Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL064C (AVT2)1.80ON48048023370.0
Suva_5.31.80ON48348321910.0
Skud_5.251.80ON48348320720.0
Smik_5.231.80ON48348320380.0
NCAS0J018401.80ON44543713560.0
TDEL0C062101.80ON47948613570.0
ZYRO0F16720g1.80ON49243312541e-169
Kwal_33.133861.80ON46947012301e-166
SAKL0C02574g1.80ON47346812131e-163
Ecym_10841.80ON49546712041e-161
KLTH0F02332g1.80ON46943611931e-160
NDAI0I001301.80ON44445211571e-155
KLLA0C02277g1.80ON46544911131e-148
KNAG0C007801.80ON51344710091e-132
AFR671W1.80ON4883889941e-130
YBL089W (AVT5)7.420ON4594282301e-19
KAFR0L019107.420ON4454022211e-18
Smik_2.317.420ON4594212184e-18
ZYRO0B04026g7.420ON4363962131e-17
Suva_2.287.420ON4594272122e-17
KLTH0C06006g7.420ON4454152095e-17
Kwal_27.107027.420ON4674052061e-16
Skud_5.2607.420ON4484052042e-16
Ecym_71337.420ON4574101952e-15
TPHA0K006707.420ON4643391943e-15
Suva_5.2407.420ON4484081944e-15
Skud_2.197.420ON4594281918e-15
YER119C (AVT6)7.420ON4484051901e-14
CAGL0H04587g7.420ON4454211891e-14
KNAG0B021907.420ON4614621846e-14
SAKL0F13134g7.420ON5104601847e-14
Smik_5.2647.420ON4484041793e-13
Kpol_1045.207.420ON4663081784e-13
KLLA0E06931g7.420ON4564131765e-13
NDAI0E040107.420ON4714351722e-12
TDEL0C028207.420ON4544101713e-12
CAGL0G03619g7.420ON4603151695e-12
TBLA0F014007.420ON4534411651e-11
TBLA0F01390singletonON4284071606e-11
NCAS0B062102.295ON4813231571e-10
CAGL0M06611g2.295ON4853151552e-10
TDEL0G022502.295ON4673171543e-10
KLLA0E08559g2.295ON4603151491e-09
AGL285C7.420ON4403951437e-09
Kwal_27.114852.295ON4714101402e-08
TPHA0C034602.295ON4733171402e-08
SAKL0E07392g2.295ON4722131402e-08
Kpol_1003.442.295ON4703121374e-08
Smik_9.972.295ON4902831356e-08
NCAS0E024407.420ON4953491349e-08
NDAI0B035102.295ON4963151303e-07
Kpol_1032.885.252ON5754041286e-07
KNAG0A053802.295ON4743031267e-07
Suva_9.1122.295ON4912171269e-07
CAGL0G06622g2.177ON7334031261e-06
KLTH0G10604g2.295ON4683141205e-06
YIL088C (AVT7)2.295ON4903421171e-05
ZYRO0A02112g2.295ON4671881152e-05
TBLA0C030305.252ON5234301152e-05
Skud_9.862.295ON4901981142e-05
KAFR0J013202.295ON4793431133e-05
TPHA0F017002.177ON4444311116e-05
KLLA0E13795g5.252ON5734091091e-04
AER380C2.177ON7164231081e-04
ADL205C2.295ON4681971062e-04
TPHA0B025305.252ON5963811053e-04
ZYRO0B09548g2.177ON7183011053e-04
Ecym_33352.295ON4741881044e-04
Kpol_505.52.177ON6874291036e-04
CAGL0E06468g5.252ON6813901037e-04
KLTH0D09042g2.177ON7184611000.001
Smik_14.2242.177ON715415980.002
SAKL0E10362g2.177ON733425980.002
KLLA0C13277g2.177ON721443960.004
KAFR0H036605.252ON646374950.005
TBLA0B072102.295ON497331930.008
YNL101W (AVT4)2.177ON713333910.015
KNAG0H023305.252ON643383910.015
Kwal_26.84012.177ON720436890.029
Skud_14.2292.177ON713333880.036
NDAI0C037905.252ON721370880.037
KAFR0D020002.177ON714172870.044
TDEL0F013202.177ON715399870.051
Suva_14.2382.177ON716337860.072
Skud_11.815.252ON712416840.12
Kwal_23.28395.252ON614382820.18
Suva_11.795.252ON719388810.27
Kwal_33.15600na 1ON48962790.41
SAKL0G12452g5.220ON602172780.57
TPHA0B029802.177ON749392780.64
TBLA0C056302.177ON742324761.0
NCAS0F031905.408ON31172751.1
NCAS0F023105.252ON668155761.2
YKL146W (AVT3)5.252ON692387751.4
TBLA0F03230singletonON561179751.4
Ecym_82495.252ON627381741.6
Kpol_1029.62.177ON767167741.7
Ecym_54082.177ON715309741.9
Smik_11.905.252ON680400732.2
CAGL0B04455g2.177ON60579722.8
KNAG0C033807.420ON545172723.0
KLLA0F04257gsingletonON501126713.4
NCAS0G026302.177ON705415714.0
Kwal_26.87598.669ON49237704.9
KLTH0B00836gna 1ON49062705.6
NDAI0F026602.177ON71083696.2
KLTH0G07502g5.252ON601135696.6
Smik_4.7613.102ON642107689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL064C
         (480 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}  AV...   904   0.0  
Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL0...   848   0.0  
Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON} Y...   802   0.0  
Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON} Y...   789   0.0  
NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1....   526   0.0  
TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1...   527   0.0  
ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} simi...   487   e-169
Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {...   478   e-166
SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {...   471   e-163
Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}...   468   e-161
KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {...   464   e-160
NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80 ...   450   e-155
KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {...   433   e-148
KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {O...   393   e-132
AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic ...   387   e-130
YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative...    93   1e-19
KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {...    90   1e-18
Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)    89   4e-18
ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {...    87   1e-17
Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)    86   2e-17
KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} simila...    85   5e-17
Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119...    84   1e-16
Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C ...    83   2e-16
Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar t...    80   2e-15
TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7....    79   3e-15
Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON...    79   4e-15
Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)    78   8e-15
YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}  ...    78   1e-14
CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} simila...    77   1e-14
KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.4...    75   6e-14
SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]...    75   7e-14
Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON...    74   3e-13
Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON} (42445....    73   4e-13
KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} simila...    72   5e-13
NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420     71   2e-12
TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {O...    70   3e-12
CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {...    70   5e-12
TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {O...    68   1e-11
TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {O...    66   6e-11
NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON} Anc_2...    65   1e-10
CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa] ...    64   2e-10
TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {O...    64   3e-10
KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {...    62   1e-09
AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON} S...    60   7e-09
Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088...    59   2e-08
TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {O...    59   2e-08
SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} simila...    59   2e-08
Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa] ...    57   4e-08
Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}...    57   6e-08
NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420     56   9e-08
NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295     55   3e-07
Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa] ...    54   6e-07
KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.2...    53   7e-07
Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON...    53   9e-07
CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {...    53   1e-06
KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {...    51   5e-06
YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}  ...    50   1e-05
ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {...    49   2e-05
TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.2...    49   2e-05
Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}...    49   2e-05
KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2....    48   3e-05
TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {O...    47   6e-05
KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]...    47   1e-04
AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}...    46   1e-04
ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON} S...    45   2e-04
TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.2...    45   3e-04
ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {...    45   3e-04
Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}...    45   4e-04
Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON} co...    44   6e-04
CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} simila...    44   7e-04
KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {...    43   0.001
Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101...    42   0.002
SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {...    42   0.002
KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} simi...    42   0.004
KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.2...    41   0.005
TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON} Anc_2...    40   0.008
YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuo...    40   0.015
KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.2...    40   0.015
Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {O...    39   0.029
Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101...    39   0.036
NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {O...    39   0.037
KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.1...    38   0.044
TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.1...    38   0.051
Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101...    38   0.072
Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W...    37   0.12 
Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -...    36   0.18 
Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W...    36   0.27 
Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]...    35   0.41 
SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]...    35   0.57 
TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.1...    35   0.64 
TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON} Anc_2...    34   1.0  
NCAS0F03190 Chr6 (650081..651016) [936 bp, 311 aa] {ON} Anc_5.408      33   1.1  
NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {O...    34   1.2  
YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuo...    33   1.4  
TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON}               33   1.4  
Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar t...    33   1.6  
Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON} (11352.....    33   1.7  
Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}...    33   1.9  
Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W...    33   2.2  
CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some s...    32   2.8  
KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.4...    32   3.0  
KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {...    32   3.4  
NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177     32   4.0  
Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W...    32   4.9  
KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserve...    32   5.6  
NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {O...    31   6.2  
KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} simila...    31   6.6  
Smik_4.761 Chr4 (1344066..1345994) [1929 bp, 642 aa] {ON} YDR484...    31   9.0  

>YEL064C Chr5 complement(29797..31239) [1443 bp, 480 aa] {ON}
           AVT2Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 480

 Score =  904 bits (2337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/480 (95%), Positives = 457/480 (95%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVL 60
           MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVL
Sbjct: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVL 60

Query: 61  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVI 120
           RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVI
Sbjct: 61  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVI 120

Query: 121 NLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQN 180
           NLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAF           DTIPHVLRAIFSQN
Sbjct: 121 NLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQN 180

Query: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLP 240
           DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLP
Sbjct: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLP 240

Query: 241 YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISII 300
           YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISII
Sbjct: 241 YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISII 300

Query: 301 ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRD 360
           ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRD
Sbjct: 301 ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRD 360

Query: 361 VVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTAS 420
           VVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTAS
Sbjct: 361 VVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTAS 420

Query: 421 TMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQHCQI 480
           TMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGF            DAVNGSDGQHCQI
Sbjct: 421 TMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFMIMIISSTQTIIDAVNGSDGQHCQI 480

>Suva_5.3 Chr5 complement(5485..6936) [1452 bp, 483 aa] {ON} YEL064C
           (REAL)
          Length = 483

 Score =  848 bits (2191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/483 (85%), Positives = 435/483 (90%), Gaps = 3/483 (0%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITP---DMDDTLVN 57
           MSELGEYSKLENKELRTEFELTNFP  G TDNDSDDGSQG++  N I P   D DD LVN
Sbjct: 1   MSELGEYSKLENKELRTEFELTNFPLSGITDNDSDDGSQGKDFPNTIYPIISDTDDQLVN 60

Query: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
           +VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI+GGL+SY+ALGFIVDWTLRL
Sbjct: 61  NVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRL 120

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           IVINLTLAGKRTYQGTVE+VMGKKGKLLILFTNGLFAF           DTIPHVLRA+F
Sbjct: 121 IVINLTLAGKRTYQGTVEYVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVF 180

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
           SQNDG VHFWLRRNVII+MVT FISFPLS+KRNIE LSKASFLAV+SMI+IVLTVVIRGP
Sbjct: 181 SQNDGEVHFWLRRNVIIIMVTIFISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGP 240

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
           MLPYDW+GH+LKLSD F+K TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFT+LTHI
Sbjct: 241 MLPYDWRGHTLKLSDIFIKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHI 300

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           SI+ISVICC LMGYSGFA FKEKTKGNVLNSFPGTDTAIN+ARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIVISVICCGLMGYSGFAAFKEKTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFV 360

Query: 358 LRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGAT 417
           LRDVVGNLLHEC+LIKNYDEHTQLS KQH +ITS LVFITMGISLTTCNLGALFELIGAT
Sbjct: 361 LRDVVGNLLHECHLIKNYDEHTQLSNKQHTIITSMLVFITMGISLTTCNLGALFELIGAT 420

Query: 418 TASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQH 477
           TASTMAYILPPYTNLLLTSKKK+WK +LP+Y CICFGF            DAVNG DGQH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYFCICFGFMIMIVSSTQTILDAVNGPDGQH 480

Query: 478 CQI 480
           CQI
Sbjct: 481 CQI 483

>Skud_5.25 Chr5 complement(28970..30421) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/483 (83%), Positives = 430/483 (89%), Gaps = 3/483 (0%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITP---DMDDTLVN 57
           M+E+G Y+KLENKELRTEFELT+FP  G TDNDSDDGSQG++S N + P   D DD LVN
Sbjct: 1   MTEVGGYTKLENKELRTEFELTDFPLLGITDNDSDDGSQGKDSPNFVYPITSDTDDPLVN 60

Query: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
            VLRENDKKSSMRMAFMNLANSILGAGIITQP AIKNAGILGGL++Y+ALGFIVDWTLRL
Sbjct: 61  SVLRENDKKSSMRMAFMNLANSILGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRL 120

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAF           DTIPHVLRA+F
Sbjct: 121 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVF 180

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
           SQNDG VHFWLRRNVIIV+VT FISFPLS+KRNIE LSKASFLAVISMIIIVLTVVIRGP
Sbjct: 181 SQNDGEVHFWLRRNVIIVLVTIFISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGP 240

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
           MLPYDWKGHSLK  DF +K TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI
Sbjct: 241 MLPYDWKGHSLKWPDFLVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 300

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           SIIISVICC LMG+SGFA FKEKTKGNVLN+FPGTDTAIN+ARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIIISVICCGLMGFSGFAAFKEKTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFV 360

Query: 358 LRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGAT 417
           LRDVVGN LHEC+LIK+YDEHTQLS KQH +ITS LVFITM ISLTTCNLGALFELIG+T
Sbjct: 361 LRDVVGNSLHECHLIKSYDEHTQLSDKQHTIITSLLVFITMSISLTTCNLGALFELIGST 420

Query: 418 TASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQH 477
           TASTMAYILPPYTNLLLTSKKK+WK +LP+YLCICFGF            DA+NG+D QH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKNWKAKLPYYLCICFGFMIMIVSSTQTILDAINGADEQH 480

Query: 478 CQI 480
           C+I
Sbjct: 481 CEI 483

>Smik_5.23 Chr5 complement(32195..33646) [1452 bp, 483 aa] {ON}
           YEL064C (REAL)
          Length = 483

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/483 (86%), Positives = 437/483 (90%), Gaps = 3/483 (0%)

Query: 1   MSELGEYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITP---DMDDTLVN 57
           M+ELG Y+KLENKELRTEFELT+FP PG TDN+SDD SQG++SL  I P   D DDTLVN
Sbjct: 1   MAELGAYTKLENKELRTEFELTDFPLPGITDNNSDDRSQGKDSLKAIYPIASDTDDTLVN 60

Query: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
            VL ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGL+SY+ALGFIVDWTLRL
Sbjct: 61  KVLLENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRL 120

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAF           DTIPHVLRAIF
Sbjct: 121 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIF 180

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
           SQ DG++HFWLRRNVII++VT FISFPLS+KRNIEALSKASFLAVISMIIIV+TVVIRGP
Sbjct: 181 SQKDGDIHFWLRRNVIIIIVTIFISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGP 240

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
           MLPYDWKGHSL+L DFF+K TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI
Sbjct: 241 MLPYDWKGHSLQLRDFFVKTTIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 300

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           SIIISVICC LMGYSGFA FKEKTKGN+LNSFPGTDTAINIARLCFGFNMLTTFPMEIFV
Sbjct: 301 SIIISVICCGLMGYSGFAAFKEKTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 360

Query: 358 LRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGAT 417
           LRDVVGNLLHEC +IKNYDEHTQLSGKQH+VITS LVFITMGISLTTCNLGALFELIGAT
Sbjct: 361 LRDVVGNLLHECKIIKNYDEHTQLSGKQHIVITSLLVFITMGISLTTCNLGALFELIGAT 420

Query: 418 TASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQH 477
           TASTMAYILPPYTNLLLTSKKKSW  +LPFYLCICFGF            DAVNGSDGQH
Sbjct: 421 TASTMAYILPPYTNLLLTSKKKSWSAKLPFYLCICFGFMIMIISSTQTILDAVNGSDGQH 480

Query: 478 CQI 480
           CQI
Sbjct: 481 CQI 483

>NCAS0J01840 Chr10 (346195..347532) [1338 bp, 445 aa] {ON} Anc_1.80
           YEL064C
          Length = 445

 Score =  526 bits (1356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/437 (60%), Positives = 324/437 (74%), Gaps = 11/437 (2%)

Query: 49  PDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALG 108
           PD  + L  +++ EN+KKS++ MAFMN+ANSILGAGIITQP A+KNAGILG ++ Y+ LG
Sbjct: 15  PDTSEELAKELIEENEKKSNVYMAFMNMANSILGAGIITQPLAVKNAGILGSIICYILLG 74

Query: 109 FIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDT 168
           FIVDWTLRL+VIN+TL+ K+TYQ TVEHVMGKKGK LIL  NGLFA            DT
Sbjct: 75  FIVDWTLRLLVINITLSSKQTYQDTVEHVMGKKGKFLILGCNGLFALGGCIGFSIIIGDT 134

Query: 169 IPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIII 228
           IPHVLR  F+         + RN++I + T FIS+PLS+ RNI ALSKASFLA++SM++I
Sbjct: 135 IPHVLRIFFNSEK------ITRNMVIFLTTLFISYPLSLLRNIAALSKASFLALVSMVVI 188

Query: 229 VLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
           V TVVIRGP LP + KG  L  S  F   ++F+SLS+ISFALVCHHNTSFIF S+RN+S+
Sbjct: 189 VFTVVIRGPALPSELKGEPLSHSSLFFSPSLFKSLSIISFALVCHHNTSFIFHSIRNKSL 248

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
            KFT+LTHIS+ ISV  C LMGYSGF +F +KTKGN+LN+FP  D  INIAR+CFGFNML
Sbjct: 249 TKFTKLTHISVFISVAFCMLMGYSGFFIFTDKTKGNILNNFPAKDNIINIARICFGFNML 308

Query: 349 TTFPMEIFVLRDVVGNLLHECNLIKNYDEH---TQLSGKQHVVITSSLVFITMGISLTTC 405
           TTFP+EIFVLRDVV  +L EC+L+ + + +     LS K H  IT+ LVF++MGISL TC
Sbjct: 309 TTFPLEIFVLRDVVAVILLECHLVPSEENNPLLPYLSRKWHFCITTGLVFLSMGISLMTC 368

Query: 406 NLGALFELIGATTASTMAYILPPYTNLLLTSKKK--SWKERLPFYLCICFGFXXXXXXXX 463
           NLGALFELIG+TTAS MAYILPPY NLLL  ++   S+  +LP Y CI FGF        
Sbjct: 369 NLGALFELIGSTTASVMAYILPPYVNLLLRQQRNELSFTTKLPHYFCIFFGFTVMIISST 428

Query: 464 XXXXDAVNGSDGQHCQI 480
               DAV G++ +HC+I
Sbjct: 429 ETILDAVFGTEQKHCEI 445

>TDEL0C06210 Chr3 (1130473..1131912) [1440 bp, 479 aa] {ON} Anc_1.80
           YEL064C
          Length = 479

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/486 (56%), Positives = 358/486 (73%), Gaps = 25/486 (5%)

Query: 7   YSKLENKE----LRTEFELTNFPF-PGTTD----NDSDDGSQGQNSLNIITPDMDDTLVN 57
           YS+LE +     L  EFEL +F   PG +D    NDS++     ++  I     D+++V 
Sbjct: 7   YSRLEEQSERIPLELEFELVDFDAKPGASDETEENDSNEAKASSSNSAI-----DESMVI 61

Query: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
           ++LR+NDKKS+MR AFMN+ANSILGAG++ QPFAI+N GI+GG+L+Y+ L  +VDWTLRL
Sbjct: 62  NLLRDNDKKSTMRWAFMNMANSILGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRL 121

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           IVINLTLAGK+TYQ TVE  +G+KG++L+L +NGLFAF           DTIPH L++IF
Sbjct: 122 IVINLTLAGKKTYQDTVEFALGRKGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIF 181

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
             ++    F+ RRNV+I +VT FIS+PLS++RNI ALSKASFLA+ISM++IV +VV++GP
Sbjct: 182 HSSN----FFFRRNVVITIVTLFISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGP 237

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
            +    KG    L+D F+ + IFR +SVISFALVCHHNTSFIFFS++NRS+ KF RLTHI
Sbjct: 238 RVDMSLKGDKWSLTDIFISSAIFRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHI 297

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           S  IS+I C LMGYSG++VF++KTKGN+LN+FP  D  INIARLCFGFNMLTTFP+EIFV
Sbjct: 298 STFISMIFCMLMGYSGYSVFRDKTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFV 357

Query: 358 LRDVVGNLLHECNLIKNYDEHTQ---LSGKQHVVITSSLVFITMGISLTTCNLGALFELI 414
           LRDV+   L+     K  ++ T+   LS ++  +IT+  V  TM ISLTTCNLGALFELI
Sbjct: 358 LRDVIAAFLYG----KKEEDETEAPPLSTRKLFIITTVCVVSTMSISLTTCNLGALFELI 413

Query: 415 GATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSD 474
           GATTASTMAYILPPYTNL+L+ +  ++++++P YLCI FGF            + V GSD
Sbjct: 414 GATTASTMAYILPPYTNLVLSKEANTFRQKVPHYLCIFFGFMVMIVSSTQTIIEVVKGSD 473

Query: 475 GQHCQI 480
            +HC++
Sbjct: 474 QRHCEL 479

>ZYRO0F16720g Chr6 (1385158..1386636) [1479 bp, 492 aa] {ON} similar
           to uniprot|P39981 Saccharomyces cerevisiae YEL064C AVT2
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 492

 Score =  487 bits (1254), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 252/433 (58%), Positives = 314/433 (72%), Gaps = 14/433 (3%)

Query: 50  DMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF 109
           D DD  VNDV+REN+KKS+M+ AFMN+ANSILGAG+I QP AIKN+GI+G +++Y+ L  
Sbjct: 72  DNDDEFVNDVIRENNKKSTMKWAFMNMANSILGAGVIGQPIAIKNSGIVGAIIAYLVLFV 131

Query: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 169
           +VDWTLRLIVINLTLAGK+TYQ TV   MGK+G++ +L  NGLFAF           DT+
Sbjct: 132 LVDWTLRLIVINLTLAGKKTYQDTVAFAMGKRGRIAVLTANGLFAFGGCIGFCIIIGDTL 191

Query: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV 229
           PHV RA   QN      +L R +II +VT  IS+PL+++RNI ALSKASFLA+ISM+IIV
Sbjct: 192 PHVFRAFIHQNS----VFLSRRLIITIVTICISYPLALQRNIAALSKASFLALISMVIIV 247

Query: 230 LTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289
            TV+IRGP +    K   L   D  +   IFR +SVISFALVCHHNTSFI+FS++NRS+ 
Sbjct: 248 FTVIIRGPEI--HAKRDPLTWEDILVTPRIFRGISVISFALVCHHNTSFIYFSIKNRSLR 305

Query: 290 KFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349
           KF RLTHIS  ISV+ C +MG+SGFA F + TKGNVLN+F   D A+NIARLCFGFNMLT
Sbjct: 306 KFNRLTHISTSISVVFCMIMGFSGFAAFGQNTKGNVLNNFSADDKAVNIARLCFGFNMLT 365

Query: 350 TFPMEIFVLRDVVGNLL--HECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNL 407
           TFP+EIFVLRDV+ + +  H+ N   N      LS   H +IT+ LVF TM ISL TCNL
Sbjct: 366 TFPLEIFVLRDVIASFIGGHQPNGDPNV-----LSKSNHFIITTILVFGTMSISLLTCNL 420

Query: 408 GALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXX 467
           GA+FELIGATTAS MAYILPP+ NLLLTS  K+++++LP + CI FGF            
Sbjct: 421 GAIFELIGATTASMMAYILPPWVNLLLTS-DKTFRQKLPHFACIAFGFSIMLISSIQTIL 479

Query: 468 DAVNGSDGQHCQI 480
           D +NG+D + C++
Sbjct: 480 DTMNGTDEKQCEL 492

>Kwal_33.13386 s33 complement(195919..197328) [1410 bp, 469 aa] {ON}
           YEL064C - Hypothetical ORF [contig 118] FULL
          Length = 469

 Score =  478 bits (1230), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 245/470 (52%), Positives = 327/470 (69%), Gaps = 19/470 (4%)

Query: 11  ENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMR 70
            ++ L + F+L++F          D  SQ +NS  +I    D++     LREN  KS++ 
Sbjct: 19  RDELLGSSFQLSSF----------DRNSQ-RNSERLIDGSEDES-TTAFLRENRSKSNIF 66

Query: 71  MAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTY 130
           MAFMN+ANSILGAG+I QPFAIKN G++GG+ + + L  +VDWT+RLIV+N+ + GK TY
Sbjct: 67  MAFMNMANSILGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTY 126

Query: 131 QGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRR 190
           Q +VE  MG+KGKLLIL +NGLFAF           DTIPHVLRA F  ++   H    R
Sbjct: 127 QDSVEFAMGRKGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHENLFH----R 182

Query: 191 NVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKL 250
           N+II++VT FISFPLS+ RNI  LSKAS LA++SM+ IV+ V+++GPM+   +KG S   
Sbjct: 183 NIIIILVTCFISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKG-SFNT 241

Query: 251 SDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMG 310
           ++ F    IF+ +SVISFALVCHHNTSFI+FS++  S+ +F RLTH S  +++I C LMG
Sbjct: 242 TELFFTPRIFQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMG 301

Query: 311 YSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECN 370
           Y+GF VFK++TKGN+LN+FPG+D  +N+AR CFGFNMLTTFP+EIFVLRDV+ + +   +
Sbjct: 302 YTGFLVFKDRTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMFFNS 361

Query: 371 LIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYT 430
             K+ ++  +LS K HV++T+ LV  TM ISLTTCNLGALFEL GATTAS MAYILPP  
Sbjct: 362 --KDTNQSQELSLKLHVILTTILVMTTMLISLTTCNLGALFELTGATTASLMAYILPPSV 419

Query: 431 NLLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQHCQI 480
           NLLL  K+ + +E+LP Y CI FGF              + G D +HC++
Sbjct: 420 NLLLIGKRSTVREKLPHYACIIFGFTIMVVSSSQTIIAYIRGGDQKHCEV 469

>SAKL0C02574g Chr3 complement(236779..238200) [1422 bp, 473 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 473

 Score =  471 bits (1213), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 252/468 (53%), Positives = 328/468 (70%), Gaps = 17/468 (3%)

Query: 18  EFELTNF------PFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRM 71
           +FEL++F           +  D DD ++  ++      D++D LV+ ++ EN  KS++ M
Sbjct: 16  QFELSSFDQHMQPAHASGSAADEDDETKFVDT----GADVEDPLVSGIVTENQTKSNIYM 71

Query: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           AFMN+ANSILGAGII QPFAI N G+ GG+ + V L  +VDWT+RLIV+NL L GK TYQ
Sbjct: 72  AFMNMANSILGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQ 131

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
            +VE  MG++GKLLIL  NGLFAF           DTIPHVLRA F  +    H    RN
Sbjct: 132 DSVEFAMGRRGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHTALFH----RN 187

Query: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLS 251
            II  VT F+S+PLS+ R+I  LSKAS LA+ SM++IV+ V+++GPML   +KG SL  S
Sbjct: 188 AIIFFVTLFVSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKG-SLTAS 246

Query: 252 DFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGY 311
             F+   IF+ +SVISFALVCHHNTSFI+FS++N S+ +F +LTH+S ++S++ C +MGY
Sbjct: 247 KLFITPRIFQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGY 306

Query: 312 SGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNL 371
           SGF VFK+KTKGN+LN+FP  D  IN+AR CFGFNMLTTFP+EIFVLRDVV +L H  + 
Sbjct: 307 SGFLVFKDKTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAHFHS- 365

Query: 372 IKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTN 431
                   +LS K+HV +TS+LVF+TM +SLTTCNLGALFELIGATTAS MAYILPP TN
Sbjct: 366 -GEATAPAELSTKKHVAVTSALVFLTMTVSLTTCNLGALFELIGATTASMMAYILPPLTN 424

Query: 432 LLLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQHCQ 479
           LLLT + K+ +++LP+Y CI FGF             A+NG + +HC+
Sbjct: 425 LLLTGRAKTLRQKLPYYGCIVFGFAVMVISSTQTILAAINGGEQKHCE 472

>Ecym_1084 Chr1 complement(168749..170236) [1488 bp, 495 aa] {ON}
           similar to Ashbya gossypii AFR671W
          Length = 495

 Score =  468 bits (1204), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 247/467 (52%), Positives = 315/467 (67%), Gaps = 17/467 (3%)

Query: 18  EFELTNFP----FPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAF 73
           +FEL+ F      P T+   ++   Q    LN+     +D  V+ +   N  KS+M MAF
Sbjct: 40  QFELSTFHDYELLPTTSGARNNKNVQNNVELNL---QFEDPNVSQLTNPNRGKSNMYMAF 96

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGT 133
           MN+ANSILGAG+I QPFAIKN G++GG+   V L  IVDWT+RLIVINL L GK TYQ +
Sbjct: 97  MNMANSILGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDS 156

Query: 134 VEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVI 193
           VE  MG KGKLLILF NGLFAF           D+IPHVL+A F  +        RRNV+
Sbjct: 157 VEFAMGTKGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFPSHSE----LFRRNVV 212

Query: 194 IVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLSDF 253
           I +VT FIS+PLS+ RNI  LSKAS LA++S+++IV  V+IR P +  ++KG      + 
Sbjct: 213 ISVVTLFISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDEYKGQ-FTWEEA 271

Query: 254 FMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSG 313
           F+   +F+ +S+ISFALVCHHNTSFIFFS++N S+ +F  LTHIS IIS++ C + GY G
Sbjct: 272 FITPRVFQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVG 331

Query: 314 FAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIK 373
           F  FK+KTKGN+LN+FP  D  IN AR CFGFNMLTTFP+EIFVLRDVV +LL+     +
Sbjct: 332 FLTFKDKTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLY----FQ 387

Query: 374 NYD-EHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL 432
           + D E   L+ K+H ++TS LVFI+M ISLTTCNLGAL EL+G+TTAS  AYILPP T L
Sbjct: 388 SADSESIILTTKEHFIVTSVLVFISMSISLTTCNLGALLELVGSTTASLTAYILPPATTL 447

Query: 433 LLTSKKKSWKERLPFYLCICFGFXXXXXXXXXXXXDAVNGSDGQHCQ 479
            LT K K+ KER P+Y CI FGF             A+ G++ +HC+
Sbjct: 448 ALTGKTKTLKERTPYYACIMFGFSIMIVSSTQTILSAIYGTEIKHCE 494

>KLTH0F02332g Chr6 complement(192112..193521) [1410 bp, 469 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 469

 Score =  464 bits (1193), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 311/436 (71%), Gaps = 13/436 (2%)

Query: 47  ITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVA 106
           ++ D +D   +  L E   KS++ MAFMN+ANSILGAGII QPFA+KN G+LGG+L+ V 
Sbjct: 43  LSVDSEDRFTSTFLHEQRSKSNILMAFMNMANSILGAGIIGQPFAVKNCGLLGGVLAIVL 102

Query: 107 LGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXX 166
           L  +VDWT+RLIV+NL ++GK TYQ +VE  MG+KGKLLIL +NGLFAF           
Sbjct: 103 LSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGRKGKLLILLSNGLFAFGGCIGFCIIIG 162

Query: 167 DTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMI 226
           DTIPHVLRA FS +D   H    RN++IV+VT  ISFPLS+ R+I  LSKAS LA+ SM+
Sbjct: 163 DTIPHVLRAFFSGHDNLFH----RNIVIVVVTCLISFPLSLNRDISKLSKASMLALASMV 218

Query: 227 IIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNR 286
           +IV+ VVI+GP     +KG S   S+  +   IF+ LSVISFALVCHHNTSFI+FS++  
Sbjct: 219 VIVVIVVIKGPGTDSAYKG-SFNSSNLLITPRIFQGLSVISFALVCHHNTSFIYFSLKTP 277

Query: 287 SVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFN 346
           S+ +F RLTH S  I++I C LMG++GF VFK+KTKGN+LN+FPG D A+N+AR CFGFN
Sbjct: 278 SLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKDKTKGNILNNFPGNDNAVNVARFCFGFN 337

Query: 347 MLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQ---LSGKQHVVITSSLVFITMGISLT 403
           MLTTFP+EIFVLRDV+ +L     +  N +  +Q   LS K HV+I+++LVF TM ISLT
Sbjct: 338 MLTTFPLEIFVLRDVIKDL-----MFFNSEPKSQPRVLSLKLHVIISTALVFGTMAISLT 392

Query: 404 TCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCICFGFXXXXXXXX 463
           TCNLGALFELIGATTAS MAYILPP+ NL L      W++R+P Y+CI FGF        
Sbjct: 393 TCNLGALFELIGATTASLMAYILPPWVNLKLVGGNLKWRDRIPHYVCIGFGFAIMLISST 452

Query: 464 XXXXDAVNGSDGQHCQ 479
                 +NG D +HC+
Sbjct: 453 QTIISYINGGDQKHCE 468

>NDAI0I00130 Chr9 (12635..13969) [1335 bp, 444 aa] {ON} Anc_1.80
           YEL064C
          Length = 444

 Score =  450 bits (1157), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 241/452 (53%), Positives = 317/452 (70%), Gaps = 20/452 (4%)

Query: 34  SDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIK 93
           +D+  Q Q+S         + LV +++ EN+KKS++ MAF+N+ANSILGAGIITQP A+K
Sbjct: 8   TDEEFQLQDS---------EALVKEIIDENNKKSNIYMAFVNMANSILGAGIITQPLAVK 58

Query: 94  NAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLF 153
           NAG+   ++ Y+ LGFIVDWTLRL++ N+TL+ K TY  TVE+ MG+KGK LIL  NGLF
Sbjct: 59  NAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGRKGKYLILCCNGLF 118

Query: 154 AFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEA 213
           A            DTIPHVLR IF  +    HF + RN +I   T FIS+PLS+ R+I A
Sbjct: 119 ALGGCIGFCIIIGDTIPHVLR-IFIHS----HF-VTRNSVIFFSTLFISYPLSLLRDISA 172

Query: 214 LSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCH 273
           LS  SFLA+ISM +IV+TVV+ GP LP + KG  +  S +    ++FRSLS++SFALVCH
Sbjct: 173 LSSTSFLALISMTVIVMTVVVFGPSLPAELKGSGIPSSSYVASPSLFRSLSIVSFALVCH 232

Query: 274 HNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTD 333
           HNTSFIF S+RN+S+ KFT+LTH+S+ ISVI C +MGY+GF +F  KTKGN+LN+FP   
Sbjct: 233 HNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTGKTKGNILNNFPPNG 292

Query: 334 TAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQ---LSGKQHVVIT 390
            AINIAR+CFGFNMLTT P+E+FVLRDV+  +L E   I + +E      L+ K H ++T
Sbjct: 293 VAINIARVCFGFNMLTTLPLELFVLRDVIAVILLENEWIPSIEEKPGMPILTRKWHFIVT 352

Query: 391 SSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSW--KERLPFY 448
           + +VF+TM +SL TCNLGALFEL+GATTAS MAYILPPY NLLL  +K+    K ++P Y
Sbjct: 353 TIIVFLTMSVSLLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEKEPLPIKSKIPHY 412

Query: 449 LCICFGFXXXXXXXXXXXXDAVNGSDGQHCQI 480
            CI FGF            +A+  ++ +HC+I
Sbjct: 413 FCILFGFTVMIVSSFQTIVEALADNEQKHCEI 444

>KLLA0C02277g Chr3 complement(192607..194004) [1398 bp, 465 aa] {ON}
           similar to uniprot|P39981 Saccharomyces cerevisiae
           YEL064C AVT2 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 465

 Score =  433 bits (1113), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 231/449 (51%), Positives = 308/449 (68%), Gaps = 8/449 (1%)

Query: 6   EYSKLENKELRTEFELTNFPFPGTTDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDK 65
           +Y+KL   + +++ E   F    T+ +D+   +      NI   + +D L +D+   N+ 
Sbjct: 8   KYAKLALSDKQSKNEPNPFELELTSFDDTAKTADSAVDQNIFNVNEEDPLTDDIYLSNEA 67

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           KS+  MAFMN+ANSILG+G+I QPFA+KN GI+GGL + + +  +VDWT+RLIVINL L 
Sbjct: 68  KSNRYMAFMNMANSILGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLT 127

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVH 185
           GK TYQ +VE  MG+ G LLIL +NGLFAF           D+IPHVL A F  +    H
Sbjct: 128 GKSTYQASVETAMGQWGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHTDLFH 187

Query: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKG 245
               RNVII +VT FISFPLS+ R+I  LSK S LA++ +I IV+ +V++ P++  ++KG
Sbjct: 188 ----RNVIITLVTLFISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKG 243

Query: 246 HSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVIC 305
            +  L   F+   IF+ +SVISFALVCHHNTSFIFFS+RN S+ +F +LTH+S+I+S I 
Sbjct: 244 -TFHLHQLFITPRIFQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIV 302

Query: 306 CALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNL 365
           C    YSGF  FK+KT GN+LN+FP  D  IN ARL  GFNMLTTFP+EIFVLRDV+ ++
Sbjct: 303 CLTTAYSGFLNFKDKTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDI 362

Query: 366 LHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYI 425
           ++     K+  E  +L+ K H +ITS LV I M I+L+T NLGAL E+IGAT+AS MAYI
Sbjct: 363 IYYN---KDDPEPVKLTTKMHALITSGLVLIIMCIALSTSNLGALLEIIGATSASLMAYI 419

Query: 426 LPPYTNLLLTSKKKSWKERLPFYLCICFG 454
           LPP TNL++T KKKS KE+LP+  CI FG
Sbjct: 420 LPPLTNLVITGKKKSLKEKLPYCGCIVFG 448

>KNAG0C00780 Chr3 complement(137135..138676) [1542 bp, 513 aa] {ON}
           Anc_1.80 YEL064C
          Length = 513

 Score =  393 bits (1009), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 214/447 (47%), Positives = 288/447 (64%), Gaps = 48/447 (10%)

Query: 50  DMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF 109
           ++++ L+  ++  N++KS + MAFMN+ANSILGAGII+QPFA++ AG+LG  + Y+ALGF
Sbjct: 21  ELENPLIAGIIETNEEKSPLHMAFMNMANSILGAGIISQPFAVREAGVLGAFVVYIALGF 80

Query: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 169
           +VDWTLRLIV NL + G  TYQ +V   +G+ G+L IL  NGLFAF           DTI
Sbjct: 81  LVDWTLRLIVQNLVITGTETYQESVAVALGEPGRLAILLANGLFAFGGCVAFCIIIGDTI 140

Query: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV 229
           PHVLR +          ++ RN +I++VT  IS PLS+ + I+ L +ASFLA++SM +IV
Sbjct: 141 PHVLRTVCPPQ------YIERNWVIIVVTLLISLPLSLSKKIKQLERASFLALVSMAVIV 194

Query: 230 LTVVIRGPMLPYDWKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
           +TV +RGP LP + K   SL    ++ + TIF+S+S++SFALVCHHNTSFIF S+RN+S+
Sbjct: 195 VTVAVRGPFLPSELKSQVSLFAPQWWFRKTIFKSVSIVSFALVCHHNTSFIFHSLRNKSI 254

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
            KF RLTH S  +SV  C LMGY+GF  FKEKTKGNVLN+F G D  IN+ARL FGFNML
Sbjct: 255 YKFNRLTHWSCAVSVSVCMLMGYTGFHTFKEKTKGNVLNNFSGDDGWINVARLFFGFNML 314

Query: 349 TTFPMEIFVLRDVVGNLL----HECNLIKNYDE----HT--------------------- 379
           TTFP+EIFVLR+VV ++     H     + +      HT                     
Sbjct: 315 TTFPLEIFVLRNVVLDIWAGPTHRWYQHRRHHPPRGGHTATQQPPPPEPHGSSPARGPAG 374

Query: 380 ---------QLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYT 430
                    + S + H  +T  LV  TMG++L TCNLGAL E+IG+TT +  AYILPP T
Sbjct: 375 PHPGLPPDPEPSEQPHTAVTVVLVLATMGVALVTCNLGALLEVIGSTTGALTAYILPPLT 434

Query: 431 NLLLTSKKK---SWKERLPFYLCICFG 454
           ++LLT ++    + +ERL    C+ FG
Sbjct: 435 HVLLTRRRPQPHTARERLGHCCCVVFG 461

>AFR671W Chr6 (1670758..1672224) [1467 bp, 488 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL064C (AVT2)
          Length = 488

 Score =  387 bits (994), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 268/388 (69%), Gaps = 8/388 (2%)

Query: 92  IKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNG 151
           +KN G+LGGL+  + L  IVDWT+RLI+INL L GK TYQ TVE  MG+ GK  +LF NG
Sbjct: 108 LKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGRPGKYAVLFANG 167

Query: 152 LFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNI 211
           +FAF           D+IPHVLRA F     N   +  RN+II +VT F+S+PLS+ RNI
Sbjct: 168 MFAFGGCVGFCIIIGDSIPHVLRAFFP----NYIEYFNRNMIITIVTIFVSYPLSLNRNI 223

Query: 212 EALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALV 271
             LSKAS LA++S+++IV+ +V+RGP +  D++G S  L + F+K  +F+ +SVISFALV
Sbjct: 224 SKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRG-SFDLEELFVKPRLFQGISVISFALV 282

Query: 272 CHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPG 331
           C HNTSFI+FS+R  S+ +F  LTHIS  IS++ C + GYSGF  FK KTKGN+LN+FP 
Sbjct: 283 CLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKSKTKGNILNNFPS 342

Query: 332 TDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITS 391
           +D  IN AR CFGFNMLTTFP+EIFVLRDV+ +L+   +      E  +LS K+H +IT+
Sbjct: 343 SDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLI---STETPKGEPLRLSTKRHFIITT 399

Query: 392 SLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYLCI 451
           +LV  TMGISLTTCNLGAL EL+G+TTAS  AYILPP TNL+LT ++++ KE+LP Y CI
Sbjct: 400 ALVLSTMGISLTTCNLGALLELVGSTTASLSAYILPPMTNLILTGERRAAKEKLPHYACI 459

Query: 452 CFGFXXXXXXXXXXXXDAVNGSDGQHCQ 479
            FGF             A++      C 
Sbjct: 460 LFGFSIMVISSTQAIITAIHSDKSSQCD 487

>YBL089W Chr2 (49574..50953) [1380 bp, 459 aa] {ON}  AVT5Putative
           transporter, member of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 459

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 88/428 (20%), Positives = 186/428 (43%), Gaps = 55/428 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGL--LSYVALGFIVDWTLRLIVINLTL 124
           S++R   + L ++  GAG++  PFA K  G++ GL  L++  +  +    L+  +     
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
             +      +  ++     ++  F   +  F           D +P ++++IF +ND N+
Sbjct: 63  KSENASFAKLTQLINPSISVVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYRNDDNM 122

Query: 185 ------HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPM 238
                 H +L R + I ++  F+  PL  KR++ +L  AS +A++S+        + G +
Sbjct: 123 SGSQEHHMFLDRRLYITLIIVFVISPLCFKRSLNSLRYASMIAIVSV------AYLSGLI 176

Query: 239 LPYDWKGHSLKLSD-FFM-------KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 290
           + +    H L+    +FM         +   +L +  FA  CHHN   +     ++S   
Sbjct: 177 IYHFVNRHQLERGQVYFMVPHGDSQSHSPLTTLPIFVFAYTCHHNMFSVINEQVDKSFKV 236

Query: 291 FTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTT 350
             R+   +I+++     ++G +G+  F E   GN+L  +P +  +  I RL     ++  
Sbjct: 237 IRRIPIFAIVLAYFLYIIIGGTGYMTFGENIVGNILTLYPNS-ISTTIGRLAMLLLVMLA 295

Query: 351 FPMEIFVLRDVVGNLL-----------------------------HECNLIKNYDEHTQL 381
           FP++    R  V N++                              E    +N +E    
Sbjct: 296 FPLQCHPCRSSVKNIIIFIENFRKGKLYDNRASFIPLDNFNSEDPQEAPTQQNNEEPNLR 355

Query: 382 SGK-QHV-VITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLTSKK 438
           S   +H+ +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP  +   L+ S+ 
Sbjct: 356 SESLRHINIITLCILLFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEF 415

Query: 439 KSWKERLP 446
               ER+P
Sbjct: 416 TGTNERVP 423

>KAFR0L01910 Chr12 complement(362409..363746) [1338 bp, 445 aa] {ON}
           Anc_7.420 YER119C
          Length = 445

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 96/402 (23%), Positives = 179/402 (44%), Gaps = 53/402 (13%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF--IVDWTLRLIVINLT 123
            SS+R   + L ++  GAGI+  P+A K  G++ G L     GF  +    L+  V   T
Sbjct: 2   PSSIRSGVITLLHTACGAGILAMPYAFKPFGLVPGFLMIAICGFCALSGLILQAQVAKYT 61

Query: 124 LAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGN 183
            +G  ++  T+  ++     ++      +  F           D +P +  A+F+ +   
Sbjct: 62  ASGSASFF-TLSQLISPSLSVVFDLAIAVKCFGVGVSYMIVVGDLMPQIF-AVFTTS--- 116

Query: 184 VHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV---IRGPMLP 240
            H  L R+  I ++  FI  PL   R + +L  AS +A+ ++  + + VV   I      
Sbjct: 117 -HILLNRDFHISLIMLFIVSPLCFLRKLNSLRYASMIAISAVAYLCVLVVAHFIFQTEDV 175

Query: 241 YDWKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRN-RSVAKFTRLTHIS 298
           +D KG  S+ L     + +   +L +  FA  CHHN    FFS+ N +S   FT +  I 
Sbjct: 176 HDLKGVVSIGLPK--HEPSPLTTLPIFVFAYTCHHN----FFSVINEQSNIAFTHIKKIP 229

Query: 299 I---IISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEI 355
           I   I++ +   L+G+SG+  F +   GN++  +P T ++  I RL   F ++  FP++ 
Sbjct: 230 IIAMILAYLLYILIGFSGYLTFGDNIVGNIITLYPRTASS-TIGRLAIVFLVMLAFPLQC 288

Query: 356 FVLRDVVGNLLH--------------------------ECNLIKN----YDEHTQLSGKQ 385
              R  + ++ H                             LI+       E   L GK+
Sbjct: 289 HPCRASIHHIWHYIQEKNSNEIATQPINVPPDEEDTLLAVELIEEDSPKQPEEIPLRGKR 348

Query: 386 HVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
             +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 349 FNIITVCILLFSYTLAISVNSLAKVLAIVGATGSTSISFILP 390

>Smik_2.31 Chr2 (43199..44578) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/421 (21%), Positives = 182/421 (43%), Gaps = 55/421 (13%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGL--LSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           + L ++  GAG++  PFA K  G++ GL  L++  +  +    L+  +       +    
Sbjct: 10  LTLLHTACGAGVLAMPFAFKPFGLMPGLITLTFCGICSLCGLLLQTRIAKYVPKSENASF 69

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV------H 185
             +  ++     ++  F   +  F           D +P ++++IF  ND +       H
Sbjct: 70  AKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLVPQIVQSIFYHNDDSTGGLQEHH 129

Query: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKG 245
             L R + I +V  F+  PL  KR++ +L  AS +A+IS+        + G ++ +    
Sbjct: 130 RLLDRRLYITLVMMFVIAPLCFKRSLNSLRYASMIAIISV------AYLSGLIIYHFLNR 183

Query: 246 HSLKLSD-FFM-------KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
           H L+    +FM         +   +L +  FA  CHHN   +     +++     R+   
Sbjct: 184 HQLERGQVYFMVPHRDSSSHSPLTTLPIFVFAYTCHHNMFSVINEQTDKTFRILRRIPIF 243

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           +I  + I   ++G +G+  F E   GN+L  +P +  +  I RL     ++  FP++   
Sbjct: 244 AISFAYILYLIIGGAGYMTFGENIVGNILTLYPNS-ISTTIGRLAMLLLVMLAFPLQCHP 302

Query: 358 LRDVVGNL---------------------LHECNLIKNYDEHTQLS---------GKQHV 387
            R  + N+                     L + N  + +DE +Q S          ++H 
Sbjct: 303 CRSSIKNIFIFIEDFRKGRLHDNRTGFIPLDDFNSEEPHDELSQQSSEGPTLRSESQRHT 362

Query: 388 -VITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLTSKKKSWKERL 445
            VIT  ++  +  ++++  +L  +  ++GAT ++++++ILP  +   L+ S+  +  ER+
Sbjct: 363 NVITLCVLVFSYILAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFTNRNERV 422

Query: 446 P 446
           P
Sbjct: 423 P 423

>ZYRO0B04026g Chr2 complement(339245..340555) [1311 bp, 436 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 436

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/396 (21%), Positives = 171/396 (43%), Gaps = 48/396 (12%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
            SS+      L ++  GAGI+  P+  K  G+  G+L   ALGF     +  +++   +A
Sbjct: 2   SSSVSGGVATLLHTACGAGILAMPYGFKTLGLTFGIL---ALGFCSLCAMTGLLLQAQVA 58

Query: 126 ---GKRTYQG-TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQND 181
               +RT    ++  ++  K  ++      +  F           D IP +    F+ N 
Sbjct: 59  RYVPERTASFFSLTQLIHPKLSVVFDLAIAIKCFGVGVSYMIVVGDLIPQIFTT-FTSNK 117

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPY 241
                 L RN  I MV  F+  PL   + + +L KAS +A+ S+  +   VV+      +
Sbjct: 118 ----ILLERNFHITMVMLFLVSPLCFMKRLTSLRKASLVALSSVAYLCCLVVVH-----F 168

Query: 242 DWKGHSL-----KLSDFFMK--ATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
            W  + +     K+S  F +   T   +L +  FA  CHHN   ++   ++ S  +  ++
Sbjct: 169 IWPSNEIDQRKGKVSIGFPRNEPTPLTTLPIFVFAYTCHHNAFSVYNEQKDTSTRQLNKI 228

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
               + I+ +   ++G +G+  F +   GN++  +P    +  I R+     ++  FP++
Sbjct: 229 GRYGMSIAFVLYTIIGGAGYLTFGDHIAGNIITLYP-PSLSTTIGRVAIVLLVMLAFPLQ 287

Query: 355 IFVLRDVVGNLLHECNLI-KNYDEHTQ----------------------LSGKQHVVITS 391
               R  + N+L+    + KN    T+                      L GK+  VIT 
Sbjct: 288 CHPARSSINNILYSFQSVEKNLQGQTENSNLISEEESVESQAHGPPVPPLQGKRFTVITL 347

Query: 392 SLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
            ++  +  ++++  +L  L  ++G+T ++++++ILP
Sbjct: 348 VILIASYLLAISVTSLARLLAIVGSTGSTSISFILP 383

>Suva_2.28 Chr2 (46134..47513) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/427 (18%), Positives = 181/427 (42%), Gaps = 53/427 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGL--LSYVALGFIVDWTLRLIVINLTL 124
           S  R   + L ++  GAG++  PFA K  G+L  L  L++  +  +    L+  ++    
Sbjct: 3   SDPRSGVLTLLHTACGAGVLAMPFAFKPFGLLPALITLTFCGICSLCGLLLQTRIVKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
             +      +  ++     ++  F   +  F           D +P +L +I  +ND + 
Sbjct: 63  KSENASFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQILSSILYRNDDST 122

Query: 185 ------HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPM 238
                 H +L R + I +V  F+  PL  K+++ +L  AS +A++S+  +   ++     
Sbjct: 123 GDSQEHHMFLDRRLCISLVMMFVIAPLCFKKSLNSLRHASMIAIVSVAYLCGLIIFH--- 179

Query: 239 LPYDWKGHSLKLSDFFMKA-------TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 291
             + ++    +   +FM         +   +L +  FA  CHHN   +     ++S    
Sbjct: 180 --FLYRSELERGQVYFMTPHQDAQSHSPLTTLPIFVFAYTCHHNMFSVINEQADKSFKIL 237

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
            R+  ++I ++ +   ++G +G+  F +   GN++  +P +     I RL     +   F
Sbjct: 238 RRIPILAISLAYVLYVVIGGTGYMTFGDNIVGNIITLYPNS-IYTTIGRLAMLLLVTLAF 296

Query: 352 PMEIFVLRDVVGNLL----------------------------HECNLIKNYDEHTQL-- 381
           P++    R  + N++                             +  + +  +E + L  
Sbjct: 297 PLQCHPCRSSIKNMIVFIKNLRKDKTDDSTAGFIPLDDLSSEDPQEEVAQQNNEQSNLPI 356

Query: 382 -SGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLTSKKK 439
            S +Q  VIT  ++  +  ++++  +L  +  ++GAT ++++++ILP  +   L+ S+  
Sbjct: 357 ESSRQTNVITLCILIFSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEFT 416

Query: 440 SWKERLP 446
           +  +R+P
Sbjct: 417 NSNDRVP 423

>KLTH0C06006g Chr3 (518793..520130) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 445

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 88/415 (21%), Positives = 174/415 (41%), Gaps = 77/415 (18%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
            SS+    + L ++  GAGI+  P+A +  G+L   L +  + F    +L  ++I     
Sbjct: 2   SSSLGSGVLTLLHTACGAGILAMPYAFRPFGVL---LGFGMIAFCGACSLAGLMI----- 53

Query: 126 GKRTYQGTVEHVMGKKG------------KLLILFTNGLF--AFXXXXXXXXXXXDTIPH 171
                QG V     ++             +L ++F   +    F           D +P 
Sbjct: 54  -----QGRVSKYAAERNASFFALAQVTYPQLSVIFDLAIAVKCFGVGVSYLVVVGDLMPR 108

Query: 172 VLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLT 231
           +  A F+ +       L RN+ I +V  F+  PL   + +++L  AS +A+ S+  + + 
Sbjct: 109 IF-ATFTSHG----LLLSRNLHITLVMLFVVSPLCFMKRLDSLRYASMVAISSVAYLCVL 163

Query: 232 VVIRGPMLPYDW--------KGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSM 283
           V++      Y W        +GH          A +     +  FA  CHHN   I   +
Sbjct: 164 VLVH-----YVWPSDEIRELRGHVSLGKPVGSFAALLSCFPIFVFAYTCHHNMFSIVNEL 218

Query: 284 RNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCF 343
           R+ S+    +++ IS+ +++    L+G SG+A F +   GN++  +P    A  + R+  
Sbjct: 219 RDNSLKGIYKVSIISVALAMSLYLLIGGSGYATFGDNVAGNIIMLYP-QSAATTVGRVAI 277

Query: 344 GFNMLTTFPMEIFVLRDVVGNLLH-----------------ECNLIKNYDEH-------- 378
              ++  FP++    R  V ++LH                    LI + D          
Sbjct: 278 ALLVMLAFPLQCHPARASVDHILHYFGAGKSHEAAPSPSSESSQLIPSSDTEDIVVEEGG 337

Query: 379 ------TQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
                   L GK+ + IT+S++ ++  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 338 PRQLAVMPLEGKRFIAITTSILLLSYLLAISVTSLARVLAVVGATGSTSISFILP 392

>Kwal_27.10702 s27 (455802..457205) [1404 bp, 467 aa] {ON} YER119C -
           Hypothetical ORF [contig 33] FULL
          Length = 467

 Score = 84.0 bits (206), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 85/405 (20%), Positives = 168/405 (41%), Gaps = 41/405 (10%)

Query: 57  NDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLR 116
           + +   N   SS+    + L ++  GAGI+  P+A K  G++ G    V  G      L 
Sbjct: 16  SSIYNPNAMSSSVGSGVLTLLHTACGAGILAMPYAFKPFGLVLGFCMIVFCGACSATGLM 75

Query: 117 LIVINLTLAGKRTYQG-TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 175
           L       A +R      +  +   +  ++      +  F           D +P +  A
Sbjct: 76  LQARVSKYAKERNASFFALSQITYPQLSVVFDLAIAVKCFGVGVSYLVVVGDLMPRIF-A 134

Query: 176 IFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR 235
            F+ +       L RN  I +V   I  PL   R +++L  AS +AV S+  + + VV+ 
Sbjct: 135 TFTSHS----LLLNRNFHITLVMALIVSPLCFMRRLDSLRYASMIAVSSVAYLCVLVVVH 190

Query: 236 GPMLP----YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 291
             + P     + KG+          + +     +  FA  CHHN   I   +R+ S+   
Sbjct: 191 F-LFPSEELRELKGYVSIQKPAGSFSALLSCFPIFVFAYTCHHNMFSIINELRDNSLKGI 249

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
            ++  IS+ +S+    L+G SG+A F +   GN++  +P + T   I R+     ++  F
Sbjct: 250 YKVCAISVALSMTLYLLIGGSGYATFGDNVPGNIITLYPQSTTT-TIGRVAIALLVMLAF 308

Query: 352 PMEIFVLRDVVGNLLH------------------------ECNLIKNYDEHTQ-----LS 382
           P++    R  + +++                           +++   D   Q     L 
Sbjct: 309 PLQCHPARASIDHIIQYFSKASDNPLQNSEASHLISSPRVSEDVMAEEDSPQQPQVVPLE 368

Query: 383 GKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
           GK+ + IT+ ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 369 GKRFIAITAGILIFSFLLAISVTSLARVLAVVGATGSTSISFILP 413

>Skud_5.260 Chr5 (420651..421997) [1347 bp, 448 aa] {ON} YER119C
           (REAL)
          Length = 448

 Score = 83.2 bits (204), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 82/405 (20%), Positives = 178/405 (43%), Gaps = 52/405 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL--RLIVINLTL 124
           +S+R   + L ++  GAGI+  P+A K  G++ G++     G     +L  +  V     
Sbjct: 3   ASIRSGALTLLHTACGAGILAMPYAFKPFGLMPGVIMIAVCGVCAMQSLFIQARVAKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
            G+ ++   +  ++     ++      +  F           D +P ++ +++++N    
Sbjct: 63  QGRASFSA-LTRLINPNLSIVFDLAIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNA--- 117

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWK 244
            + L RNV I ++  F+  PLS  + + +L  AS +A+ S+  + + V++   + P +  
Sbjct: 118 -WLLSRNVQISLIMVFLVAPLSFLKKLNSLRYASMIAISSVAYLCVLVLVHY-IAPSEEI 175

Query: 245 GH-SLKLSDFFMKAT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISI 299
            H   ++S FF K +    I  +  +  FA  CHHN   I    R+       ++  I+I
Sbjct: 176 LHMKGRISYFFPKQSHDLNILNTFPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAI 235

Query: 300 IISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLR 359
            +++I    +G +G+  F +   GN++  +P T T+  + R+     ++  FP++    R
Sbjct: 236 SLALILYVAIGCAGYLTFGDNIIGNIIMLYPQT-TSSTVGRVAIVLLVMLAFPLQCHPAR 294

Query: 360 DVVGNLLHE----------------------CNLIKN---------------YDEHTQLS 382
             +  +L                          LI++                 + T L 
Sbjct: 295 ASIHQILQHFTEENATISTTSTSSPAPTNESSPLIRDNSLDINEVIEEESIYQPKETPLK 354

Query: 383 GKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
           GK  +VIT +++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 355 GKSFIVITCAILIASYFVAISVSSLARVLAIVGATGSTSISFILP 399

>Ecym_7133 Chr7 (264196..265569) [1374 bp, 457 aa] {ON} similar to
           Ashbya gossypii AGL285C
          Length = 457

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 88/410 (21%), Positives = 174/410 (42%), Gaps = 55/410 (13%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           +SS++   + L ++  GAGI+  P+A ++ G+L G L  V  GF     L L        
Sbjct: 2   RSSVQSGVLTLLHTACGAGILAMPYAFRSFGLLPGFLIIVFCGFSALTGLVLQSYVSKYV 61

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAIFSQNDGN 183
             R +    E       +L I+F   +    F           D +P ++ + F+ N   
Sbjct: 62  APR-HVSFFELAQISYPELSIVFDCAIAVKCFGVGISYMVVVGDLMPQIV-STFTSN--- 116

Query: 184 VHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDW 243
             + L R + I +   FI  PL   R +++L  AS +A+ S+  + + VV        D 
Sbjct: 117 -QWLLERTLQITLCMLFIVTPLCFMRKLDSLRYASMVAISSVAYLCVLVVYHFLFPSSDI 175

Query: 244 KGHSLKLSDFFMK----ATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISI 299
           +     +S  F +    A++  S  +  FA  CHHN   I   +R+ S+    R+  I++
Sbjct: 176 RQAKGIVSIGFPENNSAASMLSSFPIFVFAYTCHHNMFSIVNELRDNSLTNCVRVVLIAM 235

Query: 300 IISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLR 359
            ++V    ++G SG+  F +   GN++  +P + ++  +AR+     ++  FP++    R
Sbjct: 236 GLAVSLYTVIGGSGYLTFGDNITGNIVTIYPRSVSS-TLARIAIVLLVMLAFPLQCHPAR 294

Query: 360 DVVGNLL--------------HECNLIKNYDEH--------------------------- 378
             + N+                E  L+++                               
Sbjct: 295 ASINNIWCYFSESKIFSPLANEESGLMRHEGSPRTPPSNNEFSISPDWSPLQTSSQPIPT 354

Query: 379 -TQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
            T + GK+  VIT+S++  +  ++++  +   +  ++GAT ++++++ILP
Sbjct: 355 TTTIEGKRFFVITTSILIASYTLAVSVSSFARVLAIVGATGSTSISFILP 404

>TPHA0K00670 Chr11 (132771..134165) [1395 bp, 464 aa] {ON} Anc_7.420
           YER119C
          Length = 464

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/339 (23%), Positives = 134/339 (39%), Gaps = 39/339 (11%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLL------SYVALGFIVDWTLRLIV 119
            SS+R   + L ++  GAGI+  P+A +  G+  GL       +   LG I+  T+   V
Sbjct: 2   SSSVRSGTLTLLHTACGAGILAMPYAFQPFGVFPGLFLIAFCGACAMLGLILQSTVAKYV 61

Query: 120 INLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQ 179
                  +      +  V   K  +L      +  F           D +P +L   F+ 
Sbjct: 62  -----PERNASFFALSQVTNPKFSVLFDIAIAVKCFGVGVSYMIVVGDVMPQIL-GTFTD 115

Query: 180 NDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV------ 233
            +    F+L RNV I +V  FI  PL   +N+ +L  AS  A+ ++I +   V+      
Sbjct: 116 TE----FFLNRNVNITIVMLFIVTPLCFLKNLNSLRYASIAAISAVIYLCFLVMFHFFIP 171

Query: 234 ---IRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 290
              IR    P  W      L+          +L +  FA  CHHN   +F  +  +    
Sbjct: 172 NEEIRDTRGPVSWGFPKDGLNP-------LNTLPIFVFAYTCHHN---MFSVINEQQDIH 221

Query: 291 FTRLTHISIIISVICCAL---MGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNM 347
           F +L  I I   ++ C L   +G SG+  F     GN++  +     A  + R+     +
Sbjct: 222 FNKLKQICIFAMLLACTLYIIIGGSGYLTFGNAITGNIITLY-SNSAATTVGRIAIVILV 280

Query: 348 LTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQH 386
           +  FP++    R  + ++LH   LI   +   Q S   H
Sbjct: 281 MLAFPLQCHPARASINHILHYFQLINCDNNQVQESESGH 319

>Suva_5.240 Chr5 complement(375238..376584) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 85/408 (20%), Positives = 176/408 (43%), Gaps = 58/408 (14%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL--RLIVINLTL 124
           +S+R   + L ++  GAGI+  P+A K  G++ G++  V  G     +L  +  V     
Sbjct: 3   TSIRSGVLTLLHTACGAGILAMPYAFKPFGLVPGVVMIVICGACAMQSLLIQARVARYVA 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
            GK ++  T+  ++  +  ++      +  F           D +P ++    S   GN 
Sbjct: 63  PGKASFS-TLTRLINPRLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIM----SSWTGNA 117

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYD-- 242
            + L RNV I ++  F   PLS  + + +L  AS +A+ S+  + + V++   ++P D  
Sbjct: 118 -WLLSRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLVHY-VVPSDEI 175

Query: 243 --WKGHSLKLSDFFMKAT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTH 296
              KG   ++S  F + +       +L +  FA  CHHN   I    ++       ++  
Sbjct: 176 LRLKG---RVSYLFPQQSHDLNFLNTLPIFVFAYTCHHNMFSIINEQKSVRFEHVMKIPL 232

Query: 297 ISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIF 356
           ISI +++     +G +G+  F +   GN++  +P T ++  + R+     ++  FP++  
Sbjct: 233 ISISLALALYIAIGCAGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCH 291

Query: 357 VLRDVVGNLLH----------------------ECNLIKN---------------YDEHT 379
             R  +  +L                          LI+N                 + T
Sbjct: 292 PARASIHQILQYFTEENATTSTTSVAGRTVTNESSPLIRNNSIDINEVIEEEPIYQPKDT 351

Query: 380 QLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
            L GK  ++IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 352 PLRGKSFIIITCGILVASYCVAISVSSLAHVLAIVGATGSTSISFILP 399

>Skud_2.19 Chr2 (33154..34533) [1380 bp, 459 aa] {ON} YBL089W (REAL)
          Length = 459

 Score = 78.2 bits (191), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 83/428 (19%), Positives = 180/428 (42%), Gaps = 55/428 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF--IVDWTLRLIVINLTL 124
           S++R   + L ++  GAG++  PFA K  G++ GL++    G   +    L+  +     
Sbjct: 3   SNVRSGVLTLLHTACGAGVLAMPFAFKPFGLMPGLITLTICGICSLCGLLLQTRIAKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
             +      +  ++     ++  F   +  F           D +P ++ +I  ++  + 
Sbjct: 63  KSENVSFAKLTQLINPSLSIVFDFAIAVKCFGVGVSYLIIVGDLMPQIVSSILYRDHDST 122

Query: 185 ------HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPM 238
                 H  L R + I ++  F+  PL  K+++ +L  AS +A+IS+        + G +
Sbjct: 123 GGPQEHHGILDRRLYISLIMLFVIAPLCFKKSLNSLRHASMIAIISV------AYLSGLI 176

Query: 239 LPYDWKGHSLKLSD-FFM-------KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAK 290
           + +    H L+    +FM             +L +  FA  CHHN   +     ++    
Sbjct: 177 IYHFLNRHQLERGQVYFMVPHRDTESHAPLTTLPIFVFAYTCHHNMFSVINEQADKGFRI 236

Query: 291 FTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTT 350
             R+  I+I ++ +   ++G +G+  F +   GN+L  +P +  +  I RL     ++  
Sbjct: 237 LKRIPIIAISLAFVLYVIIGGAGYMTFGKNIVGNILTLYPNS-VSTTIGRLAMLLLVMLA 295

Query: 351 FPMEIFVLRDVVGNLL------HECNLIKNYDEHTQL----------------------- 381
           FP++    R  + N++       +  L +N D+   L                       
Sbjct: 296 FPLQCHPCRSSIKNIIIFIENFRKGKLQENRDDCIPLDVLSSVNSQEESRQQNNEQQNFP 355

Query: 382 --SGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLTSKK 438
             S +   +IT  ++  +  ++++  +L  +  ++GAT ++++++ILP  +   L+ S+ 
Sbjct: 356 SESSRHTNIITLCILGSSYLLAISITSLAKVLAIVGATGSTSISFILPGLFGYKLIGSEY 415

Query: 439 KSWKERLP 446
            S  ER+P
Sbjct: 416 ISRDERVP 423

>YER119C Chr5 complement(399496..400842) [1347 bp, 448 aa] {ON}
           AVT6Vacuolar aspartate and glutamate exporter; member of
           a family of seven genes (AVT1-7) related to vesicular
           GABA-glycine transporters; involved in
           compartmentalizing acidic amino acids in response to
           nitrogen starvation
          Length = 448

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 85/405 (20%), Positives = 173/405 (42%), Gaps = 52/405 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL--RLIVINLTL 124
           +S+R   + L ++  GAGI+  P+A K  G++ G++  V  G     +L  +  V     
Sbjct: 3   ASIRSGVLTLLHTACGAGILAMPYAFKPFGLIPGVIMIVLCGACAMQSLFIQARVAKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
            G+ ++      +    G +  L    +  F           D +P ++ +++++N    
Sbjct: 63  QGRASFSALTRLINPNLGIVFDL-AIAIKCFGVGVSYMIVVGDLMPQIM-SVWTRNA--- 117

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYD-- 242
            + L RNV I ++  F   PLS  + + +L  AS +A+ S+  + + V++   + P D  
Sbjct: 118 -WLLNRNVQISLIMLFFVAPLSFLKKLNSLRYASMVAISSVAYLCVLVLLHY-VAPSDEI 175

Query: 243 --WKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISI 299
              KG  S  L        +  +L +  FA  CHHN   I    R+       ++  I+I
Sbjct: 176 LRLKGRISYLLPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHVMKIPLIAI 235

Query: 300 IISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLR 359
            +++I    +G +G+  F +   GN++  +P   ++  I R+     ++  FP++    R
Sbjct: 236 SLALILYIAIGCAGYLTFGDNIIGNIIMLYPQAVSS-TIGRIAIVLLVMLAFPLQCHPAR 294

Query: 360 DVVGNLLHE----------------------CNLIKN---------------YDEHTQLS 382
             +  +L                          LI++                 + T L 
Sbjct: 295 ASIHQILQHFAEENVSISATSADEPTVATESSPLIRDSSLDLNEVIEEESIYQPKETPLR 354

Query: 383 GKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
           GK  +VIT S++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 355 GKSFIVITCSILVASYLVAISVSSLARVLAIVGATGSTSISFILP 399

>CAGL0H04587g Chr8 (431944..433281) [1338 bp, 445 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119c
          Length = 445

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 84/421 (19%), Positives = 174/421 (41%), Gaps = 53/421 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAG 126
           S+ R   + L ++  GAGI+  P+A +  G++  +   +  G          ++ L L  
Sbjct: 2   STARSGVVTLLHTACGAGILAIPYAFRPFGLVPAIFMLLFCGLCS-------MMGLLLQS 54

Query: 127 KRTYQG--------TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
           +    G        ++  V+     +L      +  F           D +P +   + S
Sbjct: 55  RIAKYGPLKNVSFFSLAQVVNPASSILFDAAIAIKCFGVGVSYMIVVGDLMPKIWSRVSS 114

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPM 238
                    L RNV I +V  FI  PL   R + +L  AS +A+ S+  + + V++    
Sbjct: 115 SG-----LLLSRNVNITLVMLFIVGPLCFMRRLNSLRYASMIAIGSVAYLCILVIVHFAH 169

Query: 239 LPYDWKGHSLKLSDFFM--KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTH 296
              + +    ++S      + T   +L +  FA  CHHN   +    +N        +  
Sbjct: 170 QTTELRELKGEVSVGLPHGEPTPLTTLPIFVFAYTCHHNMFSVINEQKNTGFTYVRYIAI 229

Query: 297 ISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIF 356
           +SI+++ +   ++G +G+  F +   GN++  +P T  +  I R+     ++  FP++  
Sbjct: 230 VSILVAFVLYVVIGSTGYLTFGDNITGNIIALYPDT-LSTTIGRIAIVLLVMLAFPLQCH 288

Query: 357 VLRDVVGNLLHEC------------------NLIKNYD-----------EHTQLSGKQHV 387
             R+ + N++                     NL  N D           E   +  K+ +
Sbjct: 289 PARESINNMIKYVQDRYSPQTSYELTAVDADNLEINNDVTSINSRANDKEEECMDTKRFM 348

Query: 388 VITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL-LLTSKKKSWKERLP 446
           +IT+ ++F +  ++++  +L  +  ++GAT ++T+++ILP Y    L+ ++  S   +LP
Sbjct: 349 IITACILFCSYLLAISVTSLARVLAIVGATGSTTISFILPGYFGWSLIGTEYTSNGNQLP 408

Query: 447 F 447
            
Sbjct: 409 L 409

>KNAG0B02190 Chr2 (418852..420237) [1386 bp, 461 aa] {ON} Anc_7.420
           YER119C
          Length = 461

 Score = 75.5 bits (184), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 99/462 (21%), Positives = 185/462 (40%), Gaps = 100/462 (21%)

Query: 68  SMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGK 127
           ++R   + L ++  GAGI+  PFA K  G++ GL        ++ W        L L   
Sbjct: 4   TVRSGVITLLHTACGAGILAMPFAFKPFGLVLGLT-------MITWCGLCAFAGLLL--- 53

Query: 128 RTYQGTVEHVMGKKG------------KLLILFTNGLF--AFXXXXXXXXXXXDTIPHVL 173
              Q  V     +KG             L ++F   +    F           D +P + 
Sbjct: 54  ---QCRVSRYAPEKGVSFFVLSSLINRNLSVVFDCAIAVKCFGVGVSYMIVVGDLLPQIW 110

Query: 174 RAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISM----IIIV 229
            ++++ N       L R+  I MV  FI  PL   + + +L  AS +A+ ++    ++++
Sbjct: 111 -SVWTSNK----LLLNRDFHITMVMIFIVAPLCFMKKLNSLRYASMIAISAVAYLCVLVI 165

Query: 230 LTVVIRGPMLPY--DWKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNR 286
              + + P   +  D KG  S+ L     +  I  +L +  FA  CHHN     FS+ N 
Sbjct: 166 YHFIFQDPNDTHFQDLKGRISIGLPR--DEPPILTTLPIFVFAYTCHHN----MFSVINE 219

Query: 287 SV-AKF---TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLC 342
            V  KF   T++   S+ ++ +   ++GYSG+  F +K  GN++  +P   ++  I R+ 
Sbjct: 220 QVDQKFNVITKIAKYSMSLAFLLYIVIGYSGYLTFGDKIVGNIVTLYPNNASS-TIGRIA 278

Query: 343 FGFNMLTTFPMEIFVLRDVVGNLLH----------------------------------- 367
               +  TFP++    R  + +++H                                   
Sbjct: 279 IAILVTLTFPLQCHPARASIHHIIHFFQARSAENGNGSAMVLNQMEGVSPELETTPLTDA 338

Query: 368 -ECNLIKNYDEH--------TQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATT 418
             C  +    E           L GK+ + IT +++F +  ++++  +L  +  ++GAT 
Sbjct: 339 ANCAEVDTAIEEGSPEELQVMPLEGKRFIFITCTILFCSYLLAVSVTSLAKVLAIVGATG 398

Query: 419 ASTMAYILPPYTNLLLTSKKKSWKERLPF------YLCICFG 454
           ++++++ILP      L   +      LPF      YL +C  
Sbjct: 399 STSISFILPGIFGYKLIGSECETGAELPFQTKMFKYLGLCLA 440

>SAKL0F13134g Chr6 complement(1038673..1040205) [1533 bp, 510 aa]
           {ON} similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119C AVT6 Vacuolar transporter exports aspartate and
           glutamate from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 510

 Score = 75.5 bits (184), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 100/460 (21%), Positives = 183/460 (39%), Gaps = 96/460 (20%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGT 133
           + L ++  GAGI+  P+A K  G+L G L  V  G      L L             QG 
Sbjct: 52  VTLLHTACGAGILAMPYAFKAYGLLPGFLVLVLCGVFSTTGLLL-------------QGQ 98

Query: 134 VEHVMGKKG------------KLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQND 181
           V   + ++             +L I+F   L                I  +L  IFS N 
Sbjct: 99  VSKYVPRRQASFFSLAQITYPQLSIIFD--LAIAVKCLGVGVSYMVVIGDLLPQIFS-NF 155

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPY 241
            +    L RN  I +V  FI  PL   + +++L  AS +A IS +  +  +V+   + P 
Sbjct: 156 TSHEILLERNFHITVVMIFIVAPLCFMKRLDSLRYASMIA-ISAVGYLCVLVVAHFLFPS 214

Query: 242 ----DWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
               D KG         +  ++  S  +  FA  CHHNT  I   +++ SV    ++   
Sbjct: 215 QEIKDLKGTVSLFRPKGLHTSMLSSFPIFVFAYTCHHNTFSIVNELKDNSVENVRKVVIG 274

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           ++ ++V     +G SG+  F +   GN++  +P + T+  + R+     ++  FP++   
Sbjct: 275 AMGLAVCLYIAIGGSGYGTFGDNIGGNIIMLYPHS-TSTTVGRIAIVLLVMLAFPLQCHP 333

Query: 358 LRDVVGNLLHE-----------------------------CN-------LIKN------Y 375
            R  + +++H                              CN       L+++       
Sbjct: 334 ARASINHIIHHLFEERRGGAQNGEERESNAASKNRTDESACNGNSESSRLVQSTETSIPV 393

Query: 376 DEHTQ-----------LSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAY 424
           DE  +           L G++ VVITS ++  +  ++++  +L  +  ++GAT ++++++
Sbjct: 394 DELIEECSARQPKVVPLEGRKFVVITSCILIFSYALAVSVTSLARVLAVVGATGSTSISF 453

Query: 425 ILPPYTNLLL------TSKKKSWKERLPFYLCI---CFGF 455
           ILP      L       + +  WK R   Y+ +   C+G 
Sbjct: 454 ILPGIFGYQLIGSEYENTSEMPWKTRWTKYIALALTCWGL 493

>Smik_5.264 Chr5 complement(408587..409933) [1347 bp, 448 aa] {ON}
           YER119C (REAL)
          Length = 448

 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 77/404 (19%), Positives = 171/404 (42%), Gaps = 50/404 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL--RLIVINLTL 124
           +S++   + L ++  GAGI+  P+A K  G++ G++  V  G     +L  +  V     
Sbjct: 3   ASIKSGVLTLLHTACGAGILAMPYAFKPFGLVPGMIMIVICGACAMQSLFIQARVAKYVP 62

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
            G+ ++  T+  ++     ++      +  F           D +P ++ ++++ N    
Sbjct: 63  QGRASFS-TLTRLINPSLSIVFDLAIAVKCFGVGVSYMIVVGDLMPQIM-SVWTNNA--- 117

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWK 244
            + L RNV I ++  F   PL   + + +L  AS +A+ S+  +   V++       D  
Sbjct: 118 -WLLSRNVQISLIMLFFVTPLCFLKKLNSLRYASMIAISSVAYLCALVLVHYIAPSEDIL 176

Query: 245 GHSLKLSDFFMKAT----IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISII 300
               ++S FF   +    +  +L +  FA  CHHN   I    R+       ++  I++ 
Sbjct: 177 RLRGQISYFFPPQSHDLNVLNTLPIFVFAYTCHHNMFSIINEQRSSRFEHIMKIPLIAVS 236

Query: 301 ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRD 360
           +++I    +G +G+  F +   GN++  +P T ++  + R+     ++  FP++    R 
Sbjct: 237 LALILYIAIGCTGYLTFGDNIIGNIIMLYPQTVSS-TVGRIAIVLLVMLAFPLQCHPARA 295

Query: 361 VVGNLLH--------------------------------ECNLIKNYD-----EHTQLSG 383
            +  +L                                 + N +   +     + T L G
Sbjct: 296 SIHQILQHLERENITTSTTSVSGPTFANENSPLMGDRGLDINEVIEEESIYQPKETSLKG 355

Query: 384 KQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
           K  V IT  ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 356 KSFVFITCGILLASYLVAISVSSLARVLAIVGATGSTSISFILP 399

>Kpol_1045.20 s1045 (42443..43843) [1401 bp, 466 aa] {ON}
           (42445..43845) [1401 nt, 467 aa]
          Length = 466

 Score = 73.2 bits (178), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 73/308 (23%), Positives = 135/308 (43%), Gaps = 15/308 (4%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV-INLTL 124
            SS+R   + L ++  GAGI+  P+A K  G++ G +  +  G      L L   ++  +
Sbjct: 2   SSSVRSGVLTLLHTACGAGILAMPYAFKPYGLITGFIMIIICGICAMIGLLLQSRVSSYV 61

Query: 125 AGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
             +     T+  +      ++      +  F           D +P VL    +      
Sbjct: 62  PVRNASFFTLTQITNPNLSIVFDLAIAIKCFGVGVSYMIVVGDVLPQVLSTFTN------ 115

Query: 185 HFWL-RRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDW 243
           H WL  RNV I +V  FI  PL   +N+ +L  AS LA+ S+  +   V+I   ++P D 
Sbjct: 116 HEWLLNRNVNITLVMLFIVTPLCFLKNLNSLRYASMLAISSVAYLCALVLIHF-IMPND- 173

Query: 244 KGHSLK--LSDFFMKATI--FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISI 299
           + H+ K  +S    K  +    +L +  FA  CHHN   +     + +     ++  IS+
Sbjct: 174 ETHNFKGDVSWGLPKNGLNPLTTLPIYVFAYTCHHNMFSVINEQMDPTYNSVKKIAIISM 233

Query: 300 IISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLR 359
           I++     L+G +G+  F +   GN++  +P  + +  I R+   F +   FP++    R
Sbjct: 234 ILAGFLYILIGGAGYLTFGDHITGNIITLYP-QNISTTIGRIAIIFLVTLAFPLQCHPAR 292

Query: 360 DVVGNLLH 367
             + +++H
Sbjct: 293 ASINHIIH 300

>KLLA0E06931g Chr5 (628083..629453) [1371 bp, 456 aa] {ON} similar
           to uniprot|P40074 Saccharomyces cerevisiae YER119C AVT6
           Vacuolar transporter exports aspartate and glutamate
           from the vacuole and to YBL089W uniprot|P38176
           Saccharomyces cerevisiae YBL089W AVT5 Putative
           transporter, members of a family of seven S. cerevisiae
           genes (AVT1-7) related to vesicular GABA-glycine
           transporters
          Length = 456

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 89/413 (21%), Positives = 169/413 (40%), Gaps = 63/413 (15%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL--IVINLT 123
            SS++   + L ++  GAGI+  P+A K  G++ GL   +  G      L L   V    
Sbjct: 2   SSSVQSGVITLLHTACGAGILAMPYAFKPFGLILGLSMIIFCGLCSSTGLYLQSYVSKYV 61

Query: 124 LAGKRTYQGTVEHVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAIFSQND 181
             G  ++          + +L ++F   +    F           D +P ++        
Sbjct: 62  PPGHASFFTLCRL---TRPELSVVFDAAIAVKCFGVGVSYLVVVGDLLPQIMSTF----- 113

Query: 182 GNVHFWL-RRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR--GPM 238
              H WL  R   I  VT  I  PL   + +++L   S +A+ ++  + + VV     P 
Sbjct: 114 -TTHGWLLSRQFHITAVTLIIVTPLCFIKKLDSLRYTSSIAITAVGYLCVLVVFHFAVPN 172

Query: 239 LPYD-WKGHS--LKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLT 295
              D  +GH    K SD  + +++  S  +  FA  CHHN   I     ++S+   T+L 
Sbjct: 173 SEIDHLRGHVSIWKPSD--VDSSMLSSFPIFVFAYTCHHNMFSIINEQSDKSLDSITKLI 230

Query: 296 HISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEI 355
            I+I +++     +G  G+  F +   GN++  +P + ++  I R+     ++  FP++ 
Sbjct: 231 RIAITLAMSLYISIGALGYCTFGDHITGNIITLYPNSISS-TIGRIAIALLVILAFPLQC 289

Query: 356 FVLRDVVGNLLH-----------------------------------EC--NLIK----N 374
              R  V ++LH                                   EC   LI+    N
Sbjct: 290 HPARASVNHILHYFSKGNTHPPMTTTSAEQNSLLRDSELESSEQLTYECEDELIEENSAN 349

Query: 375 YDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
                 L G + + ITS ++  +  ++++  +L  +  ++GAT ++++++ILP
Sbjct: 350 QPPVVTLEGPRFIFITSGILLFSYILAMSVTSLANVLSIVGATGSTSISFILP 402

>NDAI0E04010 Chr5 (888700..890115) [1416 bp, 471 aa] {ON} Anc_7.420
          Length = 471

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/435 (18%), Positives = 174/435 (40%), Gaps = 56/435 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL----------R 116
           S++R   + L ++  GAGI+  P+A K  G++ G +     G    W L          +
Sbjct: 3   STIRYGVLTLLHTACGAGILAMPYAFKPFGLIPGFIMIAICGLCSLWGLILQARVTKYSK 62

Query: 117 LIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAI 176
               + T   +     ++  ++     ++      +  F           D +P +L  +
Sbjct: 63  TDDNDDTANDRSVSFFSLTQIINPNLSVIFDLAIAIKCFGVGVSYMIVVGDLMPQILSHL 122

Query: 177 FSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRG 236
             ++       L RN  I ++   I  PL   +N+ +L  AS +A+ S++ + + VV   
Sbjct: 123 IPESHSTSSLLLSRNFHITIMMLCIVSPLCFMKNLSSLRYASMVAISSVVYLCVLVVFHF 182

Query: 237 PMLPYDWKGHSLKLSDFFM--KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
                + K    +LS +    + +   +L +  FA  CHHN   +     + S     +L
Sbjct: 183 LSPSQEIKDLKGELSYWLPNNEPSPLVTLPIFVFAYTCHHNMFSVINEQIDNSFHNIKKL 242

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
             I++ ++     ++G SG+  F +   GN++  +P + ++  I R+   F +   FP++
Sbjct: 243 AIIAMSLAFSLYIIIGGSGYYTFGDNIVGNIITLYPQSVSS-TIGRMAIVFLVTLAFPLQ 301

Query: 355 IFVLRDVVGNLL------------------------------HECNLIKNYDEHT----- 379
               R  + +++                                  LI++    T     
Sbjct: 302 CHPARASIHHIILYITMKINDAKEIKPSNPQQEPLALSANNQERAMLIRSERSDTLIEEE 361

Query: 380 --------QLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTN 431
                    L GKQ ++IT+S++  +  ++++  +L  +  ++GAT ++++++ILP    
Sbjct: 362 SPLQPVTVPLEGKQFILITTSILICSYLLAISVSSLAHVLAIVGATGSTSISFILPGVFG 421

Query: 432 LLLTSKKKSWKERLP 446
             L   +    E+LP
Sbjct: 422 YKLIGSEMLTTEQLP 436

>TDEL0C02820 Chr3 complement(500004..501368) [1365 bp, 454 aa] {ON}
           Anc_7.420 YER119C
          Length = 454

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 81/410 (19%), Positives = 170/410 (41%), Gaps = 60/410 (14%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA- 125
           SS R   + L ++  GAG++  P+  K  G++ GLL  +   F    +L  +++   +A 
Sbjct: 3   SSTRSGVITLLHTACGAGVLAMPYGFKPFGLIPGLLVII---FCALCSLGGLLLQAKVAR 59

Query: 126 ---GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDG 182
               K     T+  ++     ++      +  F           D  P +  ++F+ N  
Sbjct: 60  YVPEKSASFFTLTQIINPNLSVIFDIAIAIKCFGVGVSYMIVVGDLTPQI-ASVFTSN-- 116

Query: 183 NVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLP-- 240
             H  L RNV I ++  FI  PL   + + +L  AS +A++S+  + + + I   + P  
Sbjct: 117 --HLLLDRNVHITLIMLFIVSPLCFLKRLSSLRYASLIALLSVAYLCVLIFIHF-VWPSE 173

Query: 241 --YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHIS 298
             +D KGH + L     +     +L +  FA  CHHN   +    ++ S     ++   +
Sbjct: 174 EIHDLKGH-VSLWIPHDETNPLTTLPIFVFAYTCHHNMFSVINEQKDTSFRHIKKVAIYA 232

Query: 299 IIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
           + +++    L+G  G+  F +   GN++  +P   +   + R+     ++  FP++    
Sbjct: 233 MFLALSLYLLIGGMGYLTFGDHIIGNIIKLYPQFAST-TVGRIAIVLLVMLAFPLQCHPA 291

Query: 359 RDVVGNLL------------------------HECNLIKNYDEH---------------- 378
           R  + ++L                            LI N D+                 
Sbjct: 292 RASINHILFYLQEHLSQSKQNTRTDNTANAVDEASTLIVNGDQEYMIDELIEEDSANQPP 351

Query: 379 -TQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
              L G++ V+IT  L+  +  ++++  +L  +  ++G+T ++++++ILP
Sbjct: 352 VVPLHGRKFVIITIFLLLASYLLAISVSSLARVLAVVGSTGSTSISFILP 401

>CAGL0G03619g Chr7 complement(349789..351171) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40074 Saccharomyces cerevisiae
           YER119c or uniprot|P38176 Saccharomyces cerevisiae
           YBL089w or uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 460

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 139/315 (44%), Gaps = 30/315 (9%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
            S++    + L ++  GAGI+  P+A K  G++ G+L  +  G     TL   +I   +A
Sbjct: 2   SSTVGSGVLTLLHTACGAGILAMPYAFKPFGLIFGILMIMFCGLCSMMTL---LIQARVA 58

Query: 126 G-----KRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQN 180
           G     K     ++  V+ K   ++      +              D +P +  +I ++ 
Sbjct: 59  GYAPDSKNASFFSLTQVINKNLSVIFDLAIAIKCLGVGISYLIVVGDLLPQIAGSITTKP 118

Query: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLP 240
                  L R+  I +V  F+  PL +K+ + +L   S LA++S+  + + V+I   ++ 
Sbjct: 119 -----LLLNRDFHITLVMIFVVTPLCLKKRLNSLRHTSSLAIMSVAYLCVLVIIH--LVS 171

Query: 241 YD-----WKGH-SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
            D      KGH S+ L       +   +L +  FA  CHHN   +F  +  +   +F   
Sbjct: 172 SDGDIEQMKGHVSIGLPHH--GPSPLTTLPIFVFAYTCHHN---MFSVINEQKDNRFKTT 226

Query: 295 THISIIISVICC---ALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
            +I +I + + C    L+G  G+  F +K  GN++  +P + ++I I R+     +   F
Sbjct: 227 KYIPLISTSLACILYILIGGCGYMTFGDKIVGNIITLYPHSVSSI-IGRIAIALLVTLAF 285

Query: 352 PMEIFVLRDVVGNLL 366
           P++    R  + N+L
Sbjct: 286 PLQCHPARSSIHNIL 300

>TBLA0F01400 Chr6 complement(345013..346374) [1362 bp, 453 aa] {ON}
           Anc_7.420 YER119C
          Length = 453

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 97/441 (21%), Positives = 181/441 (41%), Gaps = 86/441 (19%)

Query: 68  SMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALG--FIVDWTLRLIVINLTLA 125
           S+R   + L ++  GAGI+  P+A K  G++ G+L  +      I+   L++ V   T  
Sbjct: 2   SLRAGTITLLHTACGAGILAVPYAFKPFGVIPGMLILLVCSSTAILGLLLQVKVTKYTPV 61

Query: 126 GKRTYQGTVEHVMGKKGKLLILF--TNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGN 183
           G++      E       +L +LF     +  F           D +P +L    S N   
Sbjct: 62  GEK--HSFFELASKIHPRLAVLFDIAIAIKCFGVATSYLIAVGDLLPTLLH---SSN--- 113

Query: 184 VHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMII--IVLTVVIRGPMLPY 241
                 R ++I +V  FI  PLS  + I AL   SFLAV+S+I   I++T     P    
Sbjct: 114 ------RFLLITLVWGFIIAPLSFLKKITALRYTSFLAVVSVIYLSILVTFHYADPSQEI 167

Query: 242 -DWKGHSLKLSDFFM------KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
            D +G+   +S FF         + F++L +  FA  CHHN   +F  +  +S  +F++L
Sbjct: 168 IDLRGN---VSLFFPGEDQHNSVSPFKTLPIFVFAYTCHHN---MFAVLNEQSTNEFSKL 221

Query: 295 THISIIISVICCAL---MGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
            +I +    I C +   +G  G+  F      N++  +P    A  + +      +   F
Sbjct: 222 KYIPLTAISIACIMYLIVGTFGYVTFGSNITSNIVAQYPTNSIATILGQTAMLTVVTLAF 281

Query: 352 PMEIFVLRDVVGNLL----------------HECNLIKNY-------------------- 375
           P++    R    N++                 E   I +                     
Sbjct: 282 PLQCQPARASFINIINAFFPRFKYTPPPLQDEESMYISSTADSINNNNNQNSTPSTPRES 341

Query: 376 --DEHTQLSGK------------QHVVITSSLVFITMGISLTTCNLGALFELIGATTAST 421
             +E T +  +            QH+++T+ ++  +  I+++  +L  +  ++GAT +++
Sbjct: 342 TPNETTPIEARSKLPFAQEPTQFQHILLTTIILLGSWLIAISVKSLAHVLAIVGATGSTS 401

Query: 422 MAYILPPYTNLLLTSKKKSWK 442
           +++ILP     +L S+  S++
Sbjct: 402 ISFILPGLFGAILISRDNSFE 422

>TBLA0F01390 Chr6 complement(342433..343719) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 93/407 (22%), Positives = 164/407 (40%), Gaps = 65/407 (15%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF--IVDWTLRLIVINLTLAGKRTYQ 131
           + L ++  GAGI+  PFA K  G+  GL+  V  G   I    L+  +I  T   ++   
Sbjct: 8   VTLLHTACGAGILAIPFAFKPFGLFPGLMVLVVCGIAAIFGLLLQAKIIKYTPTNEKHSF 67

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
             +   +     +L      +  F           D +     A+   N+       R N
Sbjct: 68  FILATKLHPTLAILFDLAIAVKCFGVSTSYLIAIGDFL-----AVLLDNE------YRMN 116

Query: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLS 251
            I   V  FI  PLS  R I AL   S LAV S+  + + V        Y +   S ++S
Sbjct: 117 TI-TFVWLFIILPLSYLRKINALRYTSLLAVTSVFYLCILVT-------YHYCKPSEEIS 168

Query: 252 D-------FFMKAT---IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIII 301
           +       F  K++    F++L +  FA  CHHN   +F  +  +    F RL  I +I 
Sbjct: 169 ELRGTVSLFLPKSSGISPFKTLPIFVFAYTCHHN---MFAVINEQKHTDFKRLKFIPLIA 225

Query: 302 SVICCAL---MGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
             I C L   +G  G+A F      N++  +P       + +      +   +P++    
Sbjct: 226 ISIACILYLIVGCLGYATFGANITSNIVAKYPTNSVLTVLGQTAMLTVVTLAYPLQCQPA 285

Query: 359 RDVVGNLLH--------------ECNLIKNY----DEHTQLSGKQ----------HVVIT 390
           R  + N+L+              E ++   Y    +E+ Q S  +          H ++T
Sbjct: 286 RASILNILYALFPKLKNNKSDVEEASMNDGYQVDLEENKQQSEPERIISEPSIILHSIVT 345

Query: 391 SSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSK 437
           S ++F +  I+++  +L  +  ++GAT ++ +++ILP    ++L  K
Sbjct: 346 SLILFGSWCIAVSVNSLAQVLAIVGATGSTFISFILPGLFAVVLIPK 392

>NCAS0B06210 Chr2 (1171270..1172715) [1446 bp, 481 aa] {ON}
           Anc_2.295
          Length = 481

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 129/323 (39%), Gaps = 48/323 (14%)

Query: 64  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV-INL 122
           +  +S+  + +NL  +I+GAG+   PFA KN GIL G+L  +       + L ++   + 
Sbjct: 2   EPTASVTSSTVNLVKTIVGAGLFAIPFAFKNDGILVGILLIMLAAVTSGFGLFILAKCSK 61

Query: 123 TLAGKRTYQGTVEHVMGKKGKLLILFTNGLFA--FXXXXXXXXXXXDTIPHVLRAIFSQN 180
           TL   R         M     L  LF   +    F           D  P +        
Sbjct: 62  TLINPRN-ASFFSICMLTYPSLSPLFDLAMIVQCFGVGLSYLVLMGDIFPSLF------- 113

Query: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVL--------TV 232
            GN  +W       ++ + FI  PL   + ++ L  +S L  I++I + L         +
Sbjct: 114 GGNRDYW-------IVASAFIVVPLCCLKKLDNLKYSSILGNIALIYLALFIFGVFVKDI 166

Query: 233 VIRGPMLP---------YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSM 283
           +I G             YD KG             +  + S+I FA V   N   I   +
Sbjct: 167 LIEGNTFARGEISWIRIYDGKG-------------LLSTFSIIIFAYVGAMNLFSICREL 213

Query: 284 RNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCF 343
            N S+    ++ + SI IS I   L+G SG+  F    +GN++ ++      I + + C 
Sbjct: 214 ENDSMENILKVINGSIGISSIFFLLVGISGYLTFGSNVQGNIILNYDPNSIWIYLGKFCL 273

Query: 344 GFNMLTTFPMEIFVLRDVVGNLL 366
            F +L +FP+    LR  V NL+
Sbjct: 274 AFMLLLSFPLLFHPLRIAVNNLV 296

>CAGL0M06611g Chr13 complement(681693..683150) [1458 bp, 485 aa]
           {ON} similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088c
          Length = 485

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 130/315 (41%), Gaps = 29/315 (9%)

Query: 63  NDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV-IN 121
           ++  +++  +  NL  +I+GAG+   PFA KN G+  GLL          + L L+   +
Sbjct: 3   DNPTATVGSSITNLVKTIVGAGLFAIPFAFKNDGVAVGLLLIFLAAVTSSFGLILLAKCS 62

Query: 122 LTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFA--FXXXXXXXXXXXDTIPHVLRAIFSQ 179
            TL   R         M     L  LF   +    F           D  P +       
Sbjct: 63  KTLINPRN-SSFFTICMLTYPSLAPLFDLAMVVQCFGVGLSYLVLVGDFFPDLF------ 115

Query: 180 NDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR---- 235
             G   +W+  + I+V+       PL   + ++ L  +S + VI+++ + L +  R    
Sbjct: 116 -GGERKYWILLSAILVV-------PLCCLKKLDNLKYSSIVGVIALLYLSLLIGFRYLTD 167

Query: 236 ---GPMLPYDWKGHS-LKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF 291
               P + ++    S  K+ D+     +  + S+I FA V   N   I   +++ S+   
Sbjct: 168 VAFAPEISFERGEISWFKVYDY---KGLLSTFSIIIFAYVGAMNIFTIVNELQDNSMTNV 224

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
            ++   SI+IS I    +G  G+  F   T GN+L ++     AI I + C    ++ TF
Sbjct: 225 RKVVDSSILISTILFLFVGLFGYLTFGSLTMGNILLNYDSDSLAIGIGKFCLAMMLILTF 284

Query: 352 PMEIFVLRDVVGNLL 366
           P+    LR  + N++
Sbjct: 285 PLLFHPLRTAINNIV 299

>TDEL0G02250 Chr7 complement(441289..442692) [1404 bp, 467 aa] {ON}
           Anc_2.295 YIL088C
          Length = 467

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 134/317 (42%), Gaps = 35/317 (11%)

Query: 64  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGI-LGGLLSYVAL---GFIVDWTLRLIV 119
           D   +   + +NL  +I+GAG++  PFA +N G+ +G LL+ +A    GF +     L  
Sbjct: 2   DPTGTPASSTVNLVKTIIGAGLLAIPFAFRNDGVVIGALLTLIAAVTSGFGL---FILAK 58

Query: 120 INLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAIF 177
            + TL   R         M     L  LF   +    F           D  P +     
Sbjct: 59  CSKTLINPRN-SSFFTLCMLTYPSLSPLFDLAMIVQCFGVGLSYLVLIGDLFPGLF---- 113

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMI---IIVLTVVI 234
               G   FW       +++++ I  PL   + +++L  +S + + ++    ++++T   
Sbjct: 114 ---GGEPRFW-------ILLSSLIIVPLCCLKKLDSLRYSSIIGLFALAYLSLLIVTYFA 163

Query: 235 RGPMLPYDWKGHS-----LKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289
              +L +D+K +       K+ DF     +  + S+I FA     N   I   ++  S+A
Sbjct: 164 HDTLLTHDYKSYRGEVCWFKVYDF---KGLLSTFSIIVFAYTGSMNLFSIINELKENSMA 220

Query: 290 KFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349
             T + + SI IS      +G  G+  F   T GN++ ++    T + + +LC G  ++ 
Sbjct: 221 NITSVINTSITISTAVFLAVGICGYLTFGSNTLGNIMLNYDPDSTWVYVGKLCLGSMVML 280

Query: 350 TFPMEIFVLRDVVGNLL 366
           +FP+     R  + NL+
Sbjct: 281 SFPLLFHPCRIAINNLV 297

>KLLA0E08559g Chr5 complement(766878..768260) [1383 bp, 460 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 460

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 69/315 (21%), Positives = 135/315 (42%), Gaps = 30/315 (9%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV-INLTLAGKRTYQG 132
           +NL  +I+GAG++  P+A +  G+   +   +   F   + L ++   + TL   R    
Sbjct: 12  INLIKTIVGAGLLAIPYAFRCDGVFFAVSLILMAAFTSGYGLFILAKCSKTLLNPRHSSF 71

Query: 133 -TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
            T+  +      LL  F   +  F           D  P    A+F     N   W+  +
Sbjct: 72  FTLCSITYPNLSLLFDFAMFIQCFGVALSYLILIGDLFP----ALFGGTRTN---WILLS 124

Query: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVI-----RGPMLPYDWKGH 246
            II++       PLS+ R+ ++L   S + ++++  I L ++        P    DW   
Sbjct: 125 AIIIV-------PLSLLRHFDSLKYTSVIGLLALGYIGLLIIGSYSFGNYPKPKVDW--- 174

Query: 247 SLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICC 306
              +SD   ++ +  + S+I FA     N   I   ++  S+    ++ + SI++S  C 
Sbjct: 175 -FSISD---RSGVLTTFSIIVFAFTGSMNLFSIINELKENSMTNIKKIINNSIVVSSACF 230

Query: 307 ALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLL 366
            ++G  G+  F ++T GNV+ ++     ++  AR   G  ++ +FP+     R    N++
Sbjct: 231 IILGLFGYLTFGKETLGNVILNYDADKLSVRFARFNLGLMVVLSFPLLFHPCRISANNMV 290

Query: 367 HECNLIKNYDEHTQL 381
           H   L  NY   +++
Sbjct: 291 HWLQL--NYGTKSEI 303

>AGL285C Chr7 complement(175831..177153) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER119C
           (AVT6) and YBL089W (AVT5)
          Length = 440

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 82/395 (20%), Positives = 160/395 (40%), Gaps = 42/395 (10%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGG--LLSYVALGFIVDWTLRLIVINLT 123
            SS++   + L ++  GAG++  P+A +  G+L G  +L+      +V   L+  V    
Sbjct: 2   SSSVQSGVLTLLHTACGAGVLAMPYAFRAFGLLAGGAILACCGASAMVGLVLQSHVAQYV 61

Query: 124 LAGKRTYQGTVEHVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAIFSQND 181
              + ++    +       +L ++F   +    F           D +P +   + +   
Sbjct: 62  PPRQASFFSLAQI---SNPELSVVFDCAIAVKCFGVGVSYLVVLGDLMPQLAGTVTAAP- 117

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRG----P 237
               + L RNV I   T  +  PL   R++ +L  AS +AV ++  +   V  R     P
Sbjct: 118 ----WLLDRNVQITFWTAAVIAPLCCMRHLHSLKYASMVAVAAVAYLGALVAARAAWPSP 173

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
            L       SL L        +  S  +  FA  CHHN   I   +R+ S+    R+   
Sbjct: 174 ELERLRGPVSLGLPPGTSGGAMLSSFPIFVFAYTCHHNMFSIVNELRDNSLGACLRVVVA 233

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           +I ++V   A +G +G+  F +   GN++  +P    A  + R      ++  FP++   
Sbjct: 234 AIALAVALYATIGGAGYLTFGDHITGNIIAQYP-PAPATTLGRAAIAVLVMLAFPLQCHP 292

Query: 358 LRDVVGNLLHEC------------NLIK-------------NYDEHTQLSGKQHVVITSS 392
            R  + ++ H C             LI+             N      L   +   IT++
Sbjct: 293 ARASINHIWHYCIPSHTVAPSEASALIRGGSPPADAAEGPGNEPAAVPLGPPRFAAITAA 352

Query: 393 LVFITMGISLTTCNLGALFELIGATTASTMAYILP 427
           L+  +  ++++  +L  +  ++GAT ++ +++ILP
Sbjct: 353 LLIASYAVAVSVTSLARVLAVVGATGSTAISFILP 387

>Kwal_27.11485 s27 (819908..821323) [1416 bp, 471 aa] {ON} YIL088C -
           Hypothetical ORF [contig 27] FULL
          Length = 471

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 86/410 (20%), Positives = 170/410 (41%), Gaps = 60/410 (14%)

Query: 60  LRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV 119
           +  N   ++   + +NL  +I+GAG++  P+A ++ G+L G++  +       + L ++ 
Sbjct: 1   MNTNTGTATAFFSTINLVKTIVGAGMLAIPYAFRSDGVLVGIVLTLIAALTSGFGLFVLA 60

Query: 120 -INLTLAGKRTYQG-TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
             + TL   R     T+  +      L+  F+  +  +           D  P ++    
Sbjct: 61  KCSKTLTNPRASSFFTLCSITYPSLSLVFDFSMFIQCYGVGLSYLVLIGDLFPGIV---- 116

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV---- 233
               G+ + W+  + +I++       PLS+ + +++L  +S L + ++  +V  +V    
Sbjct: 117 ---GGSRNMWIMASALIIV-------PLSLVKKLDSLKYSSILGLFAIAYLVCLIVGAFL 166

Query: 234 -----------IRGP---MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFI 279
                      IRG    +  YD+KG             +  + +++ FA     N   I
Sbjct: 167 RDVVFTDNYTAIRGDVSWIRVYDFKG-------------LISTFTIVIFAYTGSMNMFSI 213

Query: 280 FFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIA 339
              +++ S+    ++   +I IS      +G  G+  F   T GN++ ++          
Sbjct: 214 INELKDNSMTNINKVVSTTITISSFLFLAVGLCGYLTFGSNTLGNIMLNYDPNSAWTTTG 273

Query: 340 RLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHT--QLSGKQHVVITSSLVFIT 397
           +LC G  ++ +FP+ +   R    N++H    I NY +    Q++  QH  +TS    IT
Sbjct: 274 KLCLGSMVILSFPLLLHPCRIAANNMVHWT--IINYGKCADHQIARNQHTHVTSP---IT 328

Query: 398 MGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPF 447
           M +      L  L E      A+T A  LP  +N +  S+  S  E +PF
Sbjct: 329 MVVEDEEDRL--LLESDAGYNATTQA--LP--SNDIEESRVDSKTEVVPF 372

>TPHA0C03460 Chr3 complement(757629..759050) [1422 bp, 473 aa] {ON}
           Anc_2.295 YIL088C
          Length = 473

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 130/317 (41%), Gaps = 35/317 (11%)

Query: 64  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLL------SYVALGFIVDWTLRL 117
           +  +++  + +NL  +I+GAG++  PF  +N GIL G+L      +    G         
Sbjct: 2   EAVATVNSSIVNLVKTIVGAGLLAIPFVFQNDGILFGVLLTLLAATTSGFGLFALAKCSK 61

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           +++N   A   T      H +     L ++       F           D  P V     
Sbjct: 62  VMLNPRNASFFTVCLMTNHKLSVINDLAMIVQ----CFGVGVSYVVLVGDLFPIVF---- 113

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVL------- 230
               G  + W+  ++++++       PL + R++ +L  +S L + ++  + L       
Sbjct: 114 ---GGERNTWIIASLVVIL-------PLCLLRSMNSLKYSSILGLFALTYLTLLVISNFL 163

Query: 231 -TVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289
             V++    + +    + +K+ D+    T F   ++I FA     N   I   +   S+ 
Sbjct: 164 DDVILTDKFMQHRGDVNWIKIRDYKGFVTTF---NIIIFAFTGAMNLFSIINELEENSMK 220

Query: 290 KFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349
             + + + SI IS I    +G +G+  F   T GN++ ++       N+   C G  ++ 
Sbjct: 221 NISHVINYSIGISTILFLSVGITGYLTFGSNTVGNIMLNYDPNSVWTNVGNFCLGAMVIL 280

Query: 350 TFPMEIFVLRDVVGNLL 366
           +FP+    LRD V N++
Sbjct: 281 SFPLLFHPLRDAVNNII 297

>SAKL0E07392g Chr5 (602503..603921) [1419 bp, 472 aa] {ON} similar
           to uniprot|P40501 Saccharomyces cerevisiae YIL088C AVT7
           Putative transporter member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 472

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 98/213 (46%), Gaps = 16/213 (7%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV---IRGPM 238
           G+  +W+  + ++++       PL + R++++L  +S L + ++  +V  V+   + G +
Sbjct: 116 GDRDWWILGSALLII-------PLCLLRHLDSLKYSSILGLFALAYLVTLVIGTFVYGVV 168

Query: 239 LPYDWKGHSLKLSDFFMKATIFRSL----SVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
           L  D+K    +   F++K   +  L    S+I FA  C  N   I   + + SV+  T++
Sbjct: 169 LHDDYK--YTRGDVFWVKVYDYNGLISTFSIIIFAYTCTMNIFSIINELTDNSVSNVTKV 226

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
            + SI I+      +G +G+  F     GN++ ++        + + C G  ++ +FP+ 
Sbjct: 227 ANSSIGIATFLILSVGITGYLTFGSNVLGNIILNYDPDSIWTRVGKFCLGCMVVLSFPLM 286

Query: 355 IFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHV 387
               R    N++H   +   + E  Q +   H+
Sbjct: 287 FHPCRLATNNMVHWLQVNYGHCETHQTANNDHI 319

>Kpol_1003.44 s1003 complement(104836..106248) [1413 bp, 470 aa]
           {ON} complement(104836..106248) [1413 nt, 471 aa]
          Length = 470

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 127/312 (40%), Gaps = 45/312 (14%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV-INLTLAGKRTYQG 132
           +NL  +I+GAG++  P+  +N G+L G+L  V       + L ++   + T+   R    
Sbjct: 15  INLTKTIVGAGLLAIPYVFRNDGVLVGILMTVLAAIASGFGLFVLAKCSKTMINPRNSSF 74

Query: 133 TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNV 192
               +M       +   + L  F             I  +  A+F    G  H+W+  + 
Sbjct: 75  FTLCMMTNPS---LCPCSDLAMFVQCFGVGLSYLVLIGDLFPAVFG---GPRHYWIIGSG 128

Query: 193 IIVMVTTFISFPLSMKRNIEALSKASFL---AVISMIIIVLTVVIRGPMLP--------- 240
           II++       PL + +N+ +L  +S L   A+  + I+V+ + I    L          
Sbjct: 129 IIII-------PLCLLKNLNSLRYSSILGLFALAYLTILVIVIYINNVFLTDNYLETRGD 181

Query: 241 ------YDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
                 YDW G             +  + S+I FA     N   I   + N S+   T++
Sbjct: 182 VNWFSVYDWTG-------------LCSTFSIIIFAFTGAMNLFSIINELENNSIRNITKV 228

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
            + SI IS     L+G SG+  F   T GN++ ++        I + C G  ++ +FP+ 
Sbjct: 229 INRSIGISTFLFLLVGISGYLTFGSNTLGNIMLNYDPDSKWCYIGKFCLGSMIVLSFPLL 288

Query: 355 IFVLRDVVGNLL 366
              LR  V N++
Sbjct: 289 FHPLRIAVNNMV 300

>Smik_9.97 Chr9 complement(176731..178203) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 67/283 (23%), Positives = 122/283 (43%), Gaps = 44/283 (15%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV------------ 229
           G  +FW       ++ +T I  PL + + ++ L  +S L + ++  I             
Sbjct: 115 GERNFW-------IIASTVIIIPLCLVKKLDQLKYSSILGLFALAYISVLVFSHFVFELG 167

Query: 230 ---LTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNR 286
              LT V+R  +    WK H LK         +  + S+I FA     N   +   +++ 
Sbjct: 168 HGELTNVLRNDIC--WWKIHDLK--------GLLSTFSIIIFAYTGSMNLFPMINELKDN 217

Query: 287 SVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFN 346
           S+   T + + SI +S     ++G SG+  F  KT GN++ ++  T   I I + C G  
Sbjct: 218 SMENITSVINNSISLSTALFLIVGLSGYLTFGNKTLGNLILNYDPTSIWIVIGKFCLGLM 277

Query: 347 MLTTFPMEIFVLRDVVGNLLHECNLI---KNYDEHTQLSGKQHVVITSSLVFITMGISLT 403
           ++ +FP+    LR  V N++    +     N +E  Q+S        S+L      IS+T
Sbjct: 278 LILSFPLLFQPLRIAVNNVIIWIEITFGDANPEEDPQVSEYTR---ASNL----RPISMT 330

Query: 404 TCNLGALFELIGATTASTMAYILPPYT--NLLLTSKKKSWKER 444
             +     + + AT+     ++LP  +  + L+ S++ S  ER
Sbjct: 331 VDDPAQPNDALDATSYDEQEHLLPNASCDDGLIESQEDSSNER 373

>NCAS0E02440 Chr5 (477113..478600) [1488 bp, 495 aa] {ON} Anc_7.420
          Length = 495

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 77/349 (22%), Positives = 149/349 (42%), Gaps = 54/349 (15%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAG 126
           S+ R   + L ++  GAGI+  PFA K  G++ G        F +     L  +   L  
Sbjct: 7   SNTRSGVITLLHTACGAGILAMPFAFKPFGLVPG--------FAMLTICGLCSLLGLLLQ 58

Query: 127 KRTYQGTVEHV-----MGKK--GKLLILF--TNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
            R Y+   E       + +K    L ++F     +  F           D +P ++  + 
Sbjct: 59  ARVYRYAPERAASFFSLTQKINPNLSVVFDLAIAIKCFGVGVSYMIVVGDLMPQIVSGL- 117

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVIS---MIIIVLTVVI 234
           ++N       L R   I ++  F++ PL + +N+ +L  AS +A+ +   + I+VL   I
Sbjct: 118 TKNA----LLLDRVFHITLIMAFVAGPLCLLKNLNSLRYASMVAISAVAYLCILVLVHFI 173

Query: 235 RGPMLPYDWKGHSLKLSDFFM-----KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289
                  D KG      DF +     + +   +L +  FA  CHHN     F++ N    
Sbjct: 174 FPSQEIKDLKG------DFAVWFPHNEGSPLSTLPIFVFAYTCHHNV----FAVINEQ-- 221

Query: 290 KFTRLTHISII------ISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCF 343
           K TR  H+ +I      ++++   L+G +G+  F     GN++  +P + T+  I R+  
Sbjct: 222 KKTRFAHVKVIAIIAMLLALVLYVLIGGAGYFTFGNHIVGNIITLYPHSITS-TIGRVAI 280

Query: 344 GFNMLTTFPMEIFVLRDVVGNLL----HECNLIKNYDEHTQLSGKQHVV 388
            F +   FP++    R  + +++    H+    ++ ++  ++SG   ++
Sbjct: 281 VFLVTLAFPLQCHPARASIHHIICYIKHKAKK-RDQNQQIKVSGPIQII 328

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 377 EHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP-YTNLLLT 435
           E+T L GK   +IT  L+     ++++  +L  +  ++GAT ++++++ILP  +   L+ 
Sbjct: 390 ENTPLEGKTFKIITLILIACAYTVAISVTSLAHVLAIVGATGSTSISFILPGLFGFTLIG 449

Query: 436 SKKKSWKERLP 446
           S+     E +P
Sbjct: 450 SEYTEADEEIP 460

>NDAI0B03510 Chr2 (882507..883997) [1491 bp, 496 aa] {ON} Anc_2.295
          Length = 496

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 131/315 (41%), Gaps = 35/315 (11%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGG----LLSYVALGFIVDWTLRLIVINL 122
           +++  + +NL  +I+GAG++  P+A ++ GIL G    LL+ +  GF       L   + 
Sbjct: 5   ATVSSSIINLVKTIVGAGLLAIPYAFRSDGILVGTLLTLLAAINSGF---GLFILAKCSK 61

Query: 123 TLAGKRTYQGTVEHVMGKKGKLLILFTNGLF--AFXXXXXXXXXXXDTIPHVLRAIFSQN 180
           TL   R         M     L  LF   +    F           D  P +        
Sbjct: 62  TLINPRN-SSFFSICMLTYPSLSPLFDLAMIIQCFGVGLSYLVLIGDIFPGLF------- 113

Query: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASF-----LAVISMIIIVLTVVIR 235
            G+  +W       ++ + FI  PLS  + +++L  +S      LA +SM I V+   + 
Sbjct: 114 GGHRDYW-------IISSAFIIVPLSCLKKLDSLKYSSIVGLFALAYLSMFIFVM--FLH 164

Query: 236 GPMLPYDWKGHSLKLSDFFMKATIFRSL----SVISFALVCHHNTSFIFFSMRNRSVAKF 291
             +     +G S +   ++     FR L    S+I FA     N   +   + + S+   
Sbjct: 165 NTVFKLPNEGDSTRGEVYWFHVYDFRGLLSTFSIIIFAYTGAMNLFSMIRELEDISMQNI 224

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
             + + SIIIS     L+G SG+  F    +GN++ ++      I I + C G  ++ +F
Sbjct: 225 KNVINGSIIISTGLFLLVGISGYLTFGSNVEGNIILNYNPNSNWIYIGKFCLGTMLILSF 284

Query: 352 PMEIFVLRDVVGNLL 366
           P+    LR  V NL+
Sbjct: 285 PLLFHPLRIAVNNLV 299

>Kpol_1032.88 s1032 complement(188477..190204) [1728 bp, 575 aa]
           {ON} complement(188477..190204) [1728 nt, 576 aa]
          Length = 575

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 87/404 (21%), Positives = 158/404 (39%), Gaps = 43/404 (10%)

Query: 41  QNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGG 100
           Q SL    P  D T       +  KK S   A + L  S +G GI+  P    N G    
Sbjct: 154 QTSLLRRRPIPDTTRTQAAPVDKSKKVSTTKAILLLLKSFVGTGILFLPKGFSNGGYSFS 213

Query: 101 LLSYVALGFIVDWTLRLIV-INLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXX 159
            +S +    I  +   L++    T  G   Y    +H+ G+  K  IL +  L       
Sbjct: 214 TISLLLCSVISYYCFVLLISTKDTTHGINGYGDLGQHLFGRPMKFAILLSIVLSQIGFSA 273

Query: 160 XXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASF 219
                    +  +  ++F   D ++ F+     II     FI  PLS  RNI  L+  + 
Sbjct: 274 AYTVFVATNLKTLCNSVFENLDSSIKFF-----IIFQAILFI--PLSFTRNITKLTATAL 326

Query: 220 LAVISMIIIVLTV------------VIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVIS 267
           +A   ++I +L +            + RG M+P++ K  SL     F+   IF +   I 
Sbjct: 327 IADFFILIGLLYIYYYPISYISYNGIARGTMVPFNNKSWSL-----FIGTAIF-TFEGIG 380

Query: 268 FALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLN 327
             +           SM    + + + L+ + +I+++I  + +G   ++ F    +  VL 
Sbjct: 381 LLIPIQE-------SMAKPHLFRLS-LSLVMVIVTLIFVS-VGLLCYSAFGSDVETVVLL 431

Query: 328 SFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSG---K 384
           +FP       I +L +   +L + P+++F    ++ N + +      Y+   + +    +
Sbjct: 432 NFPQDSPYTLIVQLLYSLAILLSTPLQLFPAIRILENWVFKSRYSGKYNPKIKWAKNYFR 491

Query: 385 QHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPP 428
             VVI +S +       +   +L     L+G+     + YI PP
Sbjct: 492 TLVVIGTSFI-----AWIGADDLDKFVSLVGSFACIPLIYIYPP 530

>KNAG0A05380 Chr1 (791957..793381) [1425 bp, 474 aa] {ON} Anc_2.295
           YIL088C
          Length = 474

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 66/303 (21%), Positives = 132/303 (43%), Gaps = 27/303 (8%)

Query: 74  MNLANSILGAGIITQPFAIKNAGILGG----LLSYVALGFIVDWTLRLIVINLTLAG-KR 128
           +NL  +I+GAG++  P+A    GIL G    LL+ V  GF +     L   + TL   +R
Sbjct: 14  INLVKTIIGAGLLAIPYAFAQDGILVGILLTLLAAVTSGFGL---FALAKCSKTLIDPRR 70

Query: 129 TYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWL 188
           +   T+  +   +   L  F   +  F           D  P +         G+  +W+
Sbjct: 71  SSFFTLCMLTYPRLSPLFDFAMIVQCFGVGLSYLVLMGDIFPGLF-------GGDRQYWI 123

Query: 189 RRNVIIVMVTTFISFPLSMKRNIEALSKASFL---AVISMIIIVLTVVIRGPMLPYDWK- 244
             + +I+        PL   + ++ L  +S L   A+  + ++VL++ ++  +L  ++K 
Sbjct: 124 VASAVIIG-------PLCSLKKLDHLKYSSVLGLFALAYLAVLVLSMFVKDVILTDNYKV 176

Query: 245 -GHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISV 303
              ++   + +    +  + S+I FA V   N   I   + + ++   +++ + SI IS 
Sbjct: 177 VRGTILWFEIYSGKGLLSTFSIIIFAYVGAMNLFTIINELSDNNITNISKIINRSIAIST 236

Query: 304 ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVG 363
           +    +G +G+  F   T GN++ ++      +NI +      +L +FP+    LR    
Sbjct: 237 VAFLSVGITGYLTFGSNTLGNIILNYDPNSIWVNIGKFSLASMLLLSFPLLFHPLRIACN 296

Query: 364 NLL 366
           NL+
Sbjct: 297 NLV 299

>Suva_9.112 Chr9 complement(191885..193360) [1476 bp, 491 aa] {ON}
           YIL088C (REAL)
          Length = 491

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 99/217 (45%), Gaps = 31/217 (14%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTV-------VI 234
           G+ ++W       ++ +T +  PL + + ++ L  +S L + ++  I + +       + 
Sbjct: 115 GDRNYW-------IIASTVVIIPLCLVKKLDQLKYSSILGLFALAYISIFIFSHFAFELG 167

Query: 235 RGPM---LPYD---WKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
           +G +   L  D   WK H +K         +  + S+I FA     N   +   +++ S+
Sbjct: 168 KGKLTDVLENDICWWKIHDVK--------GLLSTFSIIIFAYTGSMNLFPMINELKDNSM 219

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
              T + + SI +S I   ++G SG+  F  KT GN++ ++      I I + C G  ++
Sbjct: 220 ENITLVINNSITLSTILFLIVGLSGYLTFGNKTSGNLMLNYDPNSIWIVIGKFCLGSMLI 279

Query: 349 TTFPMEIFVLRDVVGNLLHECNLI---KNYDEHTQLS 382
            +FP+    LR  V N++    +     + +E TQ+S
Sbjct: 280 LSFPLLFQPLRVAVNNVIIWLEITFGNADPNEDTQVS 316

>CAGL0G06622g Chr7 complement(631859..634060) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101w
          Length = 733

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 85/403 (21%), Positives = 156/403 (38%), Gaps = 49/403 (12%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAG 126
           +S R  F  L  S +G G++  P A  N G+   +      G        L++ +   A 
Sbjct: 316 TSTRKVFFLLLKSFIGTGVLFLPNAFNNGGLFFSIFMLAFFGLYSYLCYYLLISSKIAAQ 375

Query: 127 KRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHF 186
            R++ G    + G   K LILF+  +                +  +   +F   + ++ F
Sbjct: 376 VRSFGGIGLKLYGPTMKYLILFSLVITQLGFSSVYVIFTARNLKAIGEHVFKLPNVSITF 435

Query: 187 WLRRNVIIVMVTTFISF-PLSMKRNIEALSKASFLAVISMII-IVLTVVIRGPMLPYDWK 244
                   +M++  + F PLS  R I  LS  S  A + +++ +V+ V      L YD  
Sbjct: 436 --------LMISQLLLFIPLSFVRKISKLSLPSLFANVFILVGLVIVVFFSMKHLFYDLS 487

Query: 245 GHSLKLSDFFM---KATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHIS 298
           G       F +   + T+F   ++ SF    LV     S        R   KF  +  + 
Sbjct: 488 GSPADGVIFGINNSRWTLFIGTAIFSFEGIGLVIPVQDSM-------RKPEKFPLVLGLV 540

Query: 299 IIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
           II + +   ++   G+  +  +    +L + P  +  +++ +L +   ++ + P+++F  
Sbjct: 541 IICTTVVFIIVATIGYLAYGSEVDTVILLNLPQKNILVSLIQLLYSIAIMLSTPLQMFPA 600

Query: 359 RDVVGNLLHECNLIKNYD-------------EHTQLSGKQ-------HVVITSSLVFITM 398
             ++     E  L K YD             EH   SGK           + SS+V + +
Sbjct: 601 IRII-----ESGLFKQYDRWVNRSDREGHATEHNTSSGKSSWKVKWMKNAVRSSIVILVV 655

Query: 399 GISLTTC-NLGALFELIGATTASTMAYILPPYTNLLLTSKKKS 440
            I+     NL     +IG+     + Y+ PP  +L  TS  +S
Sbjct: 656 AIACVGADNLDKFLSIIGSFACIPLVYMYPPMLHLKSTSLPRS 698

>KLTH0G10604g Chr7 complement(895162..896568) [1407 bp, 468 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7
          Length = 468

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 66/314 (21%), Positives = 130/314 (41%), Gaps = 27/314 (8%)

Query: 64  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGG----LLSYVALGFIVDWTLRLIV 119
           D  ++   + +N+  +I+GAG++  P+A K+ GIL G    ++  V  GF +     L  
Sbjct: 2   DAGATAFFSTVNMVKTIVGAGMLAVPYAFKSDGILVGTALTIVGAVTSGFGL---FVLAK 58

Query: 120 INLTLAGKRTYQG-TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
            + TL   R     T+  +      L+  F   +  +           D  P V+     
Sbjct: 59  CSKTLINPRASSFFTLCSITYPSLSLIFDFAMFVQCYGVGLSYLVLVGDLFPGVVGGT-- 116

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFL---AVISMIIIVLTVVIR 235
                     RR  II   +T  + PLS+ + ++ L  +S L   AV  ++ ++L   ++
Sbjct: 117 ----------RRGWIIG--STLATVPLSLIKRLDGLKYSSILGLFAVAYLVCLILGSFLK 164

Query: 236 GPMLPYDWKGHSLKLS--DFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTR 293
             +L  +++     +S    + K  +  + ++I FA     N   I   +++ S+    +
Sbjct: 165 DVVLSENYREFRGDVSWIGVYDKKGLVSTFTIIVFAFTASMNLFSIINELKDNSMQNINK 224

Query: 294 LTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPM 353
           +   SI  S      +G  G+  F     GN++ ++        I +LC G  ++ +FP+
Sbjct: 225 VITSSISTSAALFLSVGVCGYLTFGSNVVGNIMLNYDPESIWTTIGKLCLGTMVILSFPL 284

Query: 354 EIFVLRDVVGNLLH 367
            +   R    N++H
Sbjct: 285 LLHPCRIAANNMMH 298

>YIL088C Chr9 complement(197931..199403) [1473 bp, 490 aa] {ON}
           AVT7Putative transporter, member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 490

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/342 (21%), Positives = 138/342 (40%), Gaps = 50/342 (14%)

Query: 64  DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINL- 122
           +  SS   +  NL  +I+GAG +  P++ K+ G+L G++  + L   V   L L V++  
Sbjct: 2   EATSSALSSTANLVKTIVGAGTLAIPYSFKSDGVLVGVI--LTLLAAVTSGLGLFVLSKC 59

Query: 123 --TLAGKRTYQGTVEHVMGKKGKLLILFTNGLFA--FXXXXXXXXXXXDTIPHVLRAIFS 178
             TL   R         M     L  +F   +    F           D  P +      
Sbjct: 60  SKTLINPRN-SSFFTLCMLTYPTLAPIFDLAMIVQCFGVGLSYLVLIGDLFPGLF----- 113

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIV--------- 229
              G  ++W+  + +I++       PL + + ++ L  +S L + ++  I          
Sbjct: 114 --GGERNYWIIASAVIII-------PLCLVKKLDQLKYSSILGLFALAYISILVFSHFVF 164

Query: 230 ------LTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSM 283
                 LT ++R  +    WK H  K         +  + S+I FA     N   +   +
Sbjct: 165 ELGKGELTNILRNDIC--WWKIHDFK--------GLLSTFSIIIFAFTGSMNLFPMINEL 214

Query: 284 RNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCF 343
           ++ S+   T + + SI +S     ++G SG+  F  +T GN++ ++      I I + C 
Sbjct: 215 KDNSMENITFVINNSISLSTALFLIVGLSGYLTFGNETLGNLMLNYDPNSIWIVIGKFCL 274

Query: 344 GFNMLTTFPMEIFVLRDVVGNLLHECNLI---KNYDEHTQLS 382
           G  ++ +FP+    LR  V N++    +     N +E  Q+S
Sbjct: 275 GSMLILSFPLLFHPLRIAVNNVIIWIEITYGGANPEEDPQVS 316

>ZYRO0A02112g Chr1 complement(171184..172587) [1404 bp, 467 aa] {ON}
           similar to uniprot|P40501 Saccharomyces cerevisiae
           YIL088C AVT7 Putative transporter member of a family of
           seven S. cerevisiae genes (AVT1-7) related to vesicular
           GABA-glycine transporters
          Length = 467

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/188 (20%), Positives = 84/188 (44%), Gaps = 11/188 (5%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISM----IIIVLTVVIRGP 237
           G   +W+  + ++V+       PL + + +++L  +S + + ++    ++I+ T V    
Sbjct: 115 GQRDWWIVGSSLVVV-------PLCLLKKLDSLKYSSIIGLFALAYLSLLILSTFVYEYS 167

Query: 238 MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHI 297
              Y+     +     +    +  + S+I FA     N   I   +RN ++   T + + 
Sbjct: 168 SGRYEEVRGDISWWSVYDYKGLMSTFSIIIFAYTGSMNLFSIVNELRNNTMTNITAVVNR 227

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           SI I+ +    +  +G+  F   T GN++ ++  T   ++I + C G  ++ TFP+    
Sbjct: 228 SIAIATVFFIAVALAGYLTFGSNTLGNIMLNYDDTSIYVHIGKFCLGSMVVLTFPLLFHP 287

Query: 358 LRDVVGNL 365
            R  V NL
Sbjct: 288 CRIAVNNL 295

>TBLA0C03030 Chr3 (732818..734389) [1572 bp, 523 aa] {ON} Anc_5.252
           YKL146W
          Length = 523

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 92/430 (21%), Positives = 155/430 (36%), Gaps = 90/430 (20%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAG--------ILGGLLSYVALGFIVDWTLRL 117
           KSS   A + L  S +G G++  P A  N G        I+  L+SY     ++D   +L
Sbjct: 126 KSSTTKAILLLLKSFIGTGVLFLPKAFSNGGYVFSLVSLIICSLISYYCFILLLDTKSKL 185

Query: 118 IV-----INLTLAG----KRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDT 168
            V     + LTL G    K      V   +G      +     L +             T
Sbjct: 186 NVNGYGDLGLTLYGSILQKSILLSIVLSQLGFAAAYNVFTATNLHSLSTSLITNPPDFIT 245

Query: 169 IPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA----VIS 224
           IP                        +++ TF+  PLS  RNI  LS  + +A     I 
Sbjct: 246 IPFC----------------------ILLQTFLFIPLSFTRNITKLSSTALIADLFIFIG 283

Query: 225 MIII----VLTVVIRGP----MLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNT 276
           +I +    +  +  +GP    M P++ K  SL     F+   IF    +    L+     
Sbjct: 284 LIYLYYYPIKIIATKGPDWQTMTPFNTKDWSL-----FIGTAIFTYEGI---GLLIPIQE 335

Query: 277 SFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAI 336
           S        +S   F +   + ++I  +    +G  G++ F       +L +FP  +   
Sbjct: 336 SM-------KSPHHFKKSLILVLVIITLVFITIGLLGYSAFGSNVDTVLLQNFPQDNPCT 388

Query: 337 NIARLCFGFNMLTTFPMEIFVL----------RDVVGNLLHECNLIKNYDEHTQLSGKQH 386
           ++ +L +   +L + P+++F            +D  G   H     KNY   T       
Sbjct: 389 SLVQLLYSLAILLSTPLQLFPAIKILENWIFSKDASGKYNHSIKWAKNYFRST------- 441

Query: 387 VVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKK--SWKER 444
           +VI +SL+       L   +L     L+G+     + Y+ PP  +   T      +WK  
Sbjct: 442 IVILTSLISY-----LGANDLNKFVALVGSFACIPLIYVYPPLLHYKATQLDNTFTWKTL 496

Query: 445 LPFYLCICFG 454
           L  +  + FG
Sbjct: 497 LADFSLLTFG 506

>Skud_9.86 Chr9 complement(173889..175361) [1473 bp, 490 aa] {ON}
           YIL088C (REAL)
          Length = 490

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/198 (23%), Positives = 87/198 (43%), Gaps = 28/198 (14%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTV-------VI 234
           G  ++W       V+ +T I  PL + + ++ L  +S L + ++  I + V       + 
Sbjct: 115 GERNYW-------VIASTAIIIPLCLVKKLDQLKYSSILGLFALAYISILVFSHFVFELA 167

Query: 235 RGPM---LPYD---WKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
           +G +   L  D   WK H  K         +  + S+I FA     N   +   +++ S+
Sbjct: 168 KGELTEVLKNDVSWWKIHDFK--------GLLSTFSIIIFAYTGSMNLFPMINELKDNSM 219

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
              T + + SI +S     ++G SG+  F   T GN++ ++      I I + C G  ++
Sbjct: 220 GNITLVINNSISLSTALFLIVGLSGYLTFGNSTLGNLILNYDPNSVWIIIGKFCLGSMLI 279

Query: 349 TTFPMEIFVLRDVVGNLL 366
            +FP+    LR  V N++
Sbjct: 280 LSFPLLFQPLRVAVNNVI 297

>KAFR0J01320 Chr10 (241859..243298) [1440 bp, 479 aa] {ON} Anc_2.295
           YIL088C
          Length = 479

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 142/343 (41%), Gaps = 57/343 (16%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGL----LSYVALGFIVDWTLRLIVINL 122
           S+   + +NL  +I+GAG++  P+A KN G+L GL    L+ V  GF +     L   + 
Sbjct: 5   STAHSSTINLVKTIVGAGLLAIPYAFKNDGVLVGLFLTLLAAVTSGFGL---FVLAKCSK 61

Query: 123 TLAGKRTYQG-TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQND 181
           TL   R     T+  +       L  FT  +  F           D  P +         
Sbjct: 62  TLINPRNSSFFTLCMLTYPSLSPLFDFTMIIQCFGVGLSYLILIGDIFPGLF-------G 114

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTV--------- 232
           G+ + W+  + ++++       PL   + ++ L  +S + +I++  + L V         
Sbjct: 115 GSRNLWIYLSGLLIV-------PLCFLKKLDHLKYSSIMGLIALGYLTLLVLGMFLHTVI 167

Query: 233 ------VIRGPM---LPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSM 283
                 ++RG +     YD+KG             +  + S+I FA     N   I   +
Sbjct: 168 FTDNYMIVRGQVNWFTVYDFKG-------------LLSTFSIIIFAYTGAMNLFSIINEL 214

Query: 284 RNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCF 343
           +N S+   + + + SI IS I    +G +G+  F   T GN+L ++      ++IA+ C 
Sbjct: 215 KNNSMENVSSIINHSISISTILFLTVGIAGYLTFGCNTLGNILLNYDADSVWVSIAKFCL 274

Query: 344 GFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQH 386
              ++ +FP+    LR  V NL+    +  NY    Q S  QH
Sbjct: 275 AIMLVLSFPLLFHPLRIAVNNLVVWLEI--NYGTPQQRS--QH 313

>TPHA0F01700 Chr6 complement(387868..389202) [1335 bp, 444 aa] {ON}
           Anc_2.177 YNL101W
          Length = 444

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 95/431 (22%), Positives = 170/431 (39%), Gaps = 65/431 (15%)

Query: 60  LRENDKK-----SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWT 114
           L  ND K     S+ +  F+ L  S +G G +  P A    G++  ++  V  G    W 
Sbjct: 12  LNNNDTKQRTGTSNWKTYFL-LLKSFVGTGSLLLPSAFHKGGLVFSVILIVIFGLYSYWC 70

Query: 115 LRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLR 174
             +I+   T     T+Q    +++G+    +IL +  L              +       
Sbjct: 71  YFIIIKLKTKVKANTFQEIGNNILGRWMSYVILGSLVLTQIGFSSAYIIFVGEN------ 124

Query: 175 AIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLT 231
             F+Q   N+  +    +  ++     +F +S    +E L+  + +A   +I  II+V++
Sbjct: 125 --FNQVVYNMTNYECNIIYPILFQLGFNFAMSFISRMEVLTIPAVIANVLIICGIILVIS 182

Query: 232 VVIRGPMLPYDWKGHSLKLSDFFM--KATIFRSLSVISFALV-----CHHNTSFIFFSMR 284
             +   +L  D K     +  FF   + T+F   ++ +F  V      H+N S       
Sbjct: 183 YSLHHLILISDKKSDP-GVMLFFNSNEWTLFIGTAIYAFEGVGLLIPIHNNMS------- 234

Query: 285 NRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSF-PGTDTAINIARLCF 343
             S   F ++  + ++   I   L+G  G+  + EK K  +L SF PG    +NI  +CF
Sbjct: 235 --SPKDFPKILLLVMLTMSIIFILIGTCGYLSYGEKIKVIILQSFAPGI--FVNIIIVCF 290

Query: 344 GFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDE---------------HTQLSGKQHVV 388
              +L + P+++F L  ++ + L     I   DE                T+  G +H+ 
Sbjct: 291 TIGILLSTPLQLFSLTSLLEDFLFTKKKIAVADEDLKVLEESDILCSESDTEAQGTKHIN 350

Query: 389 ITSSLVFITMGISLTTCNLG--------ALFELIGATTASTMAYILPPYTNLLLTSK--- 437
           +    + +   I  T C +G         L  ++G+     + YI PP  NL   S    
Sbjct: 351 LRVYKIILRFLIVTTVCLIGYITSDKLNKLVAIVGSLACIPLVYIYPPLLNLYECSLPGI 410

Query: 438 -KKSWKERLPF 447
            K +W   LPF
Sbjct: 411 IKNNW-SILPF 420

>KLLA0E13795g Chr5 complement(1216938..1218659) [1722 bp, 573 aa]
           {ON} similar to uniprot|P36062 Saccharomyces cerevisiae
           YKL146W AVT3 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 573

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 87/409 (21%), Positives = 154/409 (37%), Gaps = 42/409 (10%)

Query: 33  DSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAI 92
           D D+GS   N +                + N   +S   A + L  S +G G++  P A 
Sbjct: 153 DDDEGSSENNDIQQQQQLKQQQQHLHKKKRN---TSTTKAVLLLLKSFVGTGVLFLPRAF 209

Query: 93  KNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGL 152
            N G L   L  +    +  +   L++   T  G   Y      + G K K  +L +  L
Sbjct: 210 HNGGWLFSTLCLLFCATVSFYCFILLIDTKTAVGVDGYGELGSRLFGPKLKFTVLSSIVL 269

Query: 153 FAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIE 212
                           +    + +FS  + ++ FW       +M+      PLS+ RNI 
Sbjct: 270 SQIGFAAAYTVFTATNLQAFFKHVFSL-EYSLIFW-------IMIQLAFYLPLSLTRNIA 321

Query: 213 ALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH--------SLKLSDF--FMKATIFRS 262
            LS     A+++ + I+L +V       +    H        S   SD+  F+   IF +
Sbjct: 322 RLSAT---ALVADLFILLGLVYVYYYSSFYIWNHGIASDSMVSFNKSDWTLFIGTAIF-T 377

Query: 263 LSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISV--ICCALMGYSGFAVFKEK 320
              I   +  H        SM   +  K   L ++ +++++  I C L+ YS F     K
Sbjct: 378 YEGIGLLIPIHE-------SMEKPAHFK-PALMYVILVVTIIFISCGLICYSAFGA---K 426

Query: 321 TKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQ 380
            +  +L +FP      N  +L +   +L + P+++F    ++ N +   N    +D   +
Sbjct: 427 VETVILLNFPSNSIFTNAVQLIYALAILLSTPLQLFPAIKILENKIFHKNASGKFDAKVK 486

Query: 381 LSGKQHVVITSSLVFITMGISLTTCN-LGALFELIGATTASTMAYILPP 428
               +     + +V I + I+    N L     LIG+     + YI PP
Sbjct: 487 W---RKNYFRAFVVLIAVIIAWIGANDLDKFVSLIGSFACIPLIYIYPP 532

>AER380C Chr5 complement(1349610..1351760) [2151 bp, 716 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL101W
           (AVT4)
          Length = 716

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 90/423 (21%), Positives = 164/423 (38%), Gaps = 50/423 (11%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGI---LGGLLSYVALGFIVDWTLRLIVINL 122
           K+S   AF+ +  S +G G++  P A  N G+   +  L  + A  +   W   ++V + 
Sbjct: 298 KTSTFKAFLLMIKSFIGTGVLFLPNAFSNGGLAFSISMLFFFSAYSY---WCYYILVRSK 354

Query: 123 TLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDG 182
              G  ++      + G   K +ILF+  L                +   L  +F+  D 
Sbjct: 355 DATGVSSFGDIGGILFGSWMKFIILFSLVLTQMGFAGAYVVFTAKNLIAFLDNVFNWPDI 414

Query: 183 NVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIRGPML 239
            V +       +++   FI  PLS  RN+  LS  S  A   +IS +IIV+       M 
Sbjct: 415 PVKY-------LLLTQLFIFIPLSFVRNVSKLSITSLFANFFIISGLIIVVYYTACRWMY 467

Query: 240 PYDWKGHSLKLSDFFM-KATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLT 295
              +K     +  F   + ++F   ++ +F    L+     S        R   +F ++ 
Sbjct: 468 DLSFKPAEGVIMVFNPNRWSLFIGTAIFAFEGIGLIIPVQESM-------RHPEEFPKVL 520

Query: 296 HISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEI 355
            + II + +    +G  G+  +  + +  +L + P    ++N+ +L +   +L + P+++
Sbjct: 521 GLVIITTTVLFITIGTLGYLAYGSQIQSVILLNLPQDALSVNMIQLFYSMAILLSTPLQL 580

Query: 356 FVLRDVVGNLLHECNL---IKNYD----EHTQLSGKQHVVITSSLVFITMGISLTTC--- 405
           F    ++ N          IK  D    +  Q SG+ +  +  S   +   I L      
Sbjct: 581 FPAIGIIENKFFPRFTKVDIKGQDSADFQLQQNSGRANWRVKWSKNLVRSIIVLLVIILA 640

Query: 406 -----NLGALFELIGATTASTMAYILPPYTNLLLTS-----KKKSWKER---LPFYLCIC 452
                NL     ++G      + YI P   +L   S     K  +WK R   L  Y+ I 
Sbjct: 641 YFGADNLDLFVSIVGCLACIPLVYIYPSMLHLRSCSTPDHEKSNTWKTRCSVLIDYILII 700

Query: 453 FGF 455
           FGF
Sbjct: 701 FGF 703

>ADL205C Chr4 complement(341897..343303) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL088C
          Length = 468

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/197 (21%), Positives = 81/197 (41%), Gaps = 17/197 (8%)

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV---IRGPM 238
           G    W+  +  +V+       PLS  R  ++L  +S L ++++  + L +V   I G  
Sbjct: 115 GTREAWIAASAAVVV-------PLSHLRRFDSLKYSSVLGLVAIAYLALMIVAAWIEGLT 167

Query: 239 LPYDWKGHSLKLSDFFMKATIFRSL----SVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
             Y    H  +    +++    R +    S+I FA     N   I   + + S+    R+
Sbjct: 168 TGY---AHYERGEVRWLRPASLREMVSTFSIIVFAFTGSMNMFSIINELGDNSMRNIQRI 224

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
            + SI  S     L+G +G+  F      NV+ +F     +  +  L  G  +L +FP+ 
Sbjct: 225 VYYSIAASTALFILVGMAGYLTFGSNVAQNVILNFDPDAVSTQVGSLALGLMVLLSFPLL 284

Query: 355 IFVLRDVVGNLLHECNL 371
               R    N++H  ++
Sbjct: 285 FHPGRIAFNNMVHWAHV 301

>TPHA0B02530 Chr2 (580212..582002) [1791 bp, 596 aa] {ON} Anc_5.252
           YKL146W
          Length = 596

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 81/381 (21%), Positives = 151/381 (39%), Gaps = 38/381 (9%)

Query: 62  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWT-LRLIVI 120
           +N+KK+S   A + L  S +G GI+  P    N G     +S +    +  +  + LI  
Sbjct: 195 DNNKKASTFKAILLLLKSFVGTGILFLPKGFSNGGYTFSTISLLVCSLLSYYCFILLIST 254

Query: 121 NLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQN 180
              + G   Y     H+ GK  KL IL +  L                +  + + +FS N
Sbjct: 255 KDQMKGINGYGDLGNHLYGKNMKLAILLSIVLSQIGFSAAYTVFVATNLKTLCQNLFSNN 314

Query: 181 DGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTV-------- 232
               HF +   V+ ++  T +  PLS  RNI  L+  + +A + + I V+ +        
Sbjct: 315 Q---HFSI---VLFIIFQTLLFIPLSFTRNITKLTATALVADLFIFIGVIYIYYYPITYI 368

Query: 233 ----VIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
               +    ++P++ K  SL     F+   IF +   I   +    + +        +  
Sbjct: 369 IKNGIATETIVPFNNKNWSL-----FIGTAIF-TFEGIGLLIPIQESMA--------KPH 414

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
             F  LT + +I++VI  + +G   +  F    +  VL +FP         +L +   +L
Sbjct: 415 QFFISLTLVMVIVTVIFIS-VGLLCYCAFGSSVETVVLLNFPQDSPYTLTVQLLYCLAIL 473

Query: 349 TTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCN-L 407
            + P+++F    ++ N + +      Y+   + +        S +V  T  I+ +  N L
Sbjct: 474 LSTPLQLFPAIRILENWVFKKKGSGKYNPKIKWAKN---YFRSLIVIGTTCIAWSGANDL 530

Query: 408 GALFELIGATTASTMAYILPP 428
                L+G+     + YI PP
Sbjct: 531 DKFVSLVGSFACIPLIYIYPP 551

>ZYRO0B09548g Chr2 complement(742965..745121) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 124/301 (41%), Gaps = 22/301 (7%)

Query: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           AF+ L  S +G G++  P A  N G+   ++  +  G    W   +++    + G  ++ 
Sbjct: 307 AFLLLLKSFIGTGVLFLPHAFSNGGLFFSIVMLLFFGLYSFWCYYILIRAKEVVGVTSFG 366

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
                + G   K +ILF+     F            T  + L+A  S     +HF     
Sbjct: 367 DIGLRLYGPWVKFIILFS---LVFTQLGFSGAYVIFTAEN-LKAFCSN---VLHFSENIP 419

Query: 192 VIIVMVTTFISF-PLSMKRNIEALSKASFLA---VISMIIIVLTVVIRGPMLPYDWK-GH 246
           ++  M+  F  F PLS  RN+  LS  S LA   V+  ++IVL   ++   L    K   
Sbjct: 420 ILYFMLAQFAIFIPLSFIRNVSKLSLPSLLANFFVMGGLVIVLFFSLKQLALESHMKPAE 479

Query: 247 SLKLSDFFMKATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISV 303
            + L     + T+F   ++ +F    LV     S        R   KF  +  + II S 
Sbjct: 480 GVVLLFNTNRWTMFIGTAIFAFEGIGLVIPVQDSM-------RHPEKFPLVLGMVIITST 532

Query: 304 ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVG 363
           +    +G  G+  +  K K  +L + P  + ++N+ +  +   ++ + P+++F    ++ 
Sbjct: 533 VLFITIGSIGYLAYGYKIKTVILLNLPQANISVNLIQFFYSLAIMLSTPLQLFPAIKIIE 592

Query: 364 N 364
           N
Sbjct: 593 N 593

>Ecym_3335 Chr3 complement(639655..641079) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ADL205C
          Length = 474

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 84/188 (44%), Gaps = 6/188 (3%)

Query: 189 RRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVV---IRGPMLPYDWKG 245
           RRN  I + +T I  PL+  R +++L  +S + ++S+  +VL V    ++G M    +  
Sbjct: 116 RRNWWI-LGSTIIVVPLAHLRQLDSLKYSSLVGLLSITYLVLLVTGTFLQGVMFGNKYVE 174

Query: 246 HSLKLSDFFMKAT--IFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISV 303
           H   +S   + +   +  + S+I  A     N   +   +++ S A   R+ + S+ IS 
Sbjct: 175 HRGDVSWLHIHSVGELVSTFSIIILAYTGSMNMFSVINELKDNSTANAKRVVYYSVGIST 234

Query: 304 ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVG 363
           +    +G  G+  F      NV+ ++  +     I     G  ++ +FP+     R    
Sbjct: 235 LIFLSVGLGGYLTFGNNVLTNVILNYDESAITTRIGTFSLGTMVILSFPLLFHPGRIAFN 294

Query: 364 NLLHECNL 371
           N++H  ++
Sbjct: 295 NMVHWLDI 302

>Kpol_505.5 s505 complement(5011..7074) [2064 bp, 687 aa] {ON}
           complement(5011..7074) [2064 nt, 688 aa]
          Length = 687

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 89/429 (20%), Positives = 182/429 (42%), Gaps = 46/429 (10%)

Query: 56  VNDVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL 115
           +  V  + ++K+S   +F+ L  S +G G++  P A  N G+   ++  +  G    W  
Sbjct: 261 IEQVSNDKEQKTSTLKSFLLLLKSFVGTGVLFLPSAFHNGGLFFSIVMIMFFGVYSFWCY 320

Query: 116 RLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 175
            L+V   T+ G  ++    + V G   K +IL +  L                       
Sbjct: 321 YLLVRVKTITGLTSFGNMGQRVFGPWMKFIILLSLILSQLGFGSTYVIFTAKNF-----K 375

Query: 176 IFSQNDGNVHFWLRRNVIIVMVTTFISF-PLSMKRNIEALSKASFLAVISMIIIVLTVVI 234
            F +N  N+  +   N+I  ++  FI F PLS  R +  L+  S +A    I+I L++VI
Sbjct: 376 AFIENVTNIKDF---NIIYPILLQFIIFVPLSYIRRVSKLTLPSLIAN-GFILIGLSLVI 431

Query: 235 RGPM--LPYDWKGHSLK--LSDFFMKA-TIFRSLSVISFALVCHHNTSFIFFSMRN--RS 287
              +  L  D  G      +S F  K  T+F   ++ +F  +       +   ++N  R 
Sbjct: 432 YFSIDHLAGDLHGKPADGIISFFNTKHWTLFIGTAIFAFEGIG------LIIPLQNSMRD 485

Query: 288 VAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNM 347
            +KF  +  + +I + +   ++   G+  +   T+  +L +FP  +  +N+ +L +   +
Sbjct: 486 PSKFPLVLGLVMICTTVMFIIIATIGYLSYGSSTETIILQNFPQKNIVVNLIQLFYALAI 545

Query: 348 LTTFPMEIFVLRDVVGNLLH-------ECN----LIKNYDEHT-----QLSGKQHVVITS 391
           L + P++IF   ++V + +        EC     +   Y+ ++     ++   ++++ T 
Sbjct: 546 LLSTPLQIFPAIEIVEDKIFPKPGSDPECKDEIPITTIYNANSGGLDWRIKWFKNMIRTM 605

Query: 392 SLVFITMGISLTTCNLGALFELIGATTASTMAYILPP------YTNLLLTSKKKSWKERL 445
            +  + +     + NL  L  +IG+     + Y+ PP      Y+  +   K+ +W +  
Sbjct: 606 IVTCVILLAYFGSNNLDKLVAIIGSLACIPLVYMYPPMLHLKTYSIPMSKGKRFTWSKSF 665

Query: 446 PFYLCICFG 454
             Y+ I FG
Sbjct: 666 D-YILIVFG 673

>CAGL0E06468g Chr5 (647086..649131) [2046 bp, 681 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146w or
           uniprot|P50944 Saccharomyces cerevisiae YNL101w
          Length = 681

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 88/390 (22%), Positives = 147/390 (37%), Gaps = 43/390 (11%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVAL--GFIVDWTLRLIVINLT 123
           KSS   A + L  S +G G++  P A  N G   G  S V L    I  W   L++    
Sbjct: 289 KSSTTKAVLLLLKSFVGTGVLFLPRAFHNGG--WGFSSSVLLICALISYWCFVLLIDTKN 346

Query: 124 LAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGN 183
             G   Y     H+ G   KL IL++  L                +      +F Q  G 
Sbjct: 347 HVGLDGYGDMGNHLYGSSMKLAILWSIALSQIGFSSAYTVFTATNLQVFTNNVFKQEYGI 406

Query: 184 VHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDW 243
             F      II+ V  F+  PL++ RNI  LS  + +A +  I++ L  V    +     
Sbjct: 407 TIF------IIIQVLFFL--PLALTRNIAKLSGTALIADL-FILLGLVYVYWFSISHVST 457

Query: 244 KGHSLKLSDFFMKA--TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF-TRLTHISII 300
            G + +    F KA  ++F   ++ +F  +       I      +    F   L+ +  +
Sbjct: 458 HGVASETMLMFNKADWSLFIGTAIFTFEGI----GLLIPIQESMKKPEHFHASLSGVMCV 513

Query: 301 ISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
           ++V  I C L+ Y  F    E     VL +FP         +L +   +L + P+++F  
Sbjct: 514 VTVVFISCGLICYCAFGADVETV---VLLNFPQESIYTRAVQLLYALAILLSTPLQLFP- 569

Query: 359 RDVVGNLLHECNLIKNYDEHTQLSGKQHVVIT-------SSLVFITMGISLTTCN-LGAL 410
                       +++N+      SGK +  +        +++V  +  I+    N L   
Sbjct: 570 ---------AIKILENWTFSPHSSGKHNPKVKWLKNYFRAAIVCFSALIAWAGANDLDKF 620

Query: 411 FELIGATTASTMAYILPPYTNLLLTSKKKS 440
             L+G+     + YI PP  +     K KS
Sbjct: 621 VSLVGSFACIPLIYIYPPMLHFKAFKKDKS 650

>KLTH0D09042g Chr4 complement(746802..748958) [2157 bp, 718 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 718

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 91/461 (19%), Positives = 185/461 (40%), Gaps = 56/461 (12%)

Query: 30  TDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGAGIITQP 89
           TD +S++ +  + S  +   +        V +     +S   AF+ +  S +G G++  P
Sbjct: 264 TDQESEEQAVDETSPLLARAEAGTGKKILVPKSAKGTTSTTKAFLLMIKSFVGTGVLFLP 323

Query: 90  FAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVM-GKKGKLLILF 148
            A  N G+   L   V  G    W    I+    +A K +  G +   + G   K +ILF
Sbjct: 324 GAFSNGGLFFSLAMLVFFGIYSYWCY-YILTKSKIATKVSSFGDIGLTLYGPWMKFIILF 382

Query: 149 TNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISF-PLSM 207
           +                  T  ++L  +      NV +W    ++ ++    + F PLS 
Sbjct: 383 S---LVMTQLGFSGAYVVFTAKNLLAFV-----ENVFYWPGVTIVHLLALQLVVFIPLSF 434

Query: 208 KRNIEALSKASFLA---VISMIIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKA-TIFRSL 263
            RNI  LS +S +A   V+  I+IV+    +      + K     ++ F  ++ T+F   
Sbjct: 435 IRNIAKLSFSSLVANFLVMGGIVIVIGFTAKHLFFDLNCKPAEGIVTGFNSQSWTLFVGT 494

Query: 264 SVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEK 320
           ++ +F    L+    +S        +   KF  +  + II + +    +   G+  +  +
Sbjct: 495 AIFAFEGIGLIIPIQSSM-------KHPEKFPLVMALVIITATVLFVSVATLGYLSYGAE 547

Query: 321 TKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHE--CNLIKNYDEH 378
           T+  +L + P     +N+ +  +   +L + P+++F    ++ N +      +     +H
Sbjct: 548 TQTVILLNLPQDSILVNLIQFFYSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDH 607

Query: 379 TQL-----SGK------------QHVVITSSLVFITMGISLTTCNLGALFELIGATTAST 421
           T++     SGK            + ++++S ++    G +    +L A   ++G+     
Sbjct: 608 TKIQYKPNSGKLDWRIKWLKNFVRSLIVSSVVIAAYFGAN----HLDAFVAIVGSLACIP 663

Query: 422 MAYILPPYTNLLLTSK-----KKSWKERLPF---YLCICFG 454
           + YI PP  +L   SK     +KS   + P    Y+ + FG
Sbjct: 664 LVYIYPPMLHLRSCSKPRFAGEKSVWRKWPILLDYVLVVFG 704

>Smik_14.224 Chr14 (414661..416808) [2148 bp, 715 aa] {ON} YNL101W
           (REAL)
          Length = 715

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/415 (19%), Positives = 154/415 (37%), Gaps = 49/415 (11%)

Query: 59  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLI 118
           VL      +S R  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 291 VLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGLYSYWCYYIL 350

Query: 119 VINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
           V      G  ++      + G   +++ILF+  +                +   L  +F 
Sbjct: 351 VQAKASCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVFH 410

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA-VISMIIIVLTVVIRGP 237
                + F       +++  T I  PLS  RNI  LS  S LA    M  +V+ ++    
Sbjct: 411 AGVLPLSF-------LMIFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAK 463

Query: 238 MLPYDWK---------GHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSV 288
            L +D K         G ++     F+   IF +   I   +           SMRN   
Sbjct: 464 RLFFDLKASPAMGVVYGLNMDRWTLFIGTAIF-AFEGIGLIIPVQD-------SMRNPE- 514

Query: 289 AKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
            KF  +  + I+ + I    +   G+  +    +  +L + P ++  +N+ +L +   ++
Sbjct: 515 -KFPLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIM 573

Query: 349 TTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQL---------SGK--------QHVVITS 391
            + P+++F    ++ N        K Y +H  L         SGK        ++ + + 
Sbjct: 574 LSTPLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTRVELRPNSGKLDWRVKWLKNFIRSI 632

Query: 392 SLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL----LLTSKKKSWK 442
            ++ +       + NL     +IG+     + YI P   +L    L  +K K W+
Sbjct: 633 IVIIVVAIAYFGSDNLDKFVSVIGSLACIPLVYIYPSMLHLRGNSLPETKGKFWR 687

>SAKL0E10362g Chr5 complement(860653..862854) [2202 bp, 733 aa] {ON}
           similar to uniprot|P50944 Saccharomyces cerevisiae
           YNL101W AVT4 Vacuolar transporter exports large neutral
           amino acids from the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 733

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 85/425 (20%), Positives = 170/425 (40%), Gaps = 46/425 (10%)

Query: 61  RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVI 120
           R     +S   AF+ +  S +G G++  P A  N G+   +      G    W    I+I
Sbjct: 310 RSAKGTTSTFKAFLLMIKSFIGTGVLFLPNAFANGGLTFSVCMLSFFGIYSYWCY-YILI 368

Query: 121 NLTLAGKRTYQGTVE-HVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQ 179
              +A K +  G +   + G   K +ILF+  L                +   L  +F  
Sbjct: 369 QSKVATKVSSFGDIGFRLYGTWMKFVILFSLVLTQLGFSGAYVVFTAKNLIAFLDNVFRW 428

Query: 180 NDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIRG 236
           +D  + +     ++ + +  FI  PLS  RN+  LS  S +A   V++ +IIV+  V++ 
Sbjct: 429 HDVPIEY-----LLFLQLAIFI--PLSFIRNVSKLSLTSLIANFLVMAGLIIVVFFVLKH 481

Query: 237 PMLPYDWKGHSLKLSDFFMKA-TIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFT 292
            +L   +      +  F   + ++F   ++ +F    L+     S        +   KF 
Sbjct: 482 LILDLHFTPAEGVIMGFNSSSWSLFIGTAIFAFEGIGLIIPVQDSM-------KHPEKFP 534

Query: 293 RLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFP 352
            +  + I  + +    +   G+  + + T+  +L + P  +  +N+ +  +   +L + P
Sbjct: 535 LVLGLVIGAATVLFVTIATLGYLSYGQNTETVILLNLPQGNLCVNLIQFFYSLAILLSTP 594

Query: 353 MEIF----VLRDVVGNLLHECNLIKNYDEHTQL---SGK--------QHVVITSSLVFIT 397
           +++F    ++ + V     +  + KN     +L   SGK        ++ V +  + F+ 
Sbjct: 595 LQLFPAIAIIENKVFPRFTKIYVKKNNRTDVELRPNSGKLDWKVKWLKNSVRSVIVSFVI 654

Query: 398 MGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKK-----SWKERLPF---YL 449
           +     + NL     ++G      + Y+ PP  +L   SK +      W ++ P    YL
Sbjct: 655 LLAYYGSENLDKFVSIVGCFACIPLVYMYPPLLHLRSCSKPQCHGVTKWWKKWPIGLDYL 714

Query: 450 CICFG 454
            I FG
Sbjct: 715 LITFG 719

>KLLA0C13277g Chr3 (1135255..1137420) [2166 bp, 721 aa] {ON} similar
           to uniprot|P50944 Saccharomyces cerevisiae YNL101W AVT4
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 721

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 83/443 (18%), Positives = 173/443 (39%), Gaps = 58/443 (13%)

Query: 26  FPGTTDNDS----DDGSQGQNSLNIITPDMDDTLVND---VLRENDKKSSMRMAFMNLAN 78
           F G T ND     +D    ++ + ++     + L ++   + R +  K+S   AF+ +  
Sbjct: 257 FAGETFNDDFAVDEDDEFNESEVPLLNASDRERLGHNKRVIARPSQVKTSTFKAFLLMLK 316

Query: 79  SILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVM 138
           S +G G++  P A  N G++  +L     G    W   +++ +    G  ++      + 
Sbjct: 317 SFIGTGVLFLPSAFANGGLIFSVLMLSFFGMYSYWCYYILIRSKVATGVSSFGDIGIKLY 376

Query: 139 GKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVT 198
           G   +  IL +                  T  ++L   F QN  ++H     +++I+   
Sbjct: 377 GPWMRYAILAS---LILTQLGFSAAYVVFTCKNLL--AFFQNVFHLHSLRIEHLLILQTI 431

Query: 199 TFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIRGPMLPYDWKGHSLKLSDF-F 254
            FI  PL+  RN+  LS  S LA    ++ +II++  V++  ++  D K  +  +  F  
Sbjct: 432 IFI--PLAFIRNVSKLSLTSLLANFFTMAGLIIIVFFVVKHLVIDLDLKPEAGIIYGFNS 489

Query: 255 MKATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISV---ICCAL 308
            K ++F   ++ +F    L+     S        R   KF  +  + I+ +    I  A 
Sbjct: 490 SKWSLFIGTAIFAFEGIGLIIPVQDSM-------RKPEKFPLVLGLVILTATVLFISIAA 542

Query: 309 MGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLHE 368
           +GY  F  + E     +L + P  +  +N+ +  +   +L + P+++F    ++     E
Sbjct: 543 LGYLAFGRYIETV---ILLNLPQDNIFVNLVQFFYSLAILLSTPLQLFPAIGII-----E 594

Query: 369 CNLIKNYDEHTQLSGKQHVVITSS-------------------LVFITMGISLTTCNLGA 409
             L+  + +    + K  V ++ +                   ++F+       +  L  
Sbjct: 595 SKLVPKFRKTVSPTNKNDVQLSPNSGKLDWKVKWTKNFLRSIIVIFVICLAYFGSSKLDV 654

Query: 410 LFELIGATTASTMAYILPPYTNL 432
               IG      + Y+ PP  +L
Sbjct: 655 FVSFIGCFACIPLVYMYPPLLHL 677

>KAFR0H03660 Chr8 (698211..700151) [1941 bp, 646 aa] {ON} Anc_5.252
           YKL146W
          Length = 646

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 83/374 (22%), Positives = 143/374 (38%), Gaps = 32/374 (8%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           K+S   A + L  S +G G++  P A  N G     L  +    +  +   L++I     
Sbjct: 252 KTSTFKAVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLMCAVLSYYCFILLIITKDKV 311

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVH 185
           G   Y    E + G K KL IL +  L                +    +   +  DG++ 
Sbjct: 312 GVAGYGDMGEVLYGSKMKLAILASIALSQIGFSAAYTVFTATNLQVFCQGALNLPDGSLG 371

Query: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKG 245
                  I +++   I  PLS+ RNI  LS  + LA    + I+L ++       Y    
Sbjct: 372 LG-----IFIVLQALIFIPLSLTRNIAKLSVTALLAD---LFILLGLIYVYYYAIYYVAK 423

Query: 246 HSLKLSDFFM----KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKF-TRLTHISII 300
           +S+  +          ++F   ++ +F  +       I      R   KF + L  +  I
Sbjct: 424 NSIATATMVWFNNSDWSLFIGTAIFTFEGI----GLLIPIQESMRHPEKFQSSLFGVMCI 479

Query: 301 ISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
           +SV  I C L+ YS F       +  VL +FP       + +L +   +L + P+++F  
Sbjct: 480 VSVVFISCGLLCYSAFG---SNVQTVVLLNFPQDSPYTLLVQLFYSMAILLSTPLQLFPA 536

Query: 359 RDVVGNLLHECNLIKNYDEHTQLSGKQH----VVITSSLVFITMGISLTTCNLGALFELI 414
             ++ +     N    Y+   +          VV+TS L ++  G S    NL     L+
Sbjct: 537 IRILEHWTFPSNASGKYNPKIKWRKNYFRCIIVVLTSVLAWV--GAS----NLDKFVSLV 590

Query: 415 GATTASTMAYILPP 428
           G+     + YI PP
Sbjct: 591 GSLACIPLIYIHPP 604

>TBLA0B07210 Chr2 (1705801..1707294) [1494 bp, 497 aa] {ON}
           Anc_2.295 YIL088C
          Length = 497

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 67/331 (20%), Positives = 132/331 (39%), Gaps = 65/331 (19%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAG 126
           +S+  + +NL  +I+GAG++  PFA +N GIL G+L                   LTL  
Sbjct: 6   ASIHSSIINLTKTIVGAGMLAIPFAFRNDGILVGIL-------------------LTLLA 46

Query: 127 KRTYQGTVEHVMGKKGKLLILFTNGLF----------------------AFXXXXXXXXX 164
             T  G    V+ K  K LI   N  F                       F         
Sbjct: 47  AIT-SGFGLFVLAKCSKTLINPRNSSFFQLTMIAFPNLSPLSDISMIVQCFGVGLSYIVL 105

Query: 165 XXDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKA------- 217
             D  P +       N G+ +F++  + I+++       PL + + ++ L  +       
Sbjct: 106 IGDLFPTIF-----NNYGSRNFYILTSTIVIV-------PLCLLKRLDHLKYSSIVGLFA 153

Query: 218 -SFLAVISMIIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNT 276
            S+L+ + + + +  +++   + P++ +G S+     +    +  + ++I FA     N 
Sbjct: 154 LSYLSFLIVFVFIKDIILTNNLPPFE-RG-SINWVSIYDFNGLLSTFTIIIFAYTGSMNL 211

Query: 277 SFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDT-A 335
             I   +    +     + + SI IS I   ++   G+  F   T GN++ ++  +++  
Sbjct: 212 FTIINELNYNDIDSIKIVINHSIAISTIIFLIISIFGYLTFGTLTLGNIMLNYNYSNSLY 271

Query: 336 INIARLCFGFNMLTTFPMEIFVLRDVVGNLL 366
           I + +L  G  ++ TFP+    LR    N++
Sbjct: 272 IILGKLALGIMVILTFPLLFHPLRIACNNII 302

>YNL101W Chr14 (434999..437140) [2142 bp, 713 aa] {ON}  AVT4Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 713

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 66/333 (19%), Positives = 130/333 (39%), Gaps = 22/333 (6%)

Query: 59  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLI 118
           VL      +S +  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 289 VLPSAKGTTSTKKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGIYSYWCYYIL 348

Query: 119 VINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
           V   +  G  ++      + G   +++ILF+  +                +   L  +F 
Sbjct: 349 VQAKSSCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVF- 407

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA-VISMIIIVLTVVIRGP 237
                 H  +     +++  T I  PLS  RNI  LS  S LA    M  +V+ ++    
Sbjct: 408 ------HVGVLPLSYLMVFQTIIFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAK 461

Query: 238 MLPYDWKGHSLKLSDFFMKA---TIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKF 291
            L +D  G       + + A   T+F   ++ +F    L+          SMRN    KF
Sbjct: 462 RLFFDLMGTPAMGVVYGLNADRWTLFIGTAIFAFEGIGLIIPVQD-----SMRNPE--KF 514

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
             +  + I+ + I    +   G+  +    +  +L + P ++  +N+ +L +   ++ + 
Sbjct: 515 PLVLALVILTATILFISIATLGYLAYGSNVQTVILLNLPQSNIFVNLIQLFYSIAIMLST 574

Query: 352 PMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGK 384
           P+++F    ++ N        K Y +H  L+ +
Sbjct: 575 PLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTR 606

>KNAG0H02330 Chr8 (425024..426955) [1932 bp, 643 aa] {ON} Anc_5.252
           YKL146W
          Length = 643

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 79/383 (20%), Positives = 152/383 (39%), Gaps = 43/383 (11%)

Query: 62  ENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVIN 121
           E  K ++++ A + L  S +G G++  P A  N G     L  +    +  +   L++I 
Sbjct: 242 ERHKTTTVK-AVLLLLKSFVGTGVLFLPKAFSNGGWGFSSLCLLFCAILSYYCFVLLIIT 300

Query: 122 LTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQND 181
               G + Y      + G K KL IL +  L                +   +  +F+ ++
Sbjct: 301 KDKVGVKGYGEIGMKLYGGKMKLAILLSVALSQIGFAAAYTVFTATNLKLFMDNVFNLSE 360

Query: 182 GNVHF----WLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
             +      WL+  + I         PLS+ RNI  LS  + +A +  I++ L  V    
Sbjct: 361 DVLGLGWFIWLQAAIFI---------PLSLTRNIAKLSGTALVADL-FILLGLIYVYYYA 410

Query: 238 MLPYDWKGHSLKLSDFFMKA--TIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLT 295
                  G +     +F K+  T+F   ++ +F  +       I  SM++  V +   L+
Sbjct: 411 TYYVISNGVATSTMVWFNKSDWTLFIGTAIFTFEGIGLLIP--IQESMKHPEVFR-KSLS 467

Query: 296 HISIIISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPM 353
            + +I++V  I C L+ YS F    +     VL +FP       I +L +   +L + P+
Sbjct: 468 GVMVIVTVIFISCGLLCYSAFGSHVDTV---VLVNFPQDSYTTAIVQLLYALAILLSTPL 524

Query: 354 EIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVIT--------SSLVFITMGISLTTC 405
           ++F              +++ +  ++  SGK +  +           ++F T+   +   
Sbjct: 525 QLF----------PAIRILEQWTFNSNASGKHNPRVKWLKNYFRCGVVIFTTVLAWVGAS 574

Query: 406 NLGALFELIGATTASTMAYILPP 428
           +L     L+G+     + YI PP
Sbjct: 575 DLDKFVSLVGSLACIPLIYIHPP 597

>Kwal_26.8401 s26 complement(767440..769602) [2163 bp, 720 aa] {ON}
           YNL101W - Hypothetical ORF [contig 60] FULL
          Length = 720

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 86/436 (19%), Positives = 161/436 (36%), Gaps = 80/436 (18%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIV------- 119
           +S   AF+ +  S +G G++  P A  N G++  L+  +  G    W   ++        
Sbjct: 303 TSTMKAFLLMIKSFIGTGVLFLPGAFSNGGLVFSLIMLIFFGTYSFWCYYILTQSKVATR 362

Query: 120 ------INLTLAGKRT----YQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 169
                 I LTL G           V   +G  G  ++     L AF              
Sbjct: 363 VASFGDIGLTLYGPWMKFIILLSLVMTQLGFSGAYVVFTAKNLLAFV------------- 409

Query: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISF-PLSMKRNIEALSKASFLA---VISM 225
                        NV +W    ++ ++    + F PLS  RNI  LS +S +A   V+  
Sbjct: 410 ------------NNVFYWPGVTIVHLLALQLVIFIPLSFIRNIAKLSLSSLVANFLVMGG 457

Query: 226 IIIVLTVVIRGPMLPYDWKGHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIF---FS 282
           I+IV+    +      ++K       D  M     R    +  A+        I     S
Sbjct: 458 IVIVIGFTAKHLFFDLNFK----PAEDIVMGFNSSRWTLYVGTAIFAFEGIGLIIPIQGS 513

Query: 283 MRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLC 342
           M++    KF  +  + II + +    +G  G+  +  KT+  +L + P  +  +N+ +  
Sbjct: 514 MKHPE--KFPLVLALVIISATVLFVTVGTLGYLSYGAKTETVILLNLPQGNILVNLIQFF 571

Query: 343 FGFNMLTTFPMEIFVLRDVVGNLLHE--CNLIKNYDEHTQL-----SGK--------QHV 387
           +   +L + P+++F    ++ N +      +     +HT++     SGK        ++ 
Sbjct: 572 YSSAILLSTPLQLFPAIAIIENKVFPKFTKIYVKRSDHTKVHYKPNSGKLDWRVKWLKNF 631

Query: 388 VITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKKKS------W 441
           V +  +  + +       +L     ++G+     + YI PP  +L   S+         W
Sbjct: 632 VRSLIVSLVVIAAYFGADHLDTFVSIVGSFACIPLVYIYPPMLHLESCSRPACQNETSIW 691

Query: 442 KERLPF---YLCICFG 454
           K + P    Y+ I FG
Sbjct: 692 K-KWPMAVDYVLIIFG 706

>Skud_14.229 Chr14 (425174..427315) [2142 bp, 713 aa] {ON} YNL101W
           (REAL)
          Length = 713

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 64/333 (19%), Positives = 130/333 (39%), Gaps = 22/333 (6%)

Query: 59  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLI 118
           VL      +S R  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 289 VLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLAFFGVYSYWCYYIL 348

Query: 119 VINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
           V   +  G  ++      + G   +++ILF+  +                +   L  +F 
Sbjct: 349 VQAKSSCGVSSFGDIGLKLYGPWMRIIILFSLVITQVGFSGAYMIFTAKNLQAFLDNVF- 407

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA-VISMIIIVLTVVIRGP 237
                 H  +     +++  T +  PLS  RNI  LS  S LA    M  +V+ ++    
Sbjct: 408 ------HVGVLPLSYLMVFQTIVFIPLSFIRNISKLSLPSLLANFFIMAGLVIVIIFTAK 461

Query: 238 MLPYDWKGHSLKLSDFFM---KATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKF 291
            L +D K        + +   + T+F   ++ +F    L+          SMRN    KF
Sbjct: 462 RLFFDLKATPAAGVIYGLNTDRWTLFIGTAIFAFEGIGLIIPVQD-----SMRNPE--KF 514

Query: 292 TRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
             +  + I+ + +    +   G+  +    +  +L + P ++  +N+ +L +   ++ + 
Sbjct: 515 PLVLGLVILTATLLFISIATLGYLAYGSSVRTVILLNLPQSNIFVNLIQLFYSIAIMLST 574

Query: 352 PMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGK 384
           P+++F    ++ N        K Y +H  L+ +
Sbjct: 575 PLQLFPAIKIIENKFFP-KFTKIYVKHNDLTTR 606

>NDAI0C03790 Chr3 complement(863178..865343) [2166 bp, 721 aa] {ON}
           Anc_5.252
          Length = 721

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 80/370 (21%), Positives = 144/370 (38%), Gaps = 20/370 (5%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           KSS   A + L  S +G G++  P A  N G     L  +    I  W    +++     
Sbjct: 319 KSSTFKAILLLLKSFVGTGVLFLPKAFHNGGWAFSSLCLLLCAIISYWCFLTLIVTKDKI 378

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGL----FAFXXXXXXXXXXXDTIPHVLRAIFSQND 181
               Y    E + G   KL IL++  L    F+              + +VL    + N 
Sbjct: 379 HVDGYGDMGERLYGHPMKLAILWSIVLSQIGFSAAYTVFTATNLKVFVENVLVRTATMNP 438

Query: 182 GNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPY 241
              +      V  +++   I  PLS+ R I  LS  + +A +  I++ L  V        
Sbjct: 439 TGYNL-----VWYIILQQLIFIPLSLTRKIAKLSGTALIADL-FILLGLIYVYYYSSYYI 492

Query: 242 DWKGHSLKLSDFFMKA--TIFRSLSVISFALVCHHNTSFIFFSMRNRSV-AKFTRLTHIS 298
              G + +   +  KA  ++F   ++ +F  +       I  SM+N  V  K   L    
Sbjct: 493 LSNGIASESMLWLNKADWSLFIGTAIFTFEGIGLLIP--IQESMQNPQVFPKCLSLVMCI 550

Query: 299 IIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVL 358
           + I  I C L+ YS F    EK +  VL +FP       + +L +   +L + P+++F  
Sbjct: 551 VTIIFISCGLICYSAFG---EKVETVVLLNFPQDSAFTLMVQLLYSLAILLSTPLQLFPA 607

Query: 359 RDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCNLGALFELIGATT 418
             ++ N     +    ++  +++  K++      ++F  M   +   +L     L+G+  
Sbjct: 608 IKILENWTFPIHASGKHN--SRIKWKKNYFRCIMVIFTAMVAWVGANDLDKFVSLVGSFA 665

Query: 419 ASTMAYILPP 428
              + YI PP
Sbjct: 666 CIPLIYIYPP 675

>KAFR0D02000 Chr4 (407474..409618) [2145 bp, 714 aa] {ON} Anc_2.177
           YNL101W
          Length = 714

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 69/172 (40%), Gaps = 11/172 (6%)

Query: 54  TLVNDVLREN----DKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGF 109
           TL + V R N       +S R AF+ L  S +G G++  P A  N G+   ++    +G 
Sbjct: 282 TLPDSVTRANVETIKGTTSTRKAFLLLLKSFVGTGVLFLPDAFHNGGLAFSIIVLTLVGL 341

Query: 110 IVDWTLRLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTI 169
              W   ++V         ++      + GK  K +IL    +                +
Sbjct: 342 YSYWCYYILVQTKVKVKACSFGDIGSQLYGKWMKSVILVAIFVSQLGFSAAYMIFTAKNL 401

Query: 170 PHVLRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA 221
              L+ IF   D N+ +     ++I+ +  F+  PLS  RNI  LS  S +A
Sbjct: 402 GAFLQNIFHLKDFNLGY-----IMIIQLIFFV--PLSFIRNISKLSLPSLIA 446

>TDEL0F01320 Chr6 (235988..238135) [2148 bp, 715 aa] {ON} Anc_2.177
           YNL101W
          Length = 715

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 74/399 (18%), Positives = 159/399 (39%), Gaps = 37/399 (9%)

Query: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           AF  L  S +G G++  P A  N G+   ++     G    W   +++    + G  ++ 
Sbjct: 304 AFFLLLKSFIGTGVLFLPNAFSNGGLSFSIVMLSFFGAYSYWCYFILIRAKKITGVTSFG 363

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
                + G   K +ILF+  L              + +    + +F  +D  + +++   
Sbjct: 364 DIGLRLFGPWMKFVILFSLVLTQIGFSGAYVIFTAENLKAFTKNVFLVSDVPISYFM--- 420

Query: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIRGPMLPYDWKGHSL 248
             I+ +  FI  PLS  RN+  LS  S LA   V++ + IVL    +  ++    +    
Sbjct: 421 --IIQLIVFI--PLSFIRNVSKLSLPSLLANFFVMAGLAIVLFFSTKHLVIDLGMRAADG 476

Query: 249 KLSDFFM-KATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVI 304
            +  F   + ++F   ++ +F    L+     S        R   KF  +  + I  S +
Sbjct: 477 VIVGFNQSRWSMFVGTAIFAFEGIGLIIPVQDSM-------RHPEKFPMVLALVIGSSTV 529

Query: 305 CCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGN 364
               +   G+  +    +  +L + P  +  +N+ +  +   ++ + P+++F    ++ N
Sbjct: 530 LFITIASIGYLAYGSAIETVILLNLPQKNVFVNLIQFFYSLAIMLSTPLQLFPAIKIIEN 589

Query: 365 LLHECN---LIKNYDEHTQL-----SGKQHVVI---TSSLVFITMGISLTTCNLGA---- 409
            +        +K  D+ T +     SGK +  +    +S+  I + + +     GA    
Sbjct: 590 KVFPKFTKIYVKKDDDTTDIQLRPNSGKLNWKVKWLKNSVRAIIVALVILMAYYGADKLD 649

Query: 410 -LFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPF 447
               +IG+     + Y+ PP  +L   S+ +S  ++ P+
Sbjct: 650 KFVSIIGSFACIPLVYMYPPMLHLQSYSRPRSAGQKFPW 688

>Suva_14.238 Chr14 (431876..434026) [2151 bp, 716 aa] {ON} YNL101W
           (REAL)
          Length = 716

 Score = 37.7 bits (86), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 66/337 (19%), Positives = 128/337 (37%), Gaps = 30/337 (8%)

Query: 59  VLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLI 118
           VL      +S R  F+ L  S +G G++  P A  N G+   +      G    W   ++
Sbjct: 292 VLPSAKGTTSTRKVFLILLKSFIGTGVLFLPNAFHNGGLFFSVSMLTFFGIYSYWCYYIL 351

Query: 119 VINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFS 178
           V   +  G  ++      + G   K++ILF+  +                +   L  +F 
Sbjct: 352 VQAKSSCGVSSFGDIGLKLYGPWMKIIILFSLVITQVGFSGAYMIFTAKNLQAFLENVF- 410

Query: 179 QNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA-VISMIIIVLTVVIRGP 237
                 H        ++   T I  PLS  RNI  LS  S LA    M  +++ ++    
Sbjct: 411 ------HVGALPLSYLMAFQTVIFIPLSFIRNISKLSLPSLLANFFIMAGLIIVIIFTAK 464

Query: 238 MLPYDWKG-------HSLKLSDFFMKATIFRSLSVISF---ALVCHHNTSFIFFSMRNRS 287
            L +D K        + L  SD   + T+F   ++ +F    L+     S        + 
Sbjct: 465 RLFFDLKAVPAMGVVYGLN-SD---RWTLFIGTAIFAFEGIGLIIPVQDSM-------KH 513

Query: 288 VAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNM 347
             KF  +  + I+ + +    +   G+  +    K  +L + P ++  +N+ +L +   +
Sbjct: 514 PEKFPLVLGLVILTATVLFISIATLGYLAYGSDVKTAILLNLPQSNIFVNLIQLFYSIAI 573

Query: 348 LTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGK 384
           + + P+++F    ++ N        K Y +H  L+ +
Sbjct: 574 MLSTPLQLFPAIKIIENKFFP-KFTKIYVKHDDLTTR 609

>Skud_11.81 Chr11 (157889..160027) [2139 bp, 712 aa] {ON} YKL146W
           (REAL)
          Length = 712

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 91/416 (21%), Positives = 160/416 (38%), Gaps = 46/416 (11%)

Query: 59  VLRENDK---KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL 115
           V RE+++   KSS   A + L  S +G G++  P A  N G     L  ++   +     
Sbjct: 306 VPREHERHPHKSSTVKAVLLLLKSFVGTGVLFLPRAFHNGGWGFSALCLLSCALVSYGCF 365

Query: 116 RLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 175
             ++      G   Y      + G K K  IL +  L                +      
Sbjct: 366 VSLISTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQVFFEN 425

Query: 176 IFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR 235
            F    G+++       I   V  F+  PLS+ RNI  LS  + +A +  I++ L  V  
Sbjct: 426 FFHLKPGSINL---ATYIFAQVLIFV--PLSLTRNIAKLSGTALIADL-FILLGLVYVYV 479

Query: 236 GPMLPYDWKGHSLKLSDFFMKA--TIFRSLSVISFA----LVCHHNTSFIFFSMRNRSVA 289
             +      G +      F KA  ++F   ++ +F     L+       I  SMR+ +  
Sbjct: 480 YSIYYISVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP------IQESMRHPNHF 533

Query: 290 KFTRLTHISIIISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNM 347
           +   L+ +  I++V  I C L+ Y   A F    K  VL +FP   +     +L +   +
Sbjct: 534 R-PSLSAVMCIVAVVFISCGLLCY---AAFGADVKTVVLLNFPQNSSYTLTVQLLYALAI 589

Query: 348 LTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVIT-------SSLVFITMGI 400
           L + P+++F              +++N+   +  SGK +  +         ++V +T  +
Sbjct: 590 LLSTPLQLFP----------AIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSIL 639

Query: 401 SLTTCN-LGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERLPFYL-CICFG 454
           +    N L     L+G+     + YI PP  +   +S   + + RL   L  I FG
Sbjct: 640 AWVGANDLDKFVSLVGSFACVPLIYIYPPLLHFKASSISGTSRGRLLLDLIVISFG 695

>Kwal_23.2839 s23 (38499..40343) [1845 bp, 614 aa] {ON} YKL146W -
           Hypothetical ORF [contig 246] FULL
          Length = 614

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 79/382 (20%), Positives = 140/382 (36%), Gaps = 51/382 (13%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           KSS   A + L  S +G G++  P A  N G        +A G +V +   L++IN    
Sbjct: 221 KSSTFKAVLLLLKSFVGTGVLFLPRAFHNGGWAFSTGCLLACG-VVSYYCFLLLINAKTK 279

Query: 126 GKRTYQGTV-EHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
            K    G +   V G K +  IL +  L                +      +F +   ++
Sbjct: 280 QKVNGYGDLGASVFGSKMEKAILGSIVLSQVGFVAAYSVFTATNLQVFFANVF-KFKASM 338

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWK 244
            FWL       ++   +  PLS+ RNI  LS  + +A   ++  +L V         D  
Sbjct: 339 AFWL-------LIQLPVYLPLSLTRNIAKLSGTALIADAFILFGLLYVYYYCSHYVVD-- 389

Query: 245 GHSLKLSDFFM----KATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL---THI 297
            H +      +      T+F   ++ ++  +       I      +   KF++       
Sbjct: 390 -HGVASDSMLLFNKNDWTLFIGTAIFTYEGI----GLLIPIQESMKHPEKFSKCLFGVMA 444

Query: 298 SIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFV 357
           S+ ++ I C L+ YS F    +  K  +L +FP         +L +   +L + P+++F 
Sbjct: 445 SVSVAFIVCGLLCYSAFG---DSVKIVILLNFPRDSAMTATVQLLYALAILLSTPLQLFP 501

Query: 358 L----------RDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTCN- 406
           +          +D  G        +KNY                ++V + M I+    N 
Sbjct: 502 IIRILETSIFPKDASGKYNPRVKWMKNY-------------FRVAIVLLNMLIAWLGAND 548

Query: 407 LGALFELIGATTASTMAYILPP 428
           L     L+G+     + YI PP
Sbjct: 549 LDKFVSLVGSFACIPLIYIYPP 570

>Suva_11.79 Chr11 (157798..159957) [2160 bp, 719 aa] {ON} YKL146W
           (REAL)
          Length = 719

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 85/388 (21%), Positives = 149/388 (38%), Gaps = 43/388 (11%)

Query: 59  VLRENDK---KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL 115
           V RE D+   KSS   A + L  S +G G++  P A  N G     +S +    +     
Sbjct: 313 VSRERDRRPHKSSTAKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSGVSLLLCAIVSYGCF 372

Query: 116 RLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 175
             ++      G   Y      + G K KL IL +  L                +      
Sbjct: 373 VSLITTKDKVGVDGYGDMGRVLYGPKMKLAILLSIALSQIGFSAAYTVFTATNLQVFCEH 432

Query: 176 IFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR 235
            F    G+++       I   V  F+  PLS+ RNI  LS  + +A +  I++ L  V  
Sbjct: 433 FFHLKPGSINL---ATYIFAQVLIFV--PLSLTRNIAKLSGTALIADV-FILLGLVYVYY 486

Query: 236 GPMLPYDWKGHSLKLSDFFMKA--TIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAK 290
             +      G +      F KA  ++F   ++ +F    L+       I  SM++ +  +
Sbjct: 487 YSIYHIAVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP-----IQESMKHPNHFQ 541

Query: 291 FTRLTHISIIISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNML 348
              L+ +  I++V  I C L+ Y   A F    K  VL +FP   +     +L +   +L
Sbjct: 542 -PSLSAVMCIVAVVFISCGLLCY---AAFGADVKTVVLLNFPQDSSYTLTVQLLYALAIL 597

Query: 349 TTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVIT-------SSLVFITMGIS 401
            + P+++F              +++N+   +  SGK +  +         ++V +T  ++
Sbjct: 598 LSTPLQLF----------PAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVLLTSVLA 647

Query: 402 LTTCN-LGALFELIGATTASTMAYILPP 428
               N L     L+G+     + YI PP
Sbjct: 648 WVGANDLDKFVSLVGSFACIPLIYIYPP 675

>Kwal_33.15600 s33 complement(1179716..1181185) [1470 bp, 489 aa]
           {ON} [contig 290] FULL
          Length = 489

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 201 ISFPLSMKRNIEALSKASFLAVISMII-IVLTVVIRGPM-LPYDWKGHSLKLSDFFMKAT 258
           ISF  S+ R   +LSK ++ + ++M I +VL ++  G    P+ W G  +    F  K T
Sbjct: 188 ISFVFSVPRTFSSLSKVAYFSAVTMFIAVVLAMIFVGVQDHPFGWDGTPVTFRAFPQKGT 247

Query: 259 IF 260
            F
Sbjct: 248 TF 249

>SAKL0G12452g Chr7 complement(1058250..1060058) [1809 bp, 602 aa]
           {ON} similar to uniprot|P47082 Saccharomyces cerevisiae
           YJR001W AVT1 Vacuolar transporter imports large neutral
           amino acids into the vacuole member of a family of seven
           S. cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 602

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 71/172 (41%), Gaps = 15/172 (8%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           +S+      N  N ++G G++  P  +K AG + G+   +   F    +  L+   L   
Sbjct: 208 QSTAPQTIFNSINVLIGIGLLALPLGMKYAGWVLGVPMLLTFAFATFCSAELLSRCLDTD 267

Query: 126 GKRTYQGTVEHV-MGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNV 184
                 G + +   G KG+  I F   L              D+    L A+F Q   +V
Sbjct: 268 PTLISYGDLGYAAFGPKGRAFISFLFALDLLGSGVALIILFGDS----LNALFPQY--SV 321

Query: 185 HFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRG 236
            F+  + +   +VT  I  PLS+      LS  S L +IS I IVLTVV  G
Sbjct: 322 TFF--KIIGFFVVTPQIFMPLSI------LSNVSLLGIISTISIVLTVVFCG 365

>TPHA0B02980 Chr2 (679253..681502) [2250 bp, 749 aa] {ON} Anc_2.177
           YNL101W
          Length = 749

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 76/392 (19%), Positives = 154/392 (39%), Gaps = 47/392 (11%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           K+    AF+ L  S +G GI+  P A    G+L  +   +  G    W   +++ +  + 
Sbjct: 338 KTPTTKAFLLLLKSFIGTGILFLPNAFSKGGLLFSIGMLLFFGLYSYWCYFILIRSKQIT 397

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVH 185
              ++      + G+  K +IL +  L                +   +  +F+  D N+ 
Sbjct: 398 KVSSFGDIGLILYGRWMKTIILCSLVLTQIGFSAAYVIFCAKNLRAFIINVFNFPDFNIS 457

Query: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIRGPMLPYD 242
           +     ++I  +  FI  PLS  RN+  LS  S +A   ++  ++IVL   I+   +   
Sbjct: 458 Y-----LMIFQLIVFI--PLSFVRNVSKLSLTSLMANFMIMGGLLIVLFFCIKHLFIDLQ 510

Query: 243 WK-------GHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLT 295
            K       G +  L   F+   IF +   I   +           SM++     F  + 
Sbjct: 511 MKPEAGVIYGFNPDLWSVFIGTAIF-AFEGIGLIIPVQD-------SMKHPE--HFPFVL 560

Query: 296 HISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEI 355
            + I+ + +   L+G  G+  + +  +  +L +   ++  +N+ +L +   +L + P+++
Sbjct: 561 FLVILTATVLFILIGTIGYLAYGKYIETVILMNLSQSNVFVNLVQLFYSVAILLSTPLQL 620

Query: 356 FVLRDVVGNLLHECNLIKNYDEHTQL----SGKQH-----------VVITSSLVFITMGI 400
           F    ++ N +      ++ D  +      SGK +            +I S ++ I    
Sbjct: 621 FPAIKIIENRMFTS--FRSTDNGSSQFLSNSGKLNWRIKWRKNCLRSIIVSCVILIAY-- 676

Query: 401 SLTTCNLGALFELIGATTASTMAYILPPYTNL 432
            L   NL     LIG+     + Y+ PP  +L
Sbjct: 677 -LGYNNLDKFVSLIGSFACIPLVYMYPPMLHL 707

>TBLA0C05630 Chr3 (1364052..1366280) [2229 bp, 742 aa] {ON}
           Anc_2.177 YNL101W
          Length = 742

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 72/324 (22%), Positives = 125/324 (38%), Gaps = 37/324 (11%)

Query: 58  DVLRENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
            +L     K+S + AF  L  S +G GI+  P A    G++   +  +  GF   +   L
Sbjct: 344 QILNRAKGKTSTKKAFFLLLKSFIGTGILFLPNAFSKGGLIFSNVLIIIFGFYSYYCYML 403

Query: 118 IVINLTLAGKRTYQGTVEHVMGKK--GKLL---ILFTNGLFAFXXXXXXXXXXXDTIPHV 172
           ++       KR  Q +    MG K  G L+   ILF+  +                + + 
Sbjct: 404 LI-----KCKRYSQVSSFGEMGNKLYGPLMQKIILFSIMISQIGFSCAYIIFTSTNLNYF 458

Query: 173 LRAIFSQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTV 232
            +        + +F+L     I  +  FI  PLS  RNI  LS  S +A + MIII L +
Sbjct: 459 FQQYPLTEKLDFNFFL-----IFQLILFI--PLSFVRNISKLSVPSLVANL-MIIIGLMI 510

Query: 233 VIRGPMLPY--DWKGHSLKLSDFFMKA---TIFRSLSVISFALVCHHNTSFIFFSMRNRS 287
           VI   +  +  D   H     + F      +IF   ++ +F  +               S
Sbjct: 511 VIYYCVKQFTVDMGFHMANGVEIFFNRQDWSIFVGTAIFAFEGIG-------LLIPIEES 563

Query: 288 VAKFTRLTHISIIISVICCA-----LMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLC 342
           +AK        ++  VI C      L+G  G+  + E     +L + P     +   +L 
Sbjct: 564 MAKPEEFGK--VLGGVIGCVTSLFILIGSMGYVTYGEDINTVILINLPNDKVTVQSIQLL 621

Query: 343 FGFNMLTTFPMEIFVLRDVVGNLL 366
           +   ++ + P++IF    ++ N +
Sbjct: 622 YSIAIMLSIPLQIFPAIKIIENFI 645

>NCAS0F03190 Chr6 (650081..651016) [936 bp, 311 aa] {ON} Anc_5.408
          Length = 311

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 5/72 (6%)

Query: 47  ITPDMDDTLVNDVL-----RENDKKSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGL 101
           +TPDMD++   + L     R + +  +  ++ M LANSI GA  +  P     +G     
Sbjct: 120 VTPDMDESTTPNSLEAVRSRNSSQTRAALISAMALANSIQGASAMPIPLPGGGSGDGNRY 179

Query: 102 LSYVALGFIVDW 113
           L+   +G ++ W
Sbjct: 180 LTNTQIGTVLSW 191

>NCAS0F02310 Chr6 complement(458165..460171) [2007 bp, 668 aa] {ON}
           Anc_5.252 YKL146W
          Length = 668

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 65/155 (41%), Gaps = 16/155 (10%)

Query: 294 LTHISIIISVI--CCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTF 351
           L+ +  I++VI   C L+ YS F     K +  VL +FP       + +L +   +L + 
Sbjct: 494 LSMVMCIVTVIFISCGLLCYSAFG---SKVETVVLLNFPHDSPYTLMVQLLYALAILLST 550

Query: 352 PMEIFVLRDVVGNLLHECNLI-KNYDEHTQLSGKQHVVITSSLVFITMGISLTTCN-LGA 409
           P+++F    ++ N     +   KN  +   L      +I    V +T  I+    N L  
Sbjct: 551 PLQLFPAIKILENWCFPISASGKNNPKVKWLKNYFRCII----VLLTAFIAYVGANDLDK 606

Query: 410 LFELIGATTASTMAYILPPYTNLLLTSKKKSWKER 444
              L+G+     + YI PP  +L     K  W E+
Sbjct: 607 FVSLVGSFACIPLIYIYPPLLHL-----KAYWGEQ 636

>YKL146W Chr11 (171783..173861) [2079 bp, 692 aa] {ON}  AVT3Vacuolar
           transporter, exports large neutral amino acids from the
           vacuole; member of a family of seven S. cerevisiae genes
           (AVT1-7) related to vesicular GABA-glycine transporters
          Length = 692

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 143/387 (36%), Gaps = 41/387 (10%)

Query: 59  VLRENDK---KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTL 115
           V RE+ +   KSS   A + L  S +G G++  P A  N G     L  ++   I     
Sbjct: 286 VSREHGRHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSALCLLSCALISYGCF 345

Query: 116 RLIVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRA 175
             ++      G   Y      + G K K  IL +  L                +      
Sbjct: 346 VSLITTKDKVGVDGYGDMGRILYGPKMKFAILSSIALSQIGFSAAYTVFTATNL-----Q 400

Query: 176 IFSQNDGNVHFWLRRNVIIVMVTTF----ISFPLSMKRNIEALSKASFLAVISMIIIVLT 231
           +FS+N     F L+   I +    F    I  PLS+ RNI  LS  + +A +  I++ L 
Sbjct: 401 VFSEN----FFHLKPGSISLATYIFAQVLIFVPLSLTRNIAKLSGTALIADL-FILLGLV 455

Query: 232 VVIRGPMLPYDWKGHSLKLSDFFMKA--TIFRSLSVISFALVCHHNTSFIFFSMRNRSVA 289
            V    +      G +      F KA  ++F   ++ +F          +     +    
Sbjct: 456 YVYVYSIYYIAVNGVASDTMLMFNKADWSLFIGTAIFTF-----EGIGLLIPIQESMKHP 510

Query: 290 KFTR--LTHISIIISVI--CCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGF 345
           K  R  L+ +  I++VI   C L+ Y   A F    K  VL +FP   +     +L +  
Sbjct: 511 KHFRPSLSAVMCIVAVIFISCGLLCY---AAFGSDVKTVVLLNFPQDTSYTLTVQLLYAL 567

Query: 346 NMLTTFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQH----VVITSSLVFITMGIS 401
            +L + P+++F    ++ N     N    Y+   +          VV+TS L ++     
Sbjct: 568 AILLSTPLQLFPAIRILENWTFPSNASGKYNPKVKWLKNYFRCAIVVLTSILAWVGAN-- 625

Query: 402 LTTCNLGALFELIGATTASTMAYILPP 428
               +L     L+G+     + YI PP
Sbjct: 626 ----DLDKFVSLVGSFACIPLIYIYPP 648

>TBLA0F03230 Chr6 (785400..787085) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/179 (20%), Positives = 78/179 (43%), Gaps = 30/179 (16%)

Query: 282 SMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARL 341
           SMRN    KF  +  + +++      L+G  G+  F +     +L+SF   +  ++IA+L
Sbjct: 343 SMRNPE--KFPLVLSLVLLVCTAIFMLIGTLGYLTFGKDITPVILSSFNQKNKFVSIAQL 400

Query: 342 CFGFNMLTTFPMEIFVLRDVVGNLLHECN----LIKNYDEHTQ----------------L 381
           C+   +L + P+++F +  +V   + + N     I +     Q                L
Sbjct: 401 CYSIAILLSTPIQLFPVYKMVEEAIFKKNKNNTAISSTSSEPQDNDNEENKAMLTEKIIL 460

Query: 382 SGK--------QHVVITSSLVFITMGISLTTCNLGALFELIGATTASTMAYILPPYTNL 432
           SG+        +++  T+ ++ +T+     + +L     ++G+     + YI PP+ +L
Sbjct: 461 SGRDSNKIKWLKNLSRTTIVLLVTIISYFGSQDLSKFVAIVGSVACIPLIYIYPPFFHL 519

>Ecym_8249 Chr8 (510061..511944) [1884 bp, 627 aa] {ON} similar to
           Ashbya gossypii ACR051C
          Length = 627

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 73/381 (19%), Positives = 142/381 (37%), Gaps = 37/381 (9%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           K+S+    + L  + +G G++  P   +N G L      +  G +  +   L++   T A
Sbjct: 233 KASVFKTVLLLLKAFVGTGVLFMPKGFQNGGWLFSCGCLIFFGVVSCFCFLLLIEAKTEA 292

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHV--LRAIFSQNDGN 183
               Y        GK          G+ A             TI     L+  F    G 
Sbjct: 293 CVNGYGDLGRVAYGKS------MQRGILASIVLSQIGFSAAYTIFTATNLQVFF----GE 342

Query: 184 VHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRG----PML 239
           V  W  R  + + +   +  PL++ R I  LS  +  A   ++I+   V + G     +L
Sbjct: 343 VFGWSHRLSVYIFLQLVVYLPLALTRRISRLSGTALAA--DVLILFGLVYVYGYSAVYVL 400

Query: 240 PYDWKGHSLKLSD-----FFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRL 294
            Y     S+K+ +      F+   IF +   I   +    + S      R    A     
Sbjct: 401 RYGVASQSMKMFNRQDWTLFVGTAIF-TYEGIGLLVPIQESMS------RPGRFASCLVW 453

Query: 295 THISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPME 354
              ++    I C L+ YS F     + +  +L +FP      +  +  +   ++ + P++
Sbjct: 454 VIAAVTSIFISCGLLCYSAFG---SRVETVILLNFPKDSVLSSSVQFLYAMAIMLSTPLQ 510

Query: 355 IFVLRDVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFITMGISLTTC-NLGALFEL 413
           +F    ++ + +   ++   +D   + +     V+   +VF+T+ I+     +L     L
Sbjct: 511 LFPAIRILEHGIISSSVSGKHDPRVKWAKNWFRVL---VVFVTVSIAWVGADDLDKFVSL 567

Query: 414 IGATTASTMAYILPPYTNLLL 434
           IG+     + YI PP  + +L
Sbjct: 568 IGSFACVPLIYIYPPLLHYML 588

>Kpol_1029.6 s1029 (11352..13655) [2304 bp, 767 aa] {ON}
           (11352..13655) [2304 nt, 768 aa]
          Length = 767

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/167 (20%), Positives = 69/167 (41%), Gaps = 10/167 (5%)

Query: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           AF  L  S +G GI+  P A  N G++  +   +  G    W   +++ +  +    ++ 
Sbjct: 356 AFFLLLKSFIGTGILFLPRAFDNGGLIFSICMLLFFGIYSYWCYYILIRSKNITQVTSFG 415

Query: 132 GTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRN 191
                + G+  K +ILF+  L                +   +  +F   D ++ +     
Sbjct: 416 DIGYKLYGRWMKFVILFSLVLTQLGFAGAYVIFTAKNLKAFVENVFRVPDFDLKY----- 470

Query: 192 VIIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVVIR 235
             +++   FI  PLS  RN+  LS  S +A   ++S + IV+   ++
Sbjct: 471 --LMIFQLFIFTPLSYVRNVSKLSFPSLVANFFIMSGLAIVIVFTMK 515

>Ecym_5408 Chr5 complement(838376..840523) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AER380C
          Length = 715

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 60/309 (19%), Positives = 117/309 (37%), Gaps = 27/309 (8%)

Query: 66  KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLA 125
           K+S   AF+ L  S +G G++  P A  N G+   ++          W   ++V      
Sbjct: 297 KTSTFKAFLLLIKSFVGTGVLFLPNAFSNGGLAFSIIMLFIFSGYSYWCYYILVRTKVST 356

Query: 126 GKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVH 185
           G  ++      + G   K +ILF+                   +   ++ +F   D  + 
Sbjct: 357 GVSSFGDIGAMLYGPWMKYIILFSLVFAQLGFSSAYVVFTSKNLIAFIQNVFHYPDIPMA 416

Query: 186 FWLRRNVIIVMVTTFISFPLSMKRNIEALSK----ASFLAVISMIIIVLTVVIRGPMLPY 241
           + L   +II +       PLS  RN+  LS     A+FL +  + I+VL          Y
Sbjct: 417 YMLLLQLIIFI-------PLSFVRNVSKLSLSSLLANFLIICGLFIVVL----------Y 459

Query: 242 DWKGHSLKLSDFFMKATIF-----RSLSVISFALVCHHNTSFIFFSMRNRS-VAKFTRLT 295
             K   + LS    +  IF     +    +  A+  +     I     + +   KF  + 
Sbjct: 460 SAKHLIVDLSFKPEEGVIFLFNSKKWTLFVGTAIFAYEGIGLIIPVQDSMAHPEKFPMVL 519

Query: 296 HISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEI 355
              II +     L+G  G+  + +  +  +L + P    ++N+ +  +   +L + P+++
Sbjct: 520 GWVIITTTALFVLVGSLGYLAYGKYIQSVILLNLPQKSLSVNLIQFFYSMAILLSTPLQL 579

Query: 356 FVLRDVVGN 364
           F    ++ N
Sbjct: 580 FPAIAIIEN 588

>Smik_11.90 Chr11 (157718..159760) [2043 bp, 680 aa] {ON} YKL146W
           (REAL)
          Length = 680

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 84/400 (21%), Positives = 151/400 (37%), Gaps = 37/400 (9%)

Query: 61  RENDK---KSSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRL 117
           RE+++   KSS   A + L  S +G G++  P A  N G     +  ++   +       
Sbjct: 276 REHERHPHKSSTVKAVLLLLKSFVGTGVLFLPKAFHNGGWGFSAICLLSCALVSYGCFVS 335

Query: 118 IVINLTLAGKRTYQGTVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIF 177
           ++      G   Y      + G K K  IL +  L                +       F
Sbjct: 336 LITTKDKVGVDGYGDMGRILYGPKMKFAILLSIALSQIGFSAAYTVFTATNLQVFCENFF 395

Query: 178 SQNDGNVHFWLRRNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGP 237
               G++        I   V  F+  PLS+ RNI  LS  + +A +  I++ L  V    
Sbjct: 396 HLKPGSISL---ATYIFAQVLIFV--PLSLTRNIAKLSGTALIADL-FILLGLVYVYVYS 449

Query: 238 MLPYDWKGHSLKLSDFFMKA--TIFRSLSVISFA----LVCHHNTSFIFFSMRNRSVAKF 291
           +      G +      F KA  ++F   ++ +F     L+       I  SM++ +  + 
Sbjct: 450 IYYIAVNGIASDTMLMFNKADWSLFIGTAIFTFEGIGLLIP------IQESMKHPNHFR- 502

Query: 292 TRLTHISIIISV--ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLT 349
             L+ +  I++V  I C L+ Y   A F    K  VL +FP   +     +L +   +L 
Sbjct: 503 PSLSAVMCIVAVVFISCGLLCY---AAFGSDVKTVVLLNFPQDTSYTLTVQLLYALAILL 559

Query: 350 TFPMEIFVLRDVVGNLLHECNLIKNYDEHTQLSGKQH----VVITSSLVFITMGISLTTC 405
           + P+++F    ++ N     N    ++   +          VV+TS L ++         
Sbjct: 560 STPLQLFPAIRILENWTFPSNASGKHNPKVKWLKNYFRCAIVVLTSVLAWVGAN------ 613

Query: 406 NLGALFELIGATTASTMAYILPPYTNLLLTSKKKSWKERL 445
           +L     L+G+     + YI PP  +   +S   + + RL
Sbjct: 614 DLDKFVSLVGSFACIPLIYIYPPLLHYKASSISGTSRARL 653

>CAGL0B04455g Chr2 (435437..437254) [1818 bp, 605 aa] {ON} some
           similarities with uniprot|P50944 Saccharomyces
           cerevisiae YNL101w or uniprot|P36062 Saccharomyces
           cerevisiae YKL146w
          Length = 605

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/79 (25%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 72  AFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQ 131
           A++ L  S +G G++  P A KN G+L  ++ ++ +G    W   ++ + + ++ K +  
Sbjct: 156 AYILLLKSFVGTGVLLLPNAFKNGGMLFSIILFIFIGIYSFWCYYILSV-VKVSTKLSCF 214

Query: 132 GTV-EHVMGKKGKLLILFT 149
           G + + + G   K++ILF+
Sbjct: 215 GEIGKRIYGTPMKVVILFS 233

>KNAG0C03380 Chr3 (665325..666962) [1638 bp, 545 aa] {ON} Anc_7.420
           YER119C
          Length = 545

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 69/172 (40%), Gaps = 13/172 (7%)

Query: 190 RNVIIVMVTTFISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIR-----GPMLPYDWK 244
           R + I++V   ++ PLS    +  L  +  L+  S +  VL V +      G + P+D  
Sbjct: 120 RWLCILLVAACLALPLSCIHGLSVLGYSPILS--STLTAVLAVCMPLFYLFGGVSPFDAG 177

Query: 245 GHSLKLSDFFMKATIFRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTR--LTHISIIIS 302
             +   S+    A     L ++ F   CH N        R R +    R  LT+++   +
Sbjct: 178 TVTRATSN---GAPRLLGLPLLMFMFTCHQNIFPTLNCARERGLKHTLRVPLTYLAAYAA 234

Query: 303 V-ICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPM 353
           V + C + GY  F         NVL  +P       + R+    ++  +FP+
Sbjct: 235 VCLICGITGYLTFHKSTRTIPSNVLLLYPQGSILGTLCRVTTLLSVTLSFPL 286

>KLLA0F04257g Chr6 complement(404952..406457) [1506 bp, 501 aa] {ON}
           conserved hypothetical protein
          Length = 501

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 58/126 (46%), Gaps = 12/126 (9%)

Query: 196 MVTTFISFPLSMKRNIEALSKASFLAVISMII-IVLTVVIRGPM-LPYDWKGHSLKLSDF 253
           ++T  ISF  S+ R   ++SK ++ + I+M I ++L ++  G    P  + G  L  S +
Sbjct: 195 VITAIISFVFSIPRTFASMSKVAYFSAITMFISVILAIIFVGIQDHPVGYDGTHLTFSLW 254

Query: 254 FMKAT-------IFRSLSVISFALVCHHNTSFIFFSMRNRSVAK-FTRLTHISIIISVIC 305
             K T        F ++  +  A V +    FI    R R   K F  +T I ++I  I 
Sbjct: 255 PQKGTSYVDAMGAFLNIVYVFAAQVTY--PQFISEMKRPRDFKKVFLLVTAIEVVIYSIT 312

Query: 306 CALMGY 311
            A+M Y
Sbjct: 313 GAVMYY 318

>NCAS0G02630 Chr7 (473803..475920) [2118 bp, 705 aa] {ON} Anc_2.177
          Length = 705

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 80/415 (19%), Positives = 158/415 (38%), Gaps = 52/415 (12%)

Query: 73  FMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQG 132
           F+ L  S +G G++  P A  N G+   +   +  G    W   ++     + G  ++  
Sbjct: 295 FLLLLKSFIGTGVLFLPGAFHNGGLTFSICMLLFFGIYSYWCYIILTKAKVVTGVSSFGD 354

Query: 133 TVEHVMGKKGKLLILFTNGLFAFXXXXXXXXXXXDTIPHVLRAIFSQNDGNVHFWLRRNV 192
               + G   K +ILF+  +                +   +       D ++ + +   +
Sbjct: 355 IGLKLYGPWMKAIILFSLVVTQIGFSAAYMIFTAKNLSPFVENFLRIPDLDLAYLMGLQL 414

Query: 193 IIVMVTTFISFPLSMKRNIEALSKASFLA---VISMIIIVLTVV-----IRGPMLPYDWK 244
           ++ +       PLS  R +  LS  S LA   ++  ++IVL  V     I   M P D  
Sbjct: 415 LVFI-------PLSFVRKVSKLSFPSLLANSFIMFGLLIVLFFVNKHLFIDLGMRPAD-- 465

Query: 245 GHSLKLSDFFMKATIFRSLSVISF---ALVCHHNTSFIFFSMRNRSVAKFTRLTHISIII 301
              + L   + + T+F   ++ SF    L+       I  SM+N    KF  +  + +I 
Sbjct: 466 --GVILGVNYERWTLFVGTAIFSFEGIGLIIP-----IQDSMKNPE--KFPLVLGLVLIT 516

Query: 302 SVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDV 361
           + I    +   G+  +       +L + P ++  +N+ +L +   ++ + P+++F    +
Sbjct: 517 ATILFISIATIGYLSYGSSIDVVILLNLPQSNIFVNLIQLFYSLAIMLSTPLQMFPAIKI 576

Query: 362 VGNLLHECNLIKNYDEHTQLSGKQHVVITSS-----------------LVFITMGISLTT 404
           + + L     IK Y +     G   + + S                  +  + +   L  
Sbjct: 577 IESKLFP-KFIKVYAKDGNSPGSYELSLNSGKLNWKVKWLKNFVRSIIVTLVVLIAYLEV 635

Query: 405 CNLGALFELIGATTASTMAYILPPYTNL----LLTSKKKSWKERLPF-YLCICFG 454
            NL  +  +IG+     + YI PP  +L    +  S  +  K R+ F YL + FG
Sbjct: 636 ENLDKVVSIIGSLACIPLVYIYPPLLHLRSHSIPFSVNQKVKWRVLFDYLLVGFG 690

>Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W
           (MET7) - Folylpolyglutamate synthetase [contig 67] FULL
          Length = 492

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 6/37 (16%)

Query: 360 DVVGNLLHECNLIKNYDEHTQLSGKQHVVITSSLVFI 396
           DVV N+   C LIK YDEH        VV+T SL  +
Sbjct: 452 DVVPNIESACELIKAYDEHVD------VVVTGSLHLV 482

>KLTH0B00836g Chr2 (73357..74829) [1473 bp, 490 aa] {ON} conserved
           hypothetical protein
          Length = 490

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 201 ISFPLSMKRNIEALSKASFLAVISMII-IVLTVVIRGPM-LPYDWKGHSLKLSDFFMKAT 258
           ISF +S+ R   +LSK ++ +  +M I +VL ++  G    PY + G  +    F  K T
Sbjct: 189 ISFVVSVPRTFSSLSKVAYFSAATMFIAVVLAMIFAGVQDHPYGYDGTPVTFRAFPEKGT 248

Query: 259 IF 260
            F
Sbjct: 249 TF 250

>NDAI0F02660 Chr6 complement(649723..651855) [2133 bp, 710 aa] {ON}
           Anc_2.177
          Length = 710

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 35/83 (42%)

Query: 67  SSMRMAFMNLANSILGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAG 126
           +S    F+ L  S +G GI+  P A  N G+L  ++     G    W   ++       G
Sbjct: 293 TSTAKTFLLLLKSFMGTGILFLPAAFHNGGLLFSIIMLFFFGIYSYWCYYILTKAKVATG 352

Query: 127 KRTYQGTVEHVMGKKGKLLILFT 149
           + ++      + G   K +ILF+
Sbjct: 353 QSSFGDIGLKLYGPSMKFIILFS 375

>KLTH0G07502g Chr7 (608628..610433) [1806 bp, 601 aa] {ON} similar
           to uniprot|P36062 Saccharomyces cerevisiae YKL146W AVT3
           Vacuolar transporter exports large neutral amino acids
           from the vacuole member of a family of seven S.
           cerevisiae genes (AVT1-7) related to vesicular GABA-
           glycine transporters
          Length = 601

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/135 (19%), Positives = 57/135 (42%), Gaps = 11/135 (8%)

Query: 297 ISIIISVICCALMGYSGFAVFKEKTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIF 356
           +S+ I+ I C L+ YS F    E     +L +FP         +L +   ++ + P+++F
Sbjct: 431 VSVSIAFILCGLLCYSAFGSSVETV---ILLNFPRKSAMTASVQLLYALAIMLSTPLQLF 487

Query: 357 VLRDVVGNLLHECNLIKNYDEHTQLSG---KQHVVITSSLVFITMGISLTTCNLGALFEL 413
            +  ++   +   N    Y+   +      +  +V+ ++L+       L   +L     +
Sbjct: 488 PIIRILETSIFPKNASGKYNPRVKWMKNYFRIGIVLANTLI-----AWLGANDLDKFVSI 542

Query: 414 IGATTASTMAYILPP 428
           +G+     + YI PP
Sbjct: 543 VGSFACIPLIYIYPP 557

>Smik_4.761 Chr4 (1344066..1345994) [1929 bp, 642 aa] {ON} YDR484W
           (REAL)
          Length = 642

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 50/107 (46%), Gaps = 10/107 (9%)

Query: 30  TDNDSDDGSQGQNSLNIITPDMDDTLVNDVLRENDKKSSMRMAFMNLANSILGA-----G 84
           TD+D +   Q +  LNI+T + +  +V+ +   N  K+ + + F NL  +IL        
Sbjct: 327 TDDDINRYFQIKKRLNILTQEDNTVMVSQIAENNTAKNYIEIGFKNLNLAILDNCTVEYN 386

Query: 85  IITQPFAI--KNAGILGGLLSYV---ALGFIVDWTLRLIVINLTLAG 126
            +   FAI  +N+  + GLL  +          +TL+LI  N  + G
Sbjct: 387 FLKDFFAINDENSEEINGLLEQIFQPTFDEATAYTLQLIQYNYDIFG 433

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 45,234,673
Number of extensions: 1812665
Number of successful extensions: 7527
Number of sequences better than 10.0: 124
Number of HSP's gapped: 7553
Number of HSP's successfully gapped: 163
Length of query: 480
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 367
Effective length of database: 40,524,141
Effective search space: 14872359747
Effective search space used: 14872359747
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)