RYLARKHAKDRLKPEFEALNKLKWKS 273
                     +PLG+C          ML +    RYL      D  +     +NK     
Sbjct: 238 ----------VPLGLCFAWALFMIGGMLFVPESPRYLIEAGKHDEARRSLARVNKCP--- 284

Query: 274 FCIDIAF 280
             ID AF
Sbjct: 285 --IDSAF 289

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 25/39 (64%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN 158
           A+G  F  RL D++GR   +IV+ I + +GT+I+  +V 
Sbjct: 60  AIGCFFLGRLGDMYGRRIAIIVASIIFVVGTVIQIASVK 98

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   +IV+ I + +GT+I+  +V    ++ +G     LG  GII 
Sbjct: 126 AIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLG-CGIIA 184

Query: 179 I 179
           I
Sbjct: 185 I 185

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/111 (19%), Positives = 48/111 (43%)

Query: 55  HNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCI 114
            ++E     YN  + ++ +  SL+L ++   LDG I           + +      +   
Sbjct: 17  ESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATS 76

Query: 115 KTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVG 165
             +     Q  + +LSDI GR   ++ +  F+ +G ++   A ++ +FA+ 
Sbjct: 77  FLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALA 127

>KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.858
           YML123C
          Length = 586

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 62/149 (41%), Gaps = 36/149 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I     T+++     S  +
Sbjct: 96  STATLLKVSTSVGTVI---GQLGFGILADIVGRKKIYGLELIVMIFCTVLQCTLGHSPGI 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           N   F     FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 153 N---FVAVLTFYRVVMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 191

Query: 214 VTSAIDANWKWG---IGMWAFILPLACIP 239
           + SA+ AN  +G    G+ A IL  A  P
Sbjct: 192 IMSAVFANQAFGQIAAGIVALILVAAYKP 220

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 43/195 (22%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 95  QAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMG 149
           Q + T +      LST+       I  +  A+G +F  +L D++GR   +I     + +G
Sbjct: 105 QRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVG 164

Query: 150 TIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
            II+  +V+      I R   G     + +   +LI EV   +          L I    
Sbjct: 165 VIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLISEVAPKELRGAMVSCYQLMITFGI 224

Query: 204 FIINTWISGNVTSAIDANWKWGIG---MWAFIL--PLACIPLGICMLHMRYLARKHAKDR 258
           F+ N    G  +      W+  +G   +W  I+   +  +P        RYL +++  + 
Sbjct: 225 FLGNCCNYGTKSYQNSKQWRIAVGLQFLWCIIMVSGMTFVP-----ESPRYLVQQNMFEE 279

Query: 259 LKPEFEALNKLKWKS 273
            K      NKL  +S
Sbjct: 280 AKESIAISNKLSKES 294

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/129 (18%), Positives = 52/129 (40%), Gaps = 5/129 (3%)

Query: 117 VIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGI 176
           +  A+       L+D  GR  +++ SI+ Y    I  ++  N ++     C    G++ +
Sbjct: 146 IFQALSPTLMGGLADSLGRRPVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPV 205

Query: 177 ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLA 236
           I +   I  D +    R   + + +   ++ T     + + + + W W    W  +    
Sbjct: 206 IAVNSGIMGDVTTKAERGGYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWFLV---- 261

Query: 237 CIPLGICML 245
            I  GIC++
Sbjct: 262 -IGSGICLI 269

>Kwal_33.14268 s33 complement(593529..595238) [1710 bp, 569 aa] {ON}
           YML123C (PHO84) - 1:1 [contig 104] FULL
          Length = 569

 Score = 32.3 bits (72), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 73/170 (42%), Gaps = 29/170 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE---SQAVNI 159
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I   M T+++    +A  +
Sbjct: 95  STSTLLKVSTSVGTVI---GQVGFGVMADVVGRKKIYGLELIIMIMATVLQCTIGKAPGV 151

Query: 160 TRFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWR--------------LLALFIPA 201
           +  AV   FY++ +   I     +  +I S+FS   WR               +A  I A
Sbjct: 152 SFVAVL-TFYRIIMGIGIGGDYPLSSIITSEFSTTKWRGAMMGAVFANQAFGQIAAGIVA 210

Query: 202 LPFII---NTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMR 248
           L  ++   +  I     +   A  K    MW  ++ L C+P G+  L+ R
Sbjct: 211 LVLVVAYKSDLIDATNGNCGPACAKACDQMWRILVGLGCVP-GVFALYFR 259

>AFR442C Chr6 complement(1234193..1235884) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML123C
           (PHO84)
          Length = 563

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 36/146 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE-----SQAV 157
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  + +I   + T+++     S A+
Sbjct: 96  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKRIYGLELILMILATVLQCMIGKSPAI 152

Query: 158 NITRFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWRLLALFIPALPFIINTWISGN 213
           +   F     FY++ +   I     +  +I S+FS   WR                  G 
Sbjct: 153 D---FVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 191

Query: 214 VTSAIDANWKWGI---GMWAFILPLA 236
           +  A+ AN  WG    G+ A IL  A
Sbjct: 192 IMGAVFANQAWGQITGGILALILVAA 217

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   ++  I  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 SMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            +G +I+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   ++  I  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 SMGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            +G +I+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>SAKL0A07480g Chr1 complement(658699..660420) [1722 bp, 573 aa] {ON}
           similar to uniprot|P38358 Saccharomyces cerevisiae
           YBR293W VBA2 Permease of basic amino acids in the
           vacuolar membrane
          Length = 573

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 86/430 (20%), Positives = 165/430 (38%), Gaps = 46/430 (10%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIA 81
           +L  +VG+ VD       SS  P+     +P V   + + + Y       ALF ++FL  
Sbjct: 8   LLSSKVGSSVDY------SSVPPTPRGNFEPNVQ--KPWIDRYRIVFIETALFANVFL-- 57

Query: 82  YAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIV 141
              GLDG I  +      + +    + + +     V     Q  +   SD  GR   +  
Sbjct: 58  --SGLDGTITASTYQLIGNEFDNFEISNWITTAYLVATTSFQPLYGSFSDTLGRRHCLFF 115

Query: 142 SIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPA 201
           +   +++G +    A  I           +G  G+I +  ++ SD      R +      
Sbjct: 116 ANTVFALGCLGCGLAPGILSLIFMRALTGIGGGGLITLSTIVNSDIIPPESRGIYQAFQN 175

Query: 202 LPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKP 261
           +   I   I  +   A+ +   W    W F+L    +P+ +    M Y+  ++ K  +  
Sbjct: 176 VLLGIGAVIGASTGGAVASYLGW---RWCFLLQ---VPVSVGGTIMAYMFLENQKGFVSE 229

Query: 262 EFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPE 321
              +   LK +       F K+D+ G LL+ V     L+  T+   +      +  +  E
Sbjct: 230 SESSGQLLKNR-------FSKIDLKGSLLLIVGLASQLMYLTVNSSMASSG--SQWLSKE 280

Query: 322 VIGWVVVLPLYMLWEIKYSR----HPLTPWDLIQDRGXXXXXXXXXXXXXXWYMQGDYMY 377
            IG +++  L ++  I   R    +P+ P  L+                   Y    Y++
Sbjct: 281 SIGLILLTVLSLVMFIHTERTTQANPIIPTKLLSQSHSTMVLVISVLVGFVSYA---YLF 337

Query: 378 TV---LVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSF 434
           T+     + V +S   A    ++ SF + I G I G + +++ +T PF++        SF
Sbjct: 338 TLPLFFQIVVGDSAARAGFRLAIPSFCTPIGGLITG-LSMRIPKTLPFLL--------SF 388

Query: 435 GLLVHYRGDS 444
           G+++   G++
Sbjct: 389 GMVLMMIGNA 398

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 29/120 (24%), Positives = 53/120 (44%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S++L  +   LD  I  T  A   S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 100 SMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGR 159

Query: 136 FSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             ++    + + +G +I   A +     +G     +G  GI  +  +  SD   L  R L
Sbjct: 160 KIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRAL 219

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 23/37 (62%)

Query: 122 GQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN 158
           G I    LS+ FGR   +++S IFY++G I+ + A N
Sbjct: 153 GSILLTPLSETFGRKKALVMSCIFYTVGAIVCAAAGN 189

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRF 162
           +  L+ ++ CI     A+G I F++L D +GR   +++  I Y +G +I   +++   ++
Sbjct: 103 RTGLIVSIFCIG---CAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQY 159

Query: 163 AVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +G     LG+ GI +   ++ S+ S  + R
Sbjct: 160 FIGRIIAGLGVGGIAVYSPLLISEVSPKHLR 190

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGT 150
           R+  +    S Y     +  +  I  +  A+G +F  RL D  GR   ++V++  Y +G 
Sbjct: 79  RFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFLGRLGDTIGRRKGIVVAVSIYMVGI 138

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +I+  +V    ++ +G     LG   I ++  ++ S+ S  + R
Sbjct: 139 VIQIASVKKWFQYLIGRIISGLGAGCIAVLSPMLISEVSPKHLR 182

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSR 341
           K+D IG  +  V  G +L  F       + W  A+IIV  VI  V+++  + ++EI Y+ 
Sbjct: 273 KMDWIGSAVGVV--GLLLFSFVWNQAPMDGWDKAYIIVLLVIS-VILIIAFFIYEINYAE 329

Query: 342 HPLTPWDLIQDR 353
            PL P  +  +R
Sbjct: 330 VPLLPKAITGNR 341

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 30.8 bits (68), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWI 431
            VIVGT++GF++  + R     +FG+SCWI
Sbjct: 94  GVIVGTVMGFLVGTIYRAG---LFGMSCWI 120

>TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858
           YML123C
          Length = 581

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI--T 160
           S ++LL     + TVI   GQ+ F  ++DI GR  I  V +I     TI++  A +    
Sbjct: 99  SSNTLLKVSTSVGTVI---GQLGFGMMADIIGRKKIYGVELIIMIAATILQCTAGHAPGV 155

Query: 161 RFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWR 193
            F     FY++ +   I     +  +I S+FS   WR
Sbjct: 156 NFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 192

>KNAG0A03790 Chr1 (496954..498321) [1368 bp, 455 aa] {ON} Anc_8.521
           YBR207W
          Length = 455

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 32/61 (52%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRF 162
           S+H     ++ + ++I +V  +FF R+  +  +F + + SII+   G ++  QA     F
Sbjct: 150 SEHYYEGILSIVASLIISVMGLFFLRMGKLREKFRVKLGSIIYSESGNMLRGQADKTMSF 209

Query: 163 A 163
           +
Sbjct: 210 S 210

>TBLA0D05810 Chr4 complement(1441639..1443363) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 65/160 (40%), Gaps = 10/160 (6%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN------ITRFAVGGCFYQLG 172
            A+G +   RL DI+GR   +I++   + +G +IE  +++      I R   G     + 
Sbjct: 129 CAIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIA 188

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFI 232
           +   +LI EV   +          + I    F+ +    G+   +  A W+ G+G+  F 
Sbjct: 189 ILSPMLISEVSPKEVRGGMVSCFQMMITLGIFLGDCTEYGSKEYSNSAQWRVGLGL-QFA 247

Query: 233 LPLACIPLGICMLHMR--YLARKHAKDRLKPEFEALNKLK 270
             L C+  G+  +     YL  K   +  K      NKL 
Sbjct: 248 WSL-CMVAGMLFVPESPIYLVEKGKIEEAKRSVAISNKLN 286

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +  ++L DIFGR   ++  +  Y +GTII+  A +   ++ +G   Y  G+ G+ +
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSV 185

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 186 LAPMLISE 193

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 78/185 (42%), Gaps = 14/185 (7%)

Query: 98  ATSSYSQHSLLSTVN----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIE 153
           +T+ Y +H L          I  +  A+G +    + DI+GR   +I++ I +  G +IE
Sbjct: 101 STNKYGEHYLSKARTGLLVSIFNIGCAIGSVTLGNIGDIYGRRLGLIIATIIFVAGVVIE 160

Query: 154 SQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPFIIN 207
             +++   ++ +G     +G+  ++++  ++ S+ S    R        L I    F+ +
Sbjct: 161 IASIDKWYQYFIGRIISGVGMGVVVILSPMLISEVSPKELRGAMVSSFQLMITLGMFLGD 220

Query: 208 TWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEA 265
               G    +    W+ G+G+  F   L C+  G+  +    R+L  K   +  K     
Sbjct: 221 CTEYGTKKYSNSTQWRVGLGL-QFAWSL-CMVGGMLFVPESPRFLVEKGKIEEAKRSVAI 278

Query: 266 LNKLK 270
            NKL 
Sbjct: 279 SNKLN 283

>Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON}
           (34471..36069) [1599 nt, 533 aa]
          Length = 532

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIES-QAVNITRFAVGGCFYQLGLTGII 177
           +A+G +  A+L D+FGR + +  ++ FY++G  I+     N  +F +G  F  L +  I 
Sbjct: 113 SAIGGLTLAKLGDLFGRKAGLFTALGFYNIGLFIQLINDHNWYQFFIGRIFTGLAVGSIA 172

Query: 178 LILEVIASDFSNLNWR 193
           +++ +  S+ + L  R
Sbjct: 173 VLVPMFISESAPLKIR 188

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 88/205 (42%), Gaps = 23/205 (11%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIA-AVGQIFFARLSD 131
           +  S+ +IA AYG        F        SQ   +S + C   VI  ++G + ++ +SD
Sbjct: 201 ILLSILVIAVAYGSACITGGLFTVSDKFHVSQE--VSILTCSLMVIGFSLGPLIWSPVSD 258

Query: 132 IFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGL---TGIILILEVIASDF- 187
           +FGR     VS+  Y +  I  + A NI    V  C +  G+   +G+ L+   IA  F 
Sbjct: 259 LFGRRVAYFVSLGLYVIFNIPCALAPNIGCLLV--CRFLCGVWSSSGLCLVGGSIADMFP 316

Query: 188 SNLNWRLLALFI------PALPFIINTWISGNVTSAID----ANWKWGIGMWAFILPLAC 237
                R +A F       P    ++N +IS + T  +D     N  +   MW   L +AC
Sbjct: 317 PETRGRAIAFFAYAPYCGPVFGPLVNGFISVS-THRMDLIFWVNMAFAGVMW---LVVAC 372

Query: 238 IPLGICMLHMRYLARKHAKDRLKPE 262
           IP     + ++  A K  ++   P+
Sbjct: 373 IPETFAPVILKRRAAKLRRETGNPK 397

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  ++G  F  RL D++GR   +I++   + +GTII+  +V    ++ +G     +G  
Sbjct: 117 NVGCSIGSFFLGRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCG 176

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  + R
Sbjct: 177 VIAMLSPMLISEVSPKHLR 195

>SAKL0H10538g Chr8 (905094..906374) [1281 bp, 426 aa] {ON} similar
           to uniprot|P38310 Saccharomyces cerevisiae YBR207W FTH1
           Putative high affinity iron transporter involved in
           transport of intravacuolar stores of iron forms complex
           with Fet5p expression is regulated by iron proposed to
           play indirect role in endocytosis
          Length = 426

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNIT 160
           S S+H     ++ I +VI +V  +FF R+  +  +F I + +II+   G +++       
Sbjct: 124 SMSEHYYEGVLSIIASVIISVMGLFFLRMGKLREKFRIKLAAIIYSDHGKVLQENGQKAV 183

Query: 161 RFA 163
           +++
Sbjct: 184 KWS 186

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVN 158
           S V+ +  + A  G I     S+ FGR   + +S +FY++G I+ + A N
Sbjct: 140 SLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIVCAAASN 189

>KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P32466 Saccharomyces cerevisiae
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily expression is induced in
           low or high glucose conditions
          Length = 567

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I   +L +++GR   + + +I YS+G II+  +++   ++ +G     LG+  I +
Sbjct: 125 AIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASIDKWYQYFIGRIISGLGVGAITI 184

Query: 179 ILEVIASDFSNLNWR 193
           +  ++ S+ S  + R
Sbjct: 185 LSPMLISEVSPKHLR 199

>KLLA0E20945g Chr5 (1870154..1871740) [1587 bp, 528 aa] {ON} weakly
           similar to uniprot|P42833 Saccharomyces cerevisiae
           YNL318C, HXT14 protein with similarity to hexose
           transporter family members, expression is induced in low
           glucose and repressed in high glucose; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studie
          Length = 528

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 93  TFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTII 152
            F + + + Y    L+  +  I  +  A+G +F  +++DI GR   +  +I  YS+GT+I
Sbjct: 94  NFDSSSNTHYFPKLLIGLIVSIFNISCALGGLFLVKIADINGRKPGIYAAITIYSLGTLI 153

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 50/117 (42%), Gaps = 6/117 (5%)

Query: 33  VKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRY 92
           + P L+     P++    D    N  +  E   R I  +ALF   FL A    LD  I  
Sbjct: 9   LAPCLSPIPEIPTFDSSYDAAA-NHSVLTETKTR-IIVIALFLGSFLSA----LDTTIVS 62

Query: 93  TFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMG 149
           T      S     S +S +     +  +  Q  + +LSDIFGR  +++ S + +++G
Sbjct: 63  TLLPTIASDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIG 119

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   +I+ +  Y +G +I+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWR 193
           ++  ++ S+ S  + R
Sbjct: 180 VLSPMLISEVSPKHLR 195

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   +++ ++ Y  G +I+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLLIVLVIYIAGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWR 193
           ++  ++ S+ S  + R
Sbjct: 180 VLSPMLISEVSPKHLR 195

>Suva_4.461 Chr4 (805238..806638) [1401 bp, 466 aa] {ON} YBR207W
           (REAL)
          Length = 466

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 35/69 (50%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRF 162
           S+H     ++ + +VI +V  +FF R+  +  +F + + SII+     ++ S A    +F
Sbjct: 168 SEHYYEGILSIVASVIISVMGLFFLRMGKLREKFRVKMASIIYSKDNNLLGSNATKSVKF 227

Query: 163 AVGGCFYQL 171
           +    F+ L
Sbjct: 228 SEKYSFFIL 236

>Suva_2.227 Chr2 (384110..385033) [924 bp, 307 aa] {ON} YDR068W
           (REAL)
          Length = 307

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 27/43 (62%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMY 64
           ++EK+ G ++++  +  T+  A  Y++ +D  +HN+E  A+ Y
Sbjct: 73  VVEKDDGIEINIPISDETTEAAQKYLKKLDDNIHNVENLAQSY 115

>NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYS 147
           G++      Y  S      L+S VN    +  A+G I  ++  D++GR   + +  + Y 
Sbjct: 130 GHLDTAVNTYVLSRVRLGLLVSIVN----IGCAIGGIVLSKAGDVYGRRKGLTIVTMVYM 185

Query: 148 MGTIIESQAVN 158
           +G II+  AVN
Sbjct: 186 VGIIIQISAVN 196

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTI 151
           Y  +A    +  + SL+S++  +    A  G I    LS+ FGR   +++S IFY++G I
Sbjct: 118 YGMKASLKLTSDEDSLISSLMPLG---AVGGSILLTPLSEYFGRKVALVISCIFYTIGGI 174

Query: 152 IESQAVNI 159
           + + A ++
Sbjct: 175 LCAAAQDV 182

>Skud_4.322 Chr4 (559325..560320) [996 bp, 331 aa] {ON} YDR068W
           (REAL)
          Length = 331

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 27/43 (62%)

Query: 22  MLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMY 64
           ++EK+ G ++++  +  T+  A  Y++ +D  +HN+E  A+ Y
Sbjct: 99  VVEKDDGIEINLPISNETTEAAQKYLKKLDENIHNVENLAQSY 141

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 22/165 (13%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIIL 178
           A +  IF    +DIFGR   +++S + + +G II+  A    +  VG      G+    L
Sbjct: 172 ALISSIFAGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSL 231

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGM------WAFI 232
           I  +  S+ +  N R     I +L      W++G    A    +  G G+      W  +
Sbjct: 232 IAPLYISEIAPKNIRGRLTVINSL------WLTGGQLIA----YGCGAGLSHVNNGWRIL 281

Query: 233 LPLACIPLGI---CMLHMRYLARKHAKDRLKPEFEALNKLKWKSF 274
           + L+ IP  I   C L +    R +    +K + E  NK+  KS+
Sbjct: 282 VGLSLIPTVIQFSCFLFLPDTPRFYV---MKGQLEKANKVLHKSY 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,767,496
Number of extensions: 2372403
Number of successful extensions: 8047
Number of sequences better than 10.0: 392
Number of HSP's gapped: 7923
Number of HSP's successfully gapped: 393
Length of query: 628
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 512
Effective length of database: 40,180,143
Effective search space: 20572233216
Effective search space used: 20572233216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)