Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL063C (CAN1)1.83ON59059029220.0
Smik_5.241.83ON59059027620.0
Skud_5.261.83ON59059027510.0
Suva_5.41.83ON59059026790.0
KNAG0C007901.83ON57951221780.0
NDAI0A006101.83ON56556421710.0
NCAS0B085701.83ON53251220990.0
TDEL0C061801.83ON58359520690.0
TPHA0B044801.83ON60351220360.0
CAGL0J08184g1.83ON57251220150.0
TBLA0A054501.83ON60651219780.0
Smik_14.671.83ON57351219640.0
KAFR0D007001.83ON57451819450.0
SAKL0C02684gsingletonON58851219400.0
YNL270C (ALP1)1.83ON57351219340.0
SAKL0C02662g1.83ON54851219290.0
Kpol_2000.651.83ON59551219330.0
NCAS0A006001.83ON54451419140.0
NDAI0F042001.83ON56657019160.0
Skud_14.701.83ON57351219160.0
KNAG0C05920singletonON59951219030.0
SAKL0C02640gsingletonON54856218880.0
Suva_14.731.83ON49747918770.0
Kwal_33.134011.83ON55956018730.0
KLTH0F02398g1.83ON55551118630.0
ZYRO0F16654g1.83ON58058018530.0
KLLA0C02343g1.83ON58159718520.0
NDAI0F041901.84ON59958618320.0
Smik_14.681.84ON61150818220.0
Kpol_2000.641.84ON61051118200.0
NCAS0A006101.84ON60751118100.0
CAGL0J08162g1.84ON59751218050.0
YNL268W (LYP1)1.84ON61151118050.0
Skud_14.711.84ON61251118000.0
TPHA0B044701.84ON59951217990.0
TBLA0A054601.84ON60851117970.0
Suva_14.751.84ON61160017860.0
TDEL0C061701.84ON57356817790.0
KAFR0D039401.83ON59760017510.0
Kwal_33.134111.84ON56051217400.0
KLTH0F02420g1.84ON62151217410.0
SAKL0C02728g1.84ON56251117340.0
KNAG0F004801.84ON59750817310.0
Ecym_10881.84ON56751217260.0
Ecym_10871.83ON57051017240.0
KLLA0C02365g1.84ON57957916880.0
AFR667C1.84ON56351316470.0
ZYRO0F16632g1.84ON60751116090.0
AFR668W1.83ON55650915710.0
Kpol_358.3na 1ON5755068691e-108
SAKL0G14916gna 1ON5815088681e-108
CAGL0A01199gna 1ON6135118671e-108
Kwal_33.15545na 1ON5764988511e-106
Smik_6.473na 1ON6065108501e-105
Kwal_26.69407.44ON5705228471e-105
TBLA0A07060na 1ON6255068481e-105
TPHA0H028507.44ON6015908431e-104
Ecym_2480na 1ON5865098411e-104
YPL265W (DIP5)na 1ON6085128361e-103
Skud_16.12na 1ON6075828361e-103
TPHA0M00130singletonON6115158341e-103
NCAS0D02260na 1ON5974958301e-102
KAFR0B06430singletonON5935218271e-102
KLTH0B01166gna 1ON5774988211e-101
KLLA0E16281gna 1ON6055928221e-101
KNAG0L02470singletonON6384668241e-101
Suva_16.40na 1ON6065118211e-101
SAKL0C01232gsingletonON6135108121e-99
KLTH0D01474g7.44ON6245198121e-99
CAGL0E05632g7.44ON5985218013e-98
SAKL0F09790gsingletonON5585127956e-98
KNAG0E003907.44ON5995987962e-97
NDAI0E038007.44ON6216127954e-97
YOR348C (PUT4)7.44ON6275257946e-97
NDAI0I02660na 1ON5945127891e-96
Ecym_80357.44ON5635147853e-96
TDEL0C00930singletonON5955837847e-96
Suva_2.6881.50ON6615197872e-95
Suva_8.4027.44ON6835837882e-95
Smik_4.7901.50ON6635187844e-95
NDAI0B052201.244ON6115087804e-95
Skud_4.7841.50ON6635767845e-95
TDEL0H040707.44ON5775267775e-95
Kwal_27.126811.244ON5935817785e-95
SAKL0B10956g7.44ON5725137767e-95
Smik_15.5327.44ON6315257763e-94
ZYRO0D17908gna 1ON5184767655e-94
ZYRO0D03762g1.244ON6004937708e-94
Kwal_33.154075.158ON5875647699e-94
CAGL0K05753g1.50ON6605127741e-93
Kpol_367.77.44ON5845307681e-93
SAKL0D00836gna 2ON6015887691e-93
CAGL0B01012g1.50ON6235117702e-93
SAKL0G14014g5.158ON6055257692e-93
AFR156W7.44ON5584827652e-93
KNAG0L02460singletonON5884997662e-93
SAKL0C01650g1.50ON6135207658e-93
TPHA0B010901.244ON6064967649e-93
NDAI0A006401.50ON6414957661e-92
YDR508C (GNP1)1.50ON6635187652e-92
NCAS0B085801.50ON6275067613e-92
Smik_3.531.50ON6335157624e-92
KLTH0B02046g5.158ON5895457568e-92
KAFR0D005001.50ON6176087588e-92
TDEL0C065101.50ON6425607609e-92
Ecym_60211.244ON6004997552e-91
KNAG0C02140singletonON5985757542e-91
KAFR0C051607.44ON5845087532e-91
YCL025C (AGP1)1.50ON6335087553e-91
KAFR0D00510na 3ON6175087544e-91
CAGL0B03773g5.158ON6055767534e-91
Skud_11.2751.244ON6025227534e-91
Suva_3.1891.50ON6335087554e-91
KLTH0E15642g1.244ON5965087525e-91
Skud_3.381.50ON6335087545e-91
Kpol_543.791.244ON6054937517e-91
YBR068C (BAP2)3.284ON6095117509e-91
ACL135Wna 1ON5885107481e-90
KLLA0A11770g5.158ON5815247471e-90
KAFR0D04120na 4ON6485297512e-90
Kwal_33.132041.50ON6075247473e-90
Suva_4.3073.284ON6095097464e-90
TBLA0C01240singletonON6295107475e-90
Skud_15.5157.44ON6265257466e-90
TBLA0A051801.50ON6765077506e-90
NCAS0E022607.44ON5935307411e-89
KAFR0D00520na 4ON5985137412e-89
TDEL0A08030singletonON5144247342e-89
NCAS0A071105.158ON5925377392e-89
KAFR0E018505.158ON5605287346e-89
Suva_2.716singletonON6035807377e-89
Skud_7.5255.158ON6035027377e-89
TBLA0A05190na 4ON6675577401e-88
Suva_7.4855.158ON6034997351e-88
Smik_16.1155.158ON6034997351e-88
AGR319W5.158ON6265457362e-88
Kwal_23.4026singletonON5344947292e-88
AFR698C1.50ON6095137333e-88
YKR039W (GAP1)1.244ON6025987315e-88
YGR191W (HIP1)5.158ON6034997316e-88
SAKL0D02970g3.284ON6015477309e-88
Ecym_47895.158ON5886107271e-87
NDAI0D021605.158ON5875267271e-87
Suva_11.2731.244ON6015827282e-87
NCAS0A004201.50ON6795197322e-87
Skud_2.1913.284ON6095097273e-87
Smik_2.2013.284ON6095117239e-87
Smik_11.3021.244ON5535417172e-86
KLLA0F23419g7.44ON5735737182e-86
Ecym_10561.50ON6065117193e-86
NDAI0G060301.368ON5995827184e-86
Kpol_1010.325.158ON5994997184e-86
NCAS0A106803.284ON5935097167e-86
Smik_4.2843.284ON6045117169e-86
Kpol_2000.921.50ON6375947181e-85
KNAG0G009005.158ON6135707161e-85
NCAS0B079001.244ON6195097152e-85
TPHA0E036601.50ON6475267172e-85
NDAI0A056203.284ON5715147112e-85
TBLA0G031203.284ON6735087182e-85
SAKL0D04664g1.244ON5935087123e-85
Kwal_33.14276na 2ON5964957123e-85
KAFR0A011203.284ON5925187123e-85
ZYRO0F17446g1.50ON6335117144e-85
CAGL0L03267g1.244ON5975247124e-85
AGR038C3.284ON5805397096e-85
KLLA0C01606g1.50ON6205187117e-85
TDEL0F02830na 5ON5614887061e-84
KNAG0F002701.50ON6344447111e-84
Smik_13.1singletonON5234957021e-84
KLTH0F01584g1.50ON5965117081e-84
TBLA0B077605.158ON6584957112e-84
KLLA0A06930g1.244ON5875117052e-84
CAGL0H08393g3.284ON6125117063e-84
NDAI0C029505.158ON6095247054e-84
Suva_2.2033.284ON6045147054e-84
Skud_6.2na 6ON5584967008e-84
Ecym_26643.285ON5755127009e-84
Kpol_543.78singletonON6055117021e-83
KLLA0F27093gsingletonON5635036991e-83
Kpol_2002.441.50ON6276027022e-83
KLTH0C05170g3.284ON5985167002e-83
YDR046C (BAP3)3.284ON6045117002e-83
Ecym_26623.284ON5895116992e-83
SAKL0C13992gsingletonON5525036945e-83
TPHA0A002405.158ON6035076975e-83
AFR230C1.244ON6045106967e-83
TPHA0A047005.158ON5694936947e-83
NCAS0D018705.158ON5955246958e-83
KAFR0D041401.50ON6375686988e-83
KLLA0A06886gsingletonON5875676941e-82
KAFR0C004003.284ON5826116931e-82
ZYRO0G07172gna 5ON5674936902e-82
Kwal_27.105383.284ON6025126923e-82
NCAS0J00140na 6ON5584886883e-82
KNAG0J022003.284ON6075506924e-82
NDAI0A01340singletonON5544896875e-82
SAKL0D02926g3.285ON5835076888e-82
NCAS0A089201.368ON5995006881e-81
SAKL0A09724gna 7ON5514886813e-81
Skud_4.3003.284ON6045146854e-81
Kwal_26.9612singletonON5435116795e-81
NCAS0I015303.284ON5955116835e-81
KNAG0C005901.50ON6344936865e-81
NDAI0F043901.50ON6674966877e-81
YOL020W (TAT2)1.368ON5925196819e-81
YFL055W (AGP3)na 6ON5584956799e-81
CAGL0M00154gsingletonON5504886771e-80
KLTH0F01606gna 4ON6045386801e-80
CAGL0D02178g1.368ON5775206772e-80
Skud_15.1381.368ON5925196773e-80
KNAG0L00110na 6ON5714876745e-80
KLLA0A10813g1.368ON5845176756e-80
KNAG0H011503.284ON6175126751e-79
Kwal_8.590na 8ON6294316751e-79
KLTH0H13398g1.368ON5874426722e-79
TPHA0M012003.284ON6075216742e-79
Kpol_534.221.368ON5926016722e-79
KAFR0D04130na 3ON6444686743e-79
AGR039Cna 9ON5865076694e-79
TBLA0C012101.368ON6005176704e-79
Ecym_27161.368ON5925216686e-79
SAKL0F16544gsingletonON5675286667e-79
NDAI0A074903.284ON5965586661e-78
SAKL0D02948gna 9ON5945246661e-78
Suva_15.1481.368ON5925216634e-78
Kwal_23.2817na 10ON5805276624e-78
KLTH0B00154gna 8ON5564746581e-77
Smik_15.1461.368ON5935196601e-77
AEL030W1.368ON5825006591e-77
AGR040C3.285ON5735086581e-77
ZYRO0G12342g3.284ON6205156593e-77
Sklu_YGOB_Anc_1.3681.368ON5414396524e-77
ZYRO0A00308gsingletonON5644936536e-77
CAGL0L07546g3.284ON6345926577e-77
KAFR0F02250singletonON5544886527e-77
KNAG0J022103.285ON5814956539e-77
Smik_2.2023.285ON6175836551e-76
Ecym_8297na 11ON5695126511e-76
ZYRO0C18502g7.44ON5755286511e-76
Ecym_2663na 9ON5894936494e-76
Kpol_1065.133.284ON5965146478e-76
SAKL0H08184gna 11ON5984976479e-76
Skud_2.1923.285ON6194976481e-75
TDEL0E05750singletonON5484956421e-75
TPHA0A039603.284ON6155136453e-75
ADL272Wna 11ON5645096413e-75
KLLA0B14685gna 10ON5715256372e-74
KLTH0F04048gsingletonON5835296372e-74
Kwal_33.13215na 4ON5985106372e-74
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL063C
         (590 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...  1130   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...  1068   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...  1064   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...  1036   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              843   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   840   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            813   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   801   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   788   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   780   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   766   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   761   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   753   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   751   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   749   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   747   0.0  
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   749   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   741   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            742   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   742   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            737   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   731   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   727   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   726   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   722   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   718   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   717   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   710   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   706   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   705   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              701   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   699   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   699   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   697   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   697   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   696   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   692   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   689   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   679   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   674   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   675   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   672   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                671   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   669   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   668   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   654   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   639   0.0  
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   624   0.0  
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   609   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   339   e-108
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   338   e-108
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   338   e-108
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   332   e-106
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   332   e-105
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   330   e-105
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   331   e-105
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   329   e-104
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   328   e-104
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   326   e-103
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   326   e-103
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     325   e-103
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              324   e-102
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   323   e-102
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   320   e-101
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   321   e-101
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             322   e-101
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   320   e-101
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   317   e-99 
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   317   1e-99
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   313   3e-98
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   310   6e-98
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   311   2e-97
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     310   4e-97
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   310   6e-97
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   308   1e-96
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   306   3e-96
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   306   7e-96
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   307   2e-95
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   308   2e-95
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   306   4e-95
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   305   4e-95
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   306   5e-95
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   303   5e-95
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   304   5e-95
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   303   7e-95
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   303   3e-94
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   299   5e-94
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   301   8e-94
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   300   9e-94
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   302   1e-93
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   300   1e-93
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   300   1e-93
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   301   2e-93
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   300   2e-93
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   299   2e-93
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             299   2e-93
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   299   8e-93
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   298   9e-93
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   299   1e-92
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   299   2e-92
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   297   3e-92
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   298   4e-92
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   295   8e-92
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      296   8e-92
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   297   9e-92
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   295   2e-91
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   295   2e-91
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   294   2e-91
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   295   3e-91
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      295   4e-91
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   294   4e-91
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   294   4e-91
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   295   4e-91
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   294   5e-91
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   295   5e-91
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   293   7e-91
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   293   9e-91
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   292   1e-90
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   292   1e-90
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   293   2e-90
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   292   3e-90
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   291   4e-90
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   292   5e-90
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   291   6e-90
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   293   6e-90
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     290   1e-89
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   290   2e-89
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            287   2e-89
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   289   2e-89
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   287   6e-89
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   288   7e-89
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   288   7e-89
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   289   1e-88
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   287   1e-88
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   287   1e-88
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   288   2e-88
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   285   2e-88
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   286   3e-88
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   286   5e-88
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   286   6e-88
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   285   9e-88
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   284   1e-87
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    284   1e-87
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   285   2e-87
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   286   2e-87
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   284   3e-87
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   283   9e-87
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   280   2e-86
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   281   2e-86
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   281   3e-86
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   281   4e-86
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   281   4e-86
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   280   7e-86
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   280   9e-86
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   281   1e-85
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   280   1e-85
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   280   2e-85
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   280   2e-85
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            278   2e-85
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              281   2e-85
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   278   3e-85
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   278   3e-85
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   278   3e-85
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   279   4e-85
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   278   4e-85
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   277   6e-85
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   278   7e-85
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   276   1e-84
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   278   1e-84
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    275   1e-84
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   277   1e-84
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   278   2e-84
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   276   2e-84
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   276   3e-84
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    276   4e-84
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   276   4e-84
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      274   8e-84
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   274   9e-84
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   275   1e-83
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   273   1e-83
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   275   2e-83
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   274   2e-83
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   274   2e-83
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   273   2e-83
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   271   5e-83
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   273   5e-83
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   272   7e-83
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   271   7e-83
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   272   8e-83
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              273   8e-83
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   271   1e-82
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                271   1e-82
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   270   2e-82
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   271   3e-82
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      269   3e-82
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   271   4e-82
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              269   5e-82
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   269   8e-82
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   269   1e-81
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   266   3e-81
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   268   4e-81
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   266   5e-81
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              267   5e-81
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   268   5e-81
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   269   7e-81
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   266   9e-81
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   266   9e-81
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   265   1e-80
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   266   1e-80
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   265   2e-80
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   265   3e-80
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   264   5e-80
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   264   6e-80
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              264   1e-79
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   264   1e-79
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   263   2e-79
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   264   2e-79
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   263   2e-79
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              264   3e-79
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   262   4e-79
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   262   4e-79
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   261   6e-79
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   261   7e-79
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   261   1e-78
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   261   1e-78
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   259   4e-78
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   259   4e-78
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   258   1e-77
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   258   1e-77
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   258   1e-77
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   258   1e-77
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   258   3e-77
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   255   4e-77
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   256   6e-77
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   257   7e-77
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              255   7e-77
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   256   9e-77
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   256   1e-76
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   255   1e-76
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   255   1e-76
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   254   4e-76
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   253   8e-76
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   253   9e-76
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   254   1e-75
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            251   1e-75
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              253   3e-75
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   251   3e-75
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   249   2e-74
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   249   2e-74
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   249   2e-74
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   251   2e-74
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   250   4e-74
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   248   6e-74
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   247   7e-74
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   248   1e-73
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   247   3e-73
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   241   2e-72
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   241   3e-72
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   245   5e-72
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   243   5e-72
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   242   7e-72
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   241   9e-72
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   243   9e-72
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   236   2e-70
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                237   9e-70
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   236   4e-69
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   234   9e-69
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   233   2e-68
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   234   2e-68
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   232   6e-68
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   231   1e-67
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   229   6e-67
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   229   7e-67
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   229   8e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   229   1e-66
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   229   2e-66
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   228   4e-66
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    227   5e-66
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   227   6e-66
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   227   7e-66
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   226   8e-66
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   226   1e-65
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   225   3e-65
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              224   4e-65
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   230   4e-65
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   222   3e-64
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   223   4e-64
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   221   5e-64
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   221   6e-64
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   221   1e-63
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   220   2e-63
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   220   2e-63
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   217   5e-63
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   219   5e-63
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   222   2e-62
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   222   2e-62
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   218   2e-62
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   217   3e-62
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              218   3e-62
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   216   7e-62
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   216   8e-62
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   220   9e-62
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   215   1e-61
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   214   2e-61
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   215   2e-61
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                214   3e-61
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      214   3e-61
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   218   5e-61
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   213   9e-61
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   213   9e-61
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   216   2e-60
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   211   4e-60
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   210   7e-60
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   213   2e-59
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   213   4e-59
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   208   1e-57
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   208   2e-57
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   203   2e-57
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   201   1e-56
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   198   1e-55
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   203   1e-55
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   198   2e-55
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   202   2e-55
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   198   3e-55
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                197   4e-55
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   196   1e-54
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   195   3e-54
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   197   9e-54
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   196   4e-53
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     185   8e-53
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     184   2e-52
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   194   2e-52
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   194   2e-52
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   192   1e-51
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   191   1e-51
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   191   3e-51
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   180   7e-48
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         140   2e-36
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...   134   4e-35
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          89   6e-20
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      91   1e-19
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          88   4e-19
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     91   7e-19
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    84   4e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      79   5e-17
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    62   3e-10
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      54   6e-08
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    39   0.025
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              38   0.029
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    39   0.048
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    35   0.61 
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    35   0.61 
Smik_6.7 Chr6 (9124..9204,9208..9294,9405..9470,9474..9617,9624....    35   0.72 
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    35   0.78 
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    34   0.88 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    34   0.98 
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    33   1.6  
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    33   2.1  
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    33   2.6  
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    33   3.3  
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    32   3.5  
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    32   4.1  
TPHA0B04910 Chr2 (1154661..1155797) [1137 bp, 378 aa] {ON}             32   4.4  
KNAG0D01820 Chr4 complement(307599..310298) [2700 bp, 899 aa] {O...    32   5.0  
ZYRO0G12782g Chr7 (1015954..1017684) [1731 bp, 576 aa] {ON} weak...    32   7.2  
Kwal_33.15471 s33 (1121071..1123338) [2268 bp, 755 aa] {ON} YGR1...    32   7.5  
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    31   8.2  

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score = 1130 bits (2922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/590 (94%), Positives = 559/590 (94%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN
Sbjct: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           GEDTFSM           VQNAEVKRELKQRH                    PLTNAGPV
Sbjct: 61  GEDTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
           FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG
Sbjct: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360
           ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS
Sbjct: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY
Sbjct: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540
           RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV
Sbjct: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540

Query: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1068 bits (2762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/590 (88%), Positives = 543/590 (92%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           MT+ K++ +IEEKHMYNEPVTTLFHDVEASQTH RRGS+PLKDEK+KELYPL SF TRV+
Sbjct: 1   MTDPKQNTEIEEKHMYNEPVTTLFHDVEASQTHRRRGSLPLKDEKNKELYPLHSFSTRVD 60

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           GEDTFSM           V+NAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GEDTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
           FALELSVVGQVI+FWT KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG
Sbjct: 181 FALELSVVGQVIEFWTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360
           ELVGITAGEAANPRK+VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT +TSYVS S
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420

Query: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVF+TA FGALAYMETSTGGDKVFEWLLNITGVAGFFAWL ISISHIRFMQALKY
Sbjct: 421 GVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540
           RGISRDELPFKAKLMPGLAY+AATFM III+IQGFTAFAPKF+G+ F AAYISIFLFLA+
Sbjct: 481 RGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAI 540

Query: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILF+ IFRCRFIWKI DVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFEIIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/590 (88%), Positives = 546/590 (92%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           MTN K++A+IEEKHMYNEPVTTL HDVEASQTH RRGS+ LKDEKSKELYPLRSFPT VN
Sbjct: 1   MTNPKQEAEIEEKHMYNEPVTTLLHDVEASQTHRRRGSLSLKDEKSKELYPLRSFPTGVN 60

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           G+DTFSM           VQNAEVKRELKQRH                    PL NAGPV
Sbjct: 61  GQDTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALI+YLFMGSLA+SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT
Sbjct: 121 GALIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180

Query: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
           FALELSVVGQVIQFWT+KVPLAAWISIFWV+ITIMNLFPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360
           ELVGITAGEAANPRK+VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT++TSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420
           PFI+AI+NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRT+KG
Sbjct: 361 PFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKG 420

Query: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVF TA FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY
Sbjct: 421 GVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540
           RGISRDELPFKAKLMPGLAYY++ FM IIIIIQGFTAFAPKFNG SF AAYISIFLF+AV
Sbjct: 481 RGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAV 540

Query: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILF+CIFRCRFIWKI DVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA
Sbjct: 541 WILFECIFRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score = 1036 bits (2679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/590 (85%), Positives = 530/590 (89%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           MT  K+D+++EEKHMY EP  T FHDVEASQTHHRRGS+ LKDEKSKELYPLRSFP  VN
Sbjct: 1   MTTPKQDSEVEEKHMYTEPAGTFFHDVEASQTHHRRGSLSLKDEKSKELYPLRSFPNGVN 60

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           G+DTFSM           VQNAEVKRELKQRH                    PLTNAGPV
Sbjct: 61  GQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPV 120

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
           GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWA+T
Sbjct: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVT 180

Query: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
           FALELSVVGQVIQFWTY VPLAAWISIFWVIIT MN+FPVKYYGEFEFWVASIKV+AIIG
Sbjct: 181 FALELSVVGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIG 240

Query: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300
           FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISK+KNE RFLGWVSSLINAAFTFQGT
Sbjct: 241 FLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGT 300

Query: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS 360
           ELVGITAGEAANPRK+VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT +TSYVSTS
Sbjct: 301 ELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTS 360

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420
           PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSR+LFGLSK+KLAPKF S+TTKG
Sbjct: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKG 420

Query: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           GVPYIAVF T+ FGALAYMETSTGG KVF WLLNITGVAGFFAWLFIS+SHIRFMQALKY
Sbjct: 421 GVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKY 480

Query: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540
           RGISRDELPFKAKLMPGLAYYA  FM +II+IQGFT+F P FNGV+F AAYIS+FLFLA+
Sbjct: 481 RGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAI 540

Query: 541 WILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           WILF+ IFRCRF+WKI DVDIDSDRRDIEAIVWE+ EPKT WDKFWNVV 
Sbjct: 541 WILFELIFRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/512 (79%), Positives = 443/512 (86%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V +AEVKRELKQRH                    PL  AGPVGALISY+FMG+L YSVTQ
Sbjct: 68  VHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQ 127

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVF+QRFLSP+ GAA GYMYWFSWA+TFALELSV+GQVIQ+WTY 
Sbjct: 128 SLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYA 187

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWISIFWV+IT  N+FPVKYYGE EFW+A IKV+AI+GFL+YC CMVCGAGVTGPV
Sbjct: 188 VPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPV 247

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIISKDKNE RFLGWVSSLIN AFT+QGTELVGI+AGEAANPRK+VP
Sbjct: 248 GFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVP 307

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKVVFRIL FYIGSL FIGLLVPYND  L  + SYV++SPFIIAI+NSGT VLPHIF
Sbjct: 308 RAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHIF 367

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVI  TI+SA NSN+YVGSRILFGLSKNKLAPK LSRTTKGGVP+IAV VT+  GALAY
Sbjct: 368 NAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALAY 427

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           METSTGG   F WLLNIT VAGFF WLFIS+SHIRFMQALKYRGISRD+LPFKA LMPGL
Sbjct: 428 METSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPGL 487

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA+  M +IIIIQGFTAFAPKF+G  FAAAYISIFLF+ +W LFQ IFRCRFI K+ D
Sbjct: 488 AYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVED 547

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRRDIEA+VWED EPKT WDKFWN++A
Sbjct: 548 VDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  840 bits (2171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/564 (73%), Positives = 463/564 (82%), Gaps = 7/564 (1%)

Query: 34  HRRGSIPLKDEKSK------ELYPLRSFPTRVNG-EDTFSMXXXXXXXXXXXVQNAEVKR 86
            ++   PLK+ K K      + YPL      V+      ++           ++ AEVKR
Sbjct: 2   DKKQEEPLKNGKIKSSSYELDDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKR 61

Query: 87  ELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATF 146
           ELKQRH                    PLTNAGPVGALI+YLFMG+L YSVTQSLGEMATF
Sbjct: 62  ELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATF 121

Query: 147 IPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWIS 206
           IPVTSSFTVFSQRFLSP+FGAANGYMYWFSWAITFALELSVVGQ+IQFWT  VP+ AWIS
Sbjct: 122 IPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIVAWIS 181

Query: 207 IFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNP 266
           IFWV++  MN+FPV++YGEFEFWVASIKVLAI+GFLIYC CMVCGAGVTGPVGFRYWRNP
Sbjct: 182 IFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPVGFRYWRNP 241

Query: 267 GAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVF 326
           G  GPGII+K+ NE +FLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVPRAIKKVVF
Sbjct: 242 GPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVF 301

Query: 327 RILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTI 386
           RIL FYIGSL FIGLLVPYNDPKLT   SYV+ SPFII+I+NSGT +LPHIFNAVIL+TI
Sbjct: 302 RILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTI 361

Query: 387 ISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGD 446
           ISAANSN+YVGSRI+FGLSK+KLAP+ LSRT K GVP+++V  T  FGALAYMETSTGG+
Sbjct: 362 ISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGE 421

Query: 447 KVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFM 506
             F WLLNITGVAGFF+WLFISISH+RFMQAL+YRGISRD+LPFKAK MPGLAYYA  FM
Sbjct: 422 AAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFM 481

Query: 507 TIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRR 566
           T+IIIIQGFT+F P F+G+ F AAYIS FLF+A+WI+FQ  FRCR IWKI DVDID+DRR
Sbjct: 482 TLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRR 541

Query: 567 DIEAIVWEDHEPKTFWDKFWNVVA 590
           DIE +VWED  P TFWDKFWNVVA
Sbjct: 542 DIEEVVWEDPPPVTFWDKFWNVVA 565

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  813 bits (2099), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/512 (77%), Positives = 441/512 (86%), Gaps = 1/512 (0%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V+   V+RELKQRH                    PL NAGPVGALI+YLFM +LAYSVTQ
Sbjct: 22  VEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQ 81

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVFSQRF+SPAFGAANGYMYWFSW ITFALELSVVGQVIQFWT+ 
Sbjct: 82  SLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWISIFWV++T MN+FPVKYYGEFEFWVA +KV+AI+GFLIYCFCMVCGAGVTGPV
Sbjct: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV 201

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWR+PGA+GPGII+KDKN+ RFLGWVSSLINAAFTFQGTELVGITAGEAANPRK+VP
Sbjct: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKVVFRIL FYI SL FIGLLVPY+D KLT + SYVS SPFIIAIENSGT VLPHIF
Sbjct: 262 RAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVI+ TIISA NSNIYVGSRI++GLS ++LAP  LSRTT+ GVP++AV VT+ FGALAY
Sbjct: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           METSTGG K F WLLNITGVAGFF WLFIS+SHIRFMQAL+ RGISRD+LPFKAK MPGL
Sbjct: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYY   FMT+IIIIQGFT+F P +NG+ F  AYIS+F+F+A+WI FQ  FRCR IW++ D
Sbjct: 442 AYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRR +E  VW + EP+ FWDKFWNVVA
Sbjct: 501 VDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/595 (68%), Positives = 461/595 (77%), Gaps = 17/595 (2%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQ-----THHRRGSIPLKDEKSKELYPLRSF 55
           M N+K+D   E   + N    +  +D ++S       +HR+ S+  K     E  P    
Sbjct: 1   MWNAKQDVSEEGYELGN---FSGMNDEDSSSGQAGAINHRKKSVVSKTTAVDESLP---- 53

Query: 56  PTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
                G  +  +           V  AEVKR LKQRH                    PL+
Sbjct: 54  -----GLSSSDLESSDDFVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLS 108

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175
           NAGPVG LI+YLFM +L YSV QSLGEMATFIPVTS+FTVFS RFLSPAFGAA+GYMYWF
Sbjct: 109 NAGPVGGLIAYLFMATLVYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWF 168

Query: 176 SWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKV 235
           SWAITFALELSVVGQ+I+FWT  VP+AAWI+IFWV++T+ NLFPVKYYGEFEFW+A IKV
Sbjct: 169 SWAITFALELSVVGQIIEFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKV 228

Query: 236 LAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 295
           +A++GF+IYC CMVCGAG+TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF
Sbjct: 229 IALVGFIIYCLCMVCGAGITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 288

Query: 296 TFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTS 355
           T+QGTELVGITAGEAANPRKSVPRAIKKVVFRIL FY    +FIGLLVPYNDPKL  S S
Sbjct: 289 TYQGTELVGITAGEAANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDS 348

Query: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
           YVS+SPFIIAIENSGTKVLPHIFNAV+LTTIISA NSN+YVGSRI++GL+K KLAP F  
Sbjct: 349 YVSSSPFIIAIENSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFG 408

Query: 416 RTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
           RT   GVPY AVF T+AFGALAYME STGG   F WLLNITGVAGFF W+ IS  HIRFM
Sbjct: 409 RTNAAGVPYFAVFFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFM 468

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIF 535
           QALKYRGISRD+LPFKAK MP LAYYA  FM +II+IQGFTAFAP F+GV FAAAY+S+F
Sbjct: 469 QALKYRGISRDDLPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVF 528

Query: 536 LFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           LF+A+W+  Q  FRCR   ++ +VDID+DRRDIEA+VW+D  PKT WDKFWN+VA
Sbjct: 529 LFIAIWLGAQIWFRCRIFHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/512 (76%), Positives = 440/512 (85%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V+ AEVKR+LKQRH                    PL NAGPVGALI+YLFM ++ +SVTQ
Sbjct: 92  VKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQ 151

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVFS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT+ 
Sbjct: 152 SLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHA 211

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPL+AWI I+WVI+TIMNLFPVK+YGEFEFWVASIKVLAIIGFLIYC CMVCGAGVTGPV
Sbjct: 212 VPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPV 271

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 272 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 331

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKV FRIL FYI SL FIGLLVPY+D KLT + SY+S SPFIIAIENSGTK+LPHIF
Sbjct: 332 RAIKKVTFRILIFYILSLFFIGLLVPYDDEKLTSTDSYISASPFIIAIENSGTKILPHIF 391

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL+TIISA NSN+YVGSRILFGL+K KLAPK+   T++GGVPY +VF T++FGALA+
Sbjct: 392 NAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGALAF 451

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +E S+GG K F WLLNI  VAGFFAWL ISI+H+RFMQALK+RGISRD+LPFKA+ MP L
Sbjct: 452 LEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFMPHL 511

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYY+  FMTIIIIIQGFTAFAP FNG  F AAYISIFLF  +W+ FQ  FR + +W + +
Sbjct: 512 AYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWTVEE 571

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRRD++AI+WED  PKTFWDKFW+VVA
Sbjct: 572 VDIDTDRRDVDAIIWEDSGPKTFWDKFWDVVA 603

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/512 (72%), Positives = 430/512 (83%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +++ +VKR LKQRH                    PL NAGPVGAL++YLFMG++ +SVTQ
Sbjct: 61  LEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQ 120

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSF+VF+QRFLSPA GAANGYMY+ SW  TFALELSVVGQ+IQFWT+K
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK 180

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWISIFWV++T  N+FPVK+YGEFEFW+ASIKVLA++GFLIY  C+VCGAG TGP+
Sbjct: 181 VPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGPI 240

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPGA GPGIIS +  E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI+KV+ RIL FYIGSL FIGL VPYNDPKLT + SYVS+SPFII I+N+GT+VLPHIF
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHIF 360

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVILTTIISA NSN+YVGSRILF ++KN LAPKFL++TT  GVPY++V   +AFG+L+Y
Sbjct: 361 NAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSY 420

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           ME STGG K F WLLNITGVAGFFAWL IS SH+RFMQALK+RGISRD+LP+KA  MP L
Sbjct: 421 MELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWL 480

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA  FM +II+IQGFT+FAP F+G  F AAYIS+ LFL  W  FQ  FRCR IWK+ D
Sbjct: 481 AYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLED 540

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRR+IE++VWED  PKT WDKFW+ VA
Sbjct: 541 VDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/512 (75%), Positives = 434/512 (84%), Gaps = 2/512 (0%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V+ A+VKRELK RH                    P+ NAGPVG+LI+Y+FMG+L +SVTQ
Sbjct: 97  VEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQ 156

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVF+ RF+S  FGAA GYMYWFSWAITFALELSVVGQVI+FWT+K
Sbjct: 157 SLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFK 216

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWISIFWV+I IMN FPVK YGEFEFWVASIKV+AIIGF+IYC CMVCGAG+TGPV
Sbjct: 217 VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGITGPV 276

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWR+PG WGPGIISKDKNE RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVP
Sbjct: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKV  RIL FYI SL FIGLLVPYNDPKL+ + SYVS SPFIIAI+NSGTKVLPHIF
Sbjct: 337 RAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHIF 396

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVILTTIISAANSN+YVGSRIL+GLS  KLAPKF  + T+ GVP+IAV  TAAFGALAY
Sbjct: 397 NAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQK-TRNGVPFIAVLFTAAFGALAY 455

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           METS GG   F WLLNITGVAGFFAWL ISISHIRFMQ LK+RG+SRD+LP+KA LMPGL
Sbjct: 456 METSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPGL 515

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYY A F+T+II+IQGFTAFAPKF+  +F  AYIS FLFL ++I+ QC FR R    + D
Sbjct: 516 AYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWRTLDD 575

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRRDI+ ++WE+  P+TFWDKFW V+A
Sbjct: 576 VDIDTDRRDIDTVIWEEG-PQTFWDKFWAVIA 606

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/512 (70%), Positives = 428/512 (83%), Gaps = 1/512 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  EVKR+LKQRH                    PL +AGPVGALISYLFMG++ YSVTQS
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+GQ+IQ+WT  V
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAV 181

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTG-PV 258
           PL AWI IFW ++T+MN+FPVKYYGEFEF +ASIKV+A++GF+ + FC+VCGAG +G P+
Sbjct: 182 PLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPI 241

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPGAWGPGIISK+KNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPR++VP
Sbjct: 242 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKVV RIL FYI SL FIGLLVPYNDPKL    ++VS+SPF+I+IENSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIF 361

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP+FLS  TKGGVPY AV  T+AFG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAF 421

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +ETS G  KVF WLLNITGVAGFFAWL IS+SHIRFMQA+K RGISRD+LP++A++MP L
Sbjct: 422 LETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFL 481

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA+ F+ +I++IQGFTAFAP F  + F AAYIS+FLF+A+W+LFQ  F+CRF+WK+ D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQD 541

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDIDSDRRDIE  VW + E KT W   W++++
Sbjct: 542 VDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/518 (72%), Positives = 432/518 (83%), Gaps = 6/518 (1%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V +AEVKRELKQRH                    PL ++GPVG+LI+Y+F+G+L Y+VTQ
Sbjct: 57  VHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQ 116

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVF+ RFLSP+ GAA GYMYWFSWA+TFALELSVVGQ++ +WT+ 
Sbjct: 117 SLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFA 176

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VP+AAWISIFWVI+T +N+FPVK+YGE EFWVA++KV+AI+GFLIYC CMVCGAGVTGPV
Sbjct: 177 VPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV 236

Query: 259 GFRYWRNPGAWGPGI------ISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           GFRYWRNPG WG G+      ISK+KN GRFLGW +SLINAAFT+QGTELVGITAGEAAN
Sbjct: 237 GFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAAN 296

Query: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTK 372
           PRK+VPRAIKKVVFRIL FYIGSL FIGLLVP++DPKL+   SYVS+SPFIIAIENSGTK
Sbjct: 297 PRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIENSGTK 356

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432
           +LP IFNA+IL TIISA NSNIYVGSRILF L+K  LAPK LSRTTK GVP+++V  TA 
Sbjct: 357 ILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAV 416

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           FG LAYMET+ GG  VF+WL+NIT +AGF+AWLFI ISHIRFMQ LK+RGISRD+LPFKA
Sbjct: 417 FGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKA 476

Query: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
            LMPGLAYYA   M IIII QGFTAF P F+   F AAYIS+ LF  +W  FQ  F+CR+
Sbjct: 477 NLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRW 536

Query: 553 IWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IWK+ DVDIDS+RRD+E I+WED EPKTFWDKFWNVVA
Sbjct: 537 IWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/512 (73%), Positives = 427/512 (83%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           VQ+AEVKR LK RH                    PL +AGPVGALI+Y+FMG++AY VTQ
Sbjct: 77  VQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQ 136

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVF+QRFLSPAFG ANGY+YWFSW ITFALELSVVGQ+IQFWT+ 
Sbjct: 137 SLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFA 196

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPL AWI+IFWVI+T  NLFPVKYYGE EFW+A IKVLAI+GF+IY F MVCGAG TGPV
Sbjct: 197 VPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 256

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFT+QGTELVGITAGE+ NPR++VP
Sbjct: 257 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVP 316

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KV FRIL FYI SLLFIGLLVP+NDPKL    SY+S+SPF+IAIENSGTKVLPHIF
Sbjct: 317 RAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 376

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL+TIISA NSNIYVGSR+L+GL+KNKLAPK  +R TK GVPYI+V  TAAFG LAY
Sbjct: 377 NAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAY 436

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S    KVF+WLLNIT +AGFFAWLFIS++HIRFMQ LK R +SR++LPFKAK MP  
Sbjct: 437 LNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWG 496

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYY+A F+++IIIIQGFTAFAPKFN  +F AAYIS+FLFLA+W++FQ  FR RFI    D
Sbjct: 497 AYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFILTKND 556

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRRDI+ IVWE+  PK  WDKFW  +A
Sbjct: 557 VDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/512 (69%), Positives = 421/512 (82%), Gaps = 1/512 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  EVKR+LKQRH                    PL +AGPVGALISYLFMG++ YSVTQS
Sbjct: 62  ERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEM TFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+G+VIQ+WT  V
Sbjct: 122 LGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAV 181

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPV 258
           PLAAWI IFW ++T MN+FPVKYYGEFEF +ASIKV+A++GF+I+ FC+VCGAG + GP+
Sbjct: 182 PLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPI 241

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK++P
Sbjct: 242 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKVV RIL FYI SL FIGLLVPYNDPKL     +VS+SPF+I+IENSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIF 361

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP+FLS  T+GGVPY +V  T+ FG LA+
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAF 421

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +E S G  K F WLLNITGVAGFFAWL IS SHIRFMQA++ RGISRD+LP+KA++MP L
Sbjct: 422 LEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFL 481

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA+ F+ +I++IQGFTAFAP F  + F AAYISIFLFLA+W+ FQ  F+CR +WK+ D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQD 541

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DIDSDRR IE +VW + E KT W + W+V++
Sbjct: 542 IDIDSDRRQIEELVWIEPECKTRWQRVWDVLS 573

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/512 (70%), Positives = 416/512 (81%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V+  +VKR LK RH                    PL+NAGPVGALI+Y+F+G+LAYSVTQ
Sbjct: 37  VKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSVTQ 96

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVF+QRFLSPA G+ANGY+YW SWAITFALELSVVGQ+IQFWT  
Sbjct: 97  SLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWTDA 156

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPL AWI+IFWVI+TI NLFPVKYYGE EFW+A IKVLAI+GF+IY F MVCGAG TGPV
Sbjct: 157 VPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPV 216

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KV FRIL FYI SLLFIGLLVP+NDPKL    SY+S+SPF+IAIENSGTKVLPHIF
Sbjct: 277 RAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIF 336

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL+TIISA NSN+YVGSRI + ++ N LAPK+L+ TTK G+PY AV  T+  G LAY
Sbjct: 337 NAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFLAY 396

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +E+S+G   VF WLLNIT VAGFF W+ ISISHIRFMQALK++GISRD+LPFKAK MP  
Sbjct: 397 LESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMPWG 456

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA F+ +IIIIQGFTAFAPKF    F  AYIS+ LF   WI FQ  FR     K  D
Sbjct: 457 AYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKTED 516

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +D+D+DRR+I+ +VWE+ +P+  W+KFW  +A
Sbjct: 517 IDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/512 (75%), Positives = 435/512 (84%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           VQ+AEVKRELKQRH                    PL NAGPVG+LI+YLFM ++ +SVTQ
Sbjct: 84  VQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQ 143

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSSFTVFS RF+SP+ GAANGYMYWFSWAITFALELSVVGQ+IQFWT  
Sbjct: 144 SLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPL+AWI I+W I+TIMN+FPVK+YGEFEFWVASIKV+AI+GFLIYC CMVCGAGVTGPV
Sbjct: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKV FRIL FYI SL FIGLLVP++DPKL+   SYVS+SPFIIAI+NSGTKVLPHIF
Sbjct: 324 RAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHIF 383

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL+TIISA NSNIYVGSR++FGL+K KLAP++   TTK GVPYIAV  T+AFGALA+
Sbjct: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +E S+GG K F WLLNI GVAGFFAWL ISI+H+RF+Q L++RGISRD+LPFKA LMP L
Sbjct: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA  FM IIIIIQGFTAFAP FNG  F AAYIS+FLF  +W+ FQ  FRC+  W + +
Sbjct: 504 AYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKLYWSLDE 563

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           VDID+DRRDI+AI+WED  PKTFWD+FW+VVA
Sbjct: 564 VDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/514 (71%), Positives = 423/514 (82%), Gaps = 3/514 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  +VKRELK+RH                    PL  AGP+GALI+YLFMG++ +SVTQS
Sbjct: 31  KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQS 90

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEM TFIPVT+SFTVF+QRFLSPAFGAANGYMYWFSWA+TFALELSVVGQ+IQFWT  V
Sbjct: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWISI WV++TI NLFPV+ YGE EFW+AS+KVLAI+GF+IY  C++CGAGVTGPVG
Sbjct: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAGVTGPVG 210

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYW+NPG WG GIIS + NE RF GWVSSLINAAFTFQGTELVGITAGE   PRK+VP+
Sbjct: 211 FRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPK 270

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AIKKVVFRIL FYIGSLL IGLLVPYNDPKL  + SYVS+SPFII I+N+GTK+LPHIFN
Sbjct: 271 AIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKILPHIFN 330

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AVIL TIISA NSN+Y+GSRIL+GL+KNK APKF + T+K GVPY+ V  T+ FG+LAYM
Sbjct: 331 AVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYM 390

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
           ET+TGGDK F WLLNI GVAGFFAWL IS SHIRFM+ALK RGISR++LP+KA LMP LA
Sbjct: 391 ETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLA 450

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYA  FM III+IQGFT+FAPKF   +F AAYIS+FLF+  W+ FQ  F+CR +WK+ DV
Sbjct: 451 YYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDV 510

Query: 560 DIDSDRRDIEAIVWED---HEPKTFWDKFWNVVA 590
           D+D+DRRDIE  VW D    + K +WD+FWN VA
Sbjct: 511 DLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/570 (63%), Positives = 432/570 (75%), Gaps = 13/570 (2%)

Query: 26  DVEASQTHHRRGSIPLKDEKSKELYPL-----RSFPTRVNGEDTFSMXXXXXXXXXXXVQ 80
           D+   +T   +  I +K  +S E + L     ++ PT    ++  S             +
Sbjct: 5   DINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKD--------E 56

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
             EVKR+L +RH                    PL  +GPVG+LI+YLF+G++ YSVTQSL
Sbjct: 57  YHEVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSL 116

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GEMATFIPVT+SFT+FS RFLSPA GAANGYMYWFSWA+TFALELSVVGQ+IQFWT+ VP
Sbjct: 117 GEMATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVP 176

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF 260
           L AWISIFWVI+TI NLFPV+ YGE EFW+A +KV AI+GF+IYCFC+VCGAG TGPVGF
Sbjct: 177 LPAWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGF 236

Query: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320
           RYWRNPG WG GIIS +  E RFLGW SSLINAAFTFQGTELVGITAGEAANPR++VP+A
Sbjct: 237 RYWRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKA 296

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNA 380
           I+KVVFRIL FYI SL FIGLLVPY+D KL    SYVS+SPFIIAIENSGTK+LPHIFN 
Sbjct: 297 IRKVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNG 356

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL TIISA NSN+Y+GSR+LFGL+KN   PK  ++TTK GVP  AV  T+ FGALA+ME
Sbjct: 357 VILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFME 416

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           TSTGGD+ F+WLLN+ GVAGFF+WL IS +HIRFMQ L+ RGISR++LPFKAK MP LAY
Sbjct: 417 TSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAY 476

Query: 501 YAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVD 560
           YA   M III  QGFTAFAPKF+ ++F A+YIS+FLF   W  FQ  F+CR++WK+ D+D
Sbjct: 477 YATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDID 536

Query: 561 IDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           ID DRR+IE  VW+D  P   W KFW+ VA
Sbjct: 537 IDKDRREIEDRVWQDTTPANLWGKFWDFVA 566

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  742 bits (1916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/512 (69%), Positives = 419/512 (81%), Gaps = 1/512 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
              EV+R+LK+RH                    PL +AGPVGALISYLFMG++ YSVTQS
Sbjct: 62  SRGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSSF+VF+QRFLSPA GA NGYMYW SW  TFALELSV+GQ+IQ+WT+ V
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAV 181

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV-TGPV 258
           PLAAWI IFW ++T+MN+FPVKYYGEFEF +ASIKV+ ++GF+I+ FC+VCGAG   GP+
Sbjct: 182 PLAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPI 241

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPGAWGPGIIS +KNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 242 GFRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAIKKVV RIL FYI SL FIGLLVPYNDPKL    ++VS SPF+I+IENSGTKVLP IF
Sbjct: 302 RAIKKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIF 361

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L TI SA NSN+Y+GSR+L+ LSKN LAPK LS  T+GGVPY+AV +T+ FG LA+
Sbjct: 362 NAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAF 421

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +ETS G  K F WLLNITGVAGFFAWL IS SHIRFMQA+K RGISRD+LP+KA++MP L
Sbjct: 422 LETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFL 481

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA+ F+ +I++IQGFTAFAP F  V F AAYIS+FLF  +W+ FQ  F+CR I K+ D
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQD 541

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DIDSDRR+IE  VW + E KT W + W++++
Sbjct: 542 IDIDSDRREIEEQVWIEPECKTRWQRVWDILS 573

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/512 (67%), Positives = 420/512 (82%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V++  VKR LK RH                    PL NAGPVGALI+Y+F+G++ +SVTQ
Sbjct: 88  VKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQ 147

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEM TFIPVTSSFTVFS RFLSPAFGAANGYMYWFSWA+TFA+ELSV+G+VIQFWT  
Sbjct: 148 SLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA 207

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI IFW ++T+ N+FPVKYYGE EFW+A +KVL+++GFLI+C C+  GAG  GP 
Sbjct: 208 VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPF 267

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWR+PGAWGPGII++D++E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           +AIKKV+ RIL FY+GSL FIG+LVP+NDPKLT +TS+VS+SPFIIAI+NSG  +LP IF
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIF 387

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           N VIL TIISA NSN+YVGSRILFGL+ + LAP+F +RTTK GVP++AV  T+ FG+LA+
Sbjct: 388 NGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAF 447

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +E +T GDKVF WLL+I  +AGFFAWL IS+SHIRFM+AL+YRGISR+ LPFKA  MP L
Sbjct: 448 LELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWL 507

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA  F+ +II+IQGFTAFAP+FN   F A+YIS+ LF+ +W +FQ + +CR  WK+ D
Sbjct: 508 AYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVED 567

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +D+DSDR+DIE I WED  PKTFW K W  +A
Sbjct: 568 IDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/562 (65%), Positives = 429/562 (76%), Gaps = 15/562 (2%)

Query: 29  ASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKREL 88
           ++Q HH       K++ S+EL    S       +D  S+           V+  +VKR L
Sbjct: 2   SAQQHHSSE----KEKNSEELVSEFS-----RSKDVVSLESLGS------VKETQVKRAL 46

Query: 89  KQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP 148
           K RH                    PL+NAGPVGALI+Y+F+G+LAY V+QSLGEMATFIP
Sbjct: 47  KPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIP 106

Query: 149 VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIF 208
           VTSSF VF+QRFLSPA GAANGYMY+ SW+ITFALELSVVGQVIQFWT  VPL AWI I 
Sbjct: 107 VTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAVPLTAWIIIL 166

Query: 209 WVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGA 268
           WV++   NL PVK+YGE EFW+A IKVLAI+GF+IY F MVCGAG TGPVGFRYWRNPG 
Sbjct: 167 WVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTGPVGFRYWRNPGP 226

Query: 269 WGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRI 328
           WGPGIISKD NEGRFLGWVSSLI+AAFT+QGTELVGITAGEAANPRK+VPRAI KV FRI
Sbjct: 227 WGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRI 286

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIIS 388
           L FYI SLLFIGLLVP+NDPKL    SY+S+SPF+IAIENSGTKVLPHIFNAVIL+TIIS
Sbjct: 287 LFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIIS 346

Query: 389 AANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKV 448
           A NS++Y+ SR+L+ +  N LAPK+L+ TTK G+PY AV  T+  G LAY+E+S G   V
Sbjct: 347 AGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVV 406

Query: 449 FEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTI 508
           F+WLLNIT VAGFFAW+ IS++HIRFMQALK++GISRD+LPFKAK MP  AYYAA F+ +
Sbjct: 407 FDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGV 466

Query: 509 IIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDI 568
           IIIIQGFTAFAPKFN   F  AY+S+ LF AVWI FQ  FR     K  D+D+D+DRR+I
Sbjct: 467 IIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREI 526

Query: 569 EAIVWEDHEPKTFWDKFWNVVA 590
           +  VWE+ EPK  W+KFW+ VA
Sbjct: 527 DNDVWEEDEPKNLWEKFWSAVA 548

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/479 (73%), Positives = 406/479 (84%), Gaps = 1/479 (0%)

Query: 113 PLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           PL +AGPVGALISY+FMG++ YSVTQSLGEMATFIPVTSSF+VF+QRFLSPA GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 173 YWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVAS 232
           YW SW  TFALELSV+GQ+IQ+WT  VPL+AWI IFW ++T+MN+FPVKYYGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 233 IKVLAIIGFLIYCFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 291
           IKV+A++GF+IY FCMVCGAG   GP+GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 292 NAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           NAAFT+QGTELVGITAGEAANPRK+VPRAIKKVV RIL FYI SL FIGLLVPYNDPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 352 QSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
              S+VS SPF+I+IENSGTKVLP IFNAV+L TI+SA NSN+Y+GSR+L+ LSKN LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 412 KFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           +FLS  TKGGVPY AV  T+ FG LA++ETS G  K F WLLNITGVAGFFAWL IS SH
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAY 531
           IRFMQA+  RGISR++LP+KA++MP LAYYA+ F+ +I++IQGFTAFAP F  V F AAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 532 ISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           IS+FLF+A+W  FQ  F+C  I K+ DVDIDSDRR+IE  VW +   KT W   W+V+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/560 (63%), Positives = 430/560 (76%), Gaps = 3/560 (0%)

Query: 31  QTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQ 90
           +T  + G +  K E   E Y + SF      ++  S             +NA V+R+LK 
Sbjct: 3   KTSEKEG-MSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSGHG-RNA-VQRQLKP 59

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVT 150
           RH                    PL NAGPVGALISYLFMGS+AY VTQSLGEMATFIPVT
Sbjct: 60  RHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIPVT 119

Query: 151 SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWV 210
           SSFTVF++RFLS   GAANGYMY FSW++T+ALELS+VGQ+I++WT  VP AAWI+IFWV
Sbjct: 120 SSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAAWIAIFWV 179

Query: 211 IITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWG 270
            IT+ NL PVK+YGEF+FW+A IKV+AIIGFL+YC CMVCGAG TGPVGFRYWRNPG WG
Sbjct: 180 PITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYWRNPGPWG 239

Query: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILT 330
            GIIS D +EGRFLGWVSSL+NAAFT+QGTELVGI+AGE+ANPRK+VP+AI KV FRIL 
Sbjct: 240 DGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINKVFFRILL 299

Query: 331 FYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAA 390
           FY+GSL FIGLLVP+ND KLT S SY + SPFIIAI+NSGTK+LP IFNAVIL TIISAA
Sbjct: 300 FYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAA 359

Query: 391 NSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFE 450
           NSN+YVGSR+L+GL+K +LAP+F +RT + GVP +AV   A FG L Y+  S G  K F+
Sbjct: 360 NSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFD 419

Query: 451 WLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIII 510
           WLLNIT +AGFF+WLFIS+ H+RFMQALK +GISRD+LPFKAKLMP  AYY+A F+T+II
Sbjct: 420 WLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLII 479

Query: 511 IIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEA 570
           IIQGFT+ AP FN  +F AAYIS+F+FL +W +FQC +R R I +I  VDIDSDRR+++A
Sbjct: 480 IIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVDA 539

Query: 571 IVWEDHEPKTFWDKFWNVVA 590
             W++ EP T W KFW  +A
Sbjct: 540 QQWDNTEPTTLWGKFWAAMA 559

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/511 (69%), Positives = 416/511 (81%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           Q   ++R LK RH                    PL +AGPVG+LISYLFMGSLA+ VTQS
Sbjct: 45  QERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQS 104

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPV SSFTVF++RFLSPA GAANGYMY FSW ITFALELS+VG++IQ+WT  V
Sbjct: 105 LGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGV 164

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           P AAWI IFWV I++ NL  VK+YGEF+FW+A IKV+AI+GFLIYC CMVCGAG TGPVG
Sbjct: 165 PNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGPVG 224

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPG WG GIISK K+EGRFLGWVSSL+NAAFT+QGTELVG++AGE+ANPRK+VP+
Sbjct: 225 FRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPK 284

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI+KV  RIL FY+GSL FIGLLVP+NDPKL  + +Y ++SPFIIAI+NSGT+ LP IFN
Sbjct: 285 AIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQNSGTRALPDIFN 344

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AVILTTIISAANSN+YVGSR+L+GL+K  LAPK + R  + GVPYI V + + FG L Y+
Sbjct: 345 AVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYL 404

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S+G  K F+WLLNIT +AGFFAWLFIS+ HIRFMQALKY+GISRD+LPFKAKLMP  A
Sbjct: 405 SVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGA 464

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYAA F+ +IIIIQGFTAFAPKFN  +F AAY+S+FLF+AVW++FQ IF+ R I K+ DV
Sbjct: 465 YYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDV 524

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DIDSDRR+IEA VWED EP   W KFW  +A
Sbjct: 525 DIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/580 (60%), Positives = 440/580 (75%), Gaps = 7/580 (1%)

Query: 16  YNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGE-----DTFSMXXX 70
           Y  P+    H++++S+ +  + S  L +   KE     S P + N       D       
Sbjct: 3   YKGPLEFNQHELDSSKENTDKPS--LNETYVKEYDRSISSPPKENDGYGYRVDNEYDVDD 60

Query: 71  XXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMG 130
                   V++ EVKR LK RH                    PL NAGPVG LI+YLFM 
Sbjct: 61  SVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMA 120

Query: 131 SLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQ 190
           ++A+SV QSLGEMAT+IPVTS+F+VFSQRFLSPAFGAANGYMYWFSW+ITFALELSV+GQ
Sbjct: 121 TIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQ 180

Query: 191 VIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVC 250
           ++Q+WT+KVP+AAWISIFWV+I  +N  PVK+YGEFEFW+A IKV+AI+GF+IYCF MVC
Sbjct: 181 IVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVC 240

Query: 251 GAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEA 310
           GAG TGPVGFRYWR+  A+G GIISK+KNE RFLGWVSSLINAAFT+QGTELVGITAGEA
Sbjct: 241 GAGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEA 300

Query: 311 ANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSG 370
           ANPRK+VP++IK+ ++RIL FYI SLLF+GLLVP+ND  L  S SY ++SPFI+AI+NSG
Sbjct: 301 ANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKNSG 360

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
           TK LP IFNAVILTT+ISAANS++YVGSR+++ +++N+LAP  L++ +KGGVPY AV  T
Sbjct: 361 TKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFT 420

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           +A GALAY+ETS+ G  VF WL+NITGVAGFF+W  IS SH+RFM+ALK RGISR++LPF
Sbjct: 421 SAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPF 480

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
           KA  MP +A Y+  FMT+II++QGFT F P F    F A+YIS+ LF  +W +FQ  FRC
Sbjct: 481 KASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRC 540

Query: 551 RFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
             +  I ++DID+DRRD++A VWED  PKT WDKFWN+VA
Sbjct: 541 PLLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/597 (62%), Positives = 439/597 (73%), Gaps = 23/597 (3%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           MT+  +  ++EE    +  +         SQ+   R  + + + K  +       P R +
Sbjct: 1   MTSIAQQIELEELEALHSNL---------SQSQSARSGMHVSNSKIDD-------PLRFS 44

Query: 61  GEDTFSMXXXXXXXXXX-----XVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
            ++  ++                +  AEVKR LK RH                    PL 
Sbjct: 45  KDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLW 104

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175
           NAGPVG+LI+++ +G+LAYSVTQSLGEMATFIPVTSSFTVFSQRF+SPA GAANGYMYWF
Sbjct: 105 NAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWF 164

Query: 176 SWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKV 235
           SWAITFALELS+VGQ+IQ+WT  VPL AWI+IFWV++   N+FPVK+YGEFEFWVASIKV
Sbjct: 165 SWAITFALELSIVGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKV 224

Query: 236 LAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 295
           +AIIGFLIY  CMVCGAG  GP+GFRYWR PG WG GII+K+ N+ RFLGWVSSLI+AAF
Sbjct: 225 IAIIGFLIYSLCMVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAF 284

Query: 296 TFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST- 354
           T+QGTELVGITAGE  NPRK+VPRAI KV FRIL FYIGSL FIGLLVPYNDPKL  S  
Sbjct: 285 TYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDN 344

Query: 355 -SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKF 413
            SY++ SPF+IAI N  T VLPHIFNAVILTTIISA NSN+YVGSRILFGLSKN LAPKF
Sbjct: 345 GSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKF 404

Query: 414 LSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIR 473
            S+TTK GVP+IAV +TA FG LAY+  S    +VF+WLLNIT +AGF  WL ISISHIR
Sbjct: 405 FSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIR 464

Query: 474 FMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYIS 533
           FMQ LK+RGISRD+LP+KAK MP  AYYAA F+T+IIIIQGFTAFAP FN   F AAYIS
Sbjct: 465 FMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYIS 524

Query: 534 IFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +FLF  VW +FQ I+R +    + +VDIDSDRRDI+ I+WE+ EPK  W+KFW V A
Sbjct: 525 VFLFFIVWAIFQTIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  710 bits (1832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/586 (59%), Positives = 428/586 (73%), Gaps = 13/586 (2%)

Query: 18  EPVTTLFHDVEASQTHHRRGSIPLKDEK----SKELYPLRSFPTRVNGED---------T 64
           E  T+  H +E     +  G   + DEK     K+L     F   +N            T
Sbjct: 14  EKDTSEIHSIEEGNNVYENGIETINDEKIVFDKKKLAHTNQFNADINSITHSLTRSRIAT 73

Query: 65  FSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
                           + +VKR LKQRH                    PLTN+GPVG+LI
Sbjct: 74  HHEDDQEEEAEEAQYHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLI 133

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           +YLFMGS+ Y +TQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+E
Sbjct: 134 AYLFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVE 193

Query: 185 LSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIY 244
           +SVVGQVI++WT KVPLAAWI+IFWV+IT++N FPVK YGE EFW+A IKVLAI+G+L+Y
Sbjct: 194 ISVVGQVIEYWTDKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLY 253

Query: 245 CFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVG 304
              +VCG    GP+GFRYWRNPG WGPGIISKD N GRFLGWVSSLINAAFT+QGTELVG
Sbjct: 254 ALIIVCGGSSQGPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVG 313

Query: 305 ITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFII 364
           ITAGEAANPRK+VPRAI KVVFRI  FYI SL FIG+LVPYND +L  +++ +++SPF+I
Sbjct: 314 ITAGEAANPRKTVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVI 373

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424
           +I+N+GTKVLP IFNA+++ TIISAANSN+YVGSR+L+ L+ +  APK  +  T+ GVPY
Sbjct: 374 SIQNAGTKVLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPY 433

Query: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + V VT+A G LA++  +   +  F WL+NI+ +AG  AWLFISISHIRFMQALK+RGIS
Sbjct: 434 LGVIVTSALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGIS 493

Query: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILF 544
           RD+LPFKAKLMP  AYYA  F+T+II IQGF AF+P ++  +F  +YIS+ +   ++I  
Sbjct: 494 RDDLPFKAKLMPFGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGC 553

Query: 545 QCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           Q  +RCRF W++ D+DIDSDRR+IEA++WED EPKT WDKFW  VA
Sbjct: 554 QIFYRCRFFWRVEDIDIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/508 (66%), Positives = 410/508 (80%), Gaps = 1/508 (0%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LI+Y+FMG++ Y +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG +NGYMYWF+WAIT+A+E+SV+GQVIQ+WT KVPLA
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV+IT+MN FPVK YGEFEFWVAS+KVLAI+G+LIY   +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           WRNPGAWGPGIISK+K+EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL FIGLLVPYN+P+L+ S++ +++SPF+I+I+N+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442
           L T+ISAANSN+YVGSR+L+ L+++  APK     TK GVPY+ V  TAA G LA++  +
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
              +  F WL++I+ +AG  AWLFIS++HIRFMQALK RGISRD+LPFKAKLMP  AYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 503 ATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDID 562
           + F+TIII IQGF AF P F+   F  +YIS+ L   V+I  Q  ++CRFIWK+ D+DID
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           SDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/511 (66%), Positives = 402/511 (78%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           Q+  VKR LKQRH                    PL+NAGPVG+LI+Y+FMGS+ Y VTQS
Sbjct: 100 QDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQS 159

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT  V
Sbjct: 160 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAV 219

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWI IFWVI+T+MN FPVK YGEFEFW+ASIKVLAI+G+LIY   +VCG    GP+G
Sbjct: 220 PLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGSHQGPIG 279

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPG WGPGIIS    E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVPR
Sbjct: 280 FRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 339

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KVVFRI  FYI SL FIGLLVP+ND +L   ++ +++SPF+I+I+N+GT+ LP IFN
Sbjct: 340 AINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQNAGTRALPDIFN 399

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AV+L TIISAANSN+YVGSR+L+ L+    APK  S  TK GVPY+ V  TAA G LA++
Sbjct: 400 AVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLAFL 459

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   +  F WL+NI+ +AG  AWLFIS+SHIRFMQALKYRGISRD+LPFKAKLMP  A
Sbjct: 460 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPWGA 519

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYA+ F+T+II IQGF AF PKF+  +F  +YIS+ L   ++   Q  +RCRFIWK+ D+
Sbjct: 520 YYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVEDI 579

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DIDSDRR+IEAI+WE+ EPK  W+KFW  VA
Sbjct: 580 DIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/511 (65%), Positives = 406/511 (79%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            + EVKR LKQRH                    PLTN+GPVG+LI+YLFMGS+ YS+TQS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SVVGQVI++WT KV
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWI+IFWV +T+MN FPVK YGE EFW+A +KVLAI G+L+Y   +VCG    GP+G
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPG WG GIISKDKN  RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVPR
Sbjct: 277 FRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 336

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KVVFRI  FYI SL FIGLLVPY+DP+L+  ++ V++SPF+I+I+N+GTK+LP IFN
Sbjct: 337 AINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFN 396

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+++ T+ISAANSN+YVGSR+L+ L++   APK  +  T+ GVPY+ V  TAA G LA++
Sbjct: 397 AIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFL 456

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   +  F WL+NI+ +AG  AWLFISISHIRFMQALK+RGISRD+LPFKAK MP  A
Sbjct: 457 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAA 516

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYA  F+T+II IQGF AF+P F+  +F  AYIS+ +   ++I  Q  +RCRF WK+ D+
Sbjct: 517 YYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDI 576

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DID+DRR+IE ++WED EPKT+WDKFW  VA
Sbjct: 577 DIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/512 (65%), Positives = 410/512 (80%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V +  VKR LKQRH                    PL+N+GPVGALI+Y+FMG++ Y VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT+K
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI IFWV+IT+MN FPVK YGEFEFWVASIKV+AI+G+LIY   +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPGA G GIIS D  E RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KVVFRI+ FYI SL F+GLLVPYNDP+L+ S++ +++SPF+I+I+N+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L T+ISAANSN+YVGSR+L+ L+++  APK  +  T+ GVPY+ V  TA  G LA+
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +   +  F WL+NI+ +AG  AWLFIS++HIRFMQALK+RGISRD+LPFKAK MP  
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYA+ F+T+II IQGF AFAPKF+   F  AYIS+ L + ++   Q  +RCRF+WK+ D
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DIDSDRR+I+AIVWED EP+  W+KFW  VA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  699 bits (1805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/511 (65%), Positives = 409/511 (80%), Gaps = 1/511 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  VKR LKQRH                    PL+NAGPVG+LI+Y+FMG++ Y VTQS
Sbjct: 102 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQS 161

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG +NGYMYWF+WAIT+A+E+SV+GQVI++WT KV
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKV 221

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWI+IFWVIIT+MN FPVK YGEFEFWVAS+KVLAI+G+LIY   +VCG    GP+G
Sbjct: 222 PLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGSHQGPIG 281

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPGAWGPGIIS DK+EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KVVFRI+ FYI SL FIGLLVPYND +L+ S++ +++SPF+I+I+N+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AV+L T++SAANSN+YVGSR+L+ L++   APK     T+ GVPY+ V  TAA G LA++
Sbjct: 402 AVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFL 461

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   +  F WL+NI+ +AG  AWLFIS++HIRFMQALK+RGISRD+LPFKAKLMP  A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGA 521

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYAA F+T+II IQGF AF P F    F  +YIS+ L   V+I  Q  ++CRFIWK+ D+
Sbjct: 522 YYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDI 580

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DIDSDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/511 (65%), Positives = 406/511 (79%), Gaps = 1/511 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  VKR LKQRH                    PL+ AGPVG+LISY+FMG++ Y +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT KV
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLA WI+IFWV+IT+MN FPVK YGEFEFWVAS+KVLAI+G+LIY   +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPGAWGPGIIS DKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KVVFRI+ FYI SL FIGLLVPYN+P+L+ S++ +++SPF+I+I+N+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AV+L T+ISAANSN+YVGSR+L+ L++   APK     TK GVPY+ V  TAA G LA++
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   +  F WL+NI+ +AG  AWLFIS++HIRFMQAL+ RGISRD+LPFKAKLMP  A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYAA F+T+II IQGF AF P F    F  +YIS+ L   V+   Q  ++CRFIWK+ D+
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DID+DRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/512 (65%), Positives = 403/512 (78%), Gaps = 1/512 (0%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           VQ+  VKR LKQRH                    PL NAGPVGALI+Y+FMGS+ Y +TQ
Sbjct: 89  VQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQ 148

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSS TVFS+RFLSPAFG  NGYMYWF+WAIT+A+E+SVVGQVIQ+WT  
Sbjct: 149 SLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDA 208

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI+IFWV +T++N FPVK YGE EFWVASIKVLAIIG+LIY   +VCG    GP+
Sbjct: 209 VPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSSQGPI 268

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVP
Sbjct: 269 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 328

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KVVFRI  FYI SL FIGLLVPYND  L+   SY+++SPF+I+I+N+GT  LP IF
Sbjct: 329 RAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYALPDIF 388

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV++ TIISAANSN+YVGSR+L+ L++   APK  +  TK GVP++ V VTA+ G LA+
Sbjct: 389 NAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAF 448

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +   +  F WL+NI+ +AG  AW FI++SHIRFMQALKYRGISRD+LPFKAKLMP  
Sbjct: 449 LVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWG 508

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYY+A F+ +II IQGF AF P ++  +F  +YIS+ L + V+I  Q  +RCRF+ K+ D
Sbjct: 509 AYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVED 567

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DID+DRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 568 IDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/511 (64%), Positives = 405/511 (79%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ +VKR LK RH                    PL  +GPVG+LI+Y+FMG++ Y VTQ+
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS RFLSPAFG +NGY+YWF+WAIT+A+E+SVVGQVI+FWT KV
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKV 217

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWISIFWV++T +N FPV  YGE EFWVAS+KVLAI+G+LIY   +VCG    GP+G
Sbjct: 218 PLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGSKQGPIG 277

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWR+  A G G+ISKDKNE RFLGWV+SLINAAFT+QGTELVGITAGEAANPRKSVPR
Sbjct: 278 FRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPR 337

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KVVFRI+ FYI SL FIGLLVPYNDPKL  +TSY+++SPF+I+IEN+GT+ LPHIFN
Sbjct: 338 AINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVISIENAGTRALPHIFN 397

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+I+ TIISAANSN+YV SR+L+ L+ +  APK  +R T  GVP++ V VTA  G LA++
Sbjct: 398 AIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFL 457

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   ++ F WL+NI+ +AG  AWLFIS+SH+RFM+ALKYRGISRD+LPFKA+ MP  +
Sbjct: 458 VVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGS 517

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYA  F+T+II IQGFTAF+PKF+  SF  AYIS+ L   ++I  Q  +RCRF WK+ D+
Sbjct: 518 YYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDI 577

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DID+DRR+I+ IVWED EPKT WDKFW  VA
Sbjct: 578 DIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/600 (57%), Positives = 429/600 (71%), Gaps = 15/600 (2%)

Query: 4   SKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGED 63
            +E  + EE+ + ++    + H++E   T ++  +  + DEK   L             D
Sbjct: 14  DEEQDNSEEQSIRDDSTNQIEHEMEVIDTSNKPVAYSI-DEKQDNLKKKSGLMLDGTIGD 72

Query: 64  TFSMXXXXXXXXXXX-------------VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
             S+                         ++  V+R LKQRH                  
Sbjct: 73  INSITNSLTRSQIASHEQGGDDEEEEAHYEDKHVRRALKQRHIGMIALGGTIGTGLFVGI 132

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANG 170
             PL+NAGPVG+LI+Y+FMG++ Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG +NG
Sbjct: 133 STPLSNAGPVGSLIAYIFMGTVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNG 192

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWV 230
           YMYWF+WAIT+A+E+SV+GQVI++WT KVPL  WI+IFWV+IT+MN FPVK YGEFEFWV
Sbjct: 193 YMYWFNWAITYAVEVSVIGQVIEYWTTKVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWV 252

Query: 231 ASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSL 290
           AS+KVLAI+G+LIY   +VCG    GP+GFRYWRNPGAWGPGIIS DKNEGRFLGWVSSL
Sbjct: 253 ASVKVLAIMGYLIYALVIVCGGSKQGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 312

Query: 291 INAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           INAAFT+QGTELVGITAGEAANPRK+VPRAI KVVFRI+ FYI SL FIGLLVPY DP+L
Sbjct: 313 INAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRL 372

Query: 351 TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
           + S++ +++SPF+I+I+N+GT  LP IFNA++L T+ISAANSN+YVGSR+L+ L++   A
Sbjct: 373 SASSAVIASSPFVISIQNAGTYALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNA 432

Query: 411 PKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           PK     TK GVPY+ V  TAA G LA++  +   +  F WL+NI+ +AG  AWLFIS+S
Sbjct: 433 PKQFGYVTKQGVPYLGVLSTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLS 492

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAA 530
           HIRFMQAL  RGISRD+LPFKAK MP  AYYA+ F+T+II IQGF +F P F    F  +
Sbjct: 493 HIRFMQALNQRGISRDDLPFKAKFMPYGAYYASFFVTVIIFIQGFQSFCP-FRVADFFTS 551

Query: 531 YISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           YIS+ L   V+   Q  ++CRFIWK+ D+DIDSDRR+IEAI+WED EPK  W+KFW  VA
Sbjct: 552 YISLILLAVVFTGCQLYYKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/568 (60%), Positives = 427/568 (75%), Gaps = 3/568 (0%)

Query: 25  HDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXV--QNA 82
           H+ + S T    G    +D+   EL+PL     +V      ++               + 
Sbjct: 7   HEKDDSPTISPVGKTE-QDKYGYELHPLDPVTQQVTLRTVTNVCDGLEEEDAEEAGYHDT 65

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            VKR LKQRH                    PL+NAGPVG+LI+YLFMGS+ Y +TQSLGE
Sbjct: 66  RVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQSLGE 125

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           MATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQFWT  VPLA
Sbjct: 126 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAVPLA 185

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRY 262
           AWI+IFWV ++++N FPVK YGE EFWVASIKV+AI+G+LIY   +VCG    GP+GFRY
Sbjct: 186 AWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGSSQGPIGFRY 245

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           WRNPG WGPGIIS DKNEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRKSVPRAI 
Sbjct: 246 WRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIN 305

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           KVVFRI+ FYI SL F+G+LVP+NDP+L  + + +++SPF+I+I+N+GT+VLPHIFNAV+
Sbjct: 306 KVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNAGTRVLPHIFNAVV 365

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442
           + TIISAANSN+YVGSR+L+ LS+   APK     T+ GVPY+ V  T+  G LA++  +
Sbjct: 366 MLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLAFLVVN 425

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
              +  F WL+NI+ +AG  AWLFIS+SHIRFMQALK+RGISRD+LPFKAKLMP  AYYA
Sbjct: 426 NNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPWGAYYA 485

Query: 503 ATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDID 562
           A F+T+II IQGF AF+PKF+   F  AYIS+ + + + I  Q  +RCRF+WK+ D+DID
Sbjct: 486 AFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLEDIDID 545

Query: 563 SDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DRR+IE I+WE+ EP+  W+KFW+++A
Sbjct: 546 TDRREIECIIWEEEEPQNLWEKFWSIMA 573

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/600 (56%), Positives = 427/600 (71%), Gaps = 19/600 (3%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHH---RRGSIPLKDEKSKELYPLRSFPT 57
           +  SK + D  E    N+  TT + + E  +  H   +  SI  K   S EL  L    +
Sbjct: 7   IIRSKRNEDSTES---NDDSTTSYDNFEIIEIQHNDSKDNSIKKKIPNS-ELASLTHAYS 62

Query: 58  RVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
           R   E                 ++ +VKRELKQRH                    PL +A
Sbjct: 63  RSRVEPEHD-----EDAEEADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADA 117

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GPVGALI+Y+FMGS+ Y VTQ+LGEMATFIPVTSS TVFSQRFLSPAFG ANGYMYWF+W
Sbjct: 118 GPVGALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNW 177

Query: 178 AITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLA 237
           AITFA+E+SVVGQVIQ+WT  VPLAAWI+IFWV++T+MN FPVK YGE EFWVA +KV+A
Sbjct: 178 AITFAVEISVVGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIA 237

Query: 238 IIGFLIYCFCMVCGAGV-TGPVGFRYWRNPGAWGPGIISK------DKNEGRFLGWVSSL 290
           I+G+L+Y   +VCG     GP+GFRYWRNPGAWG G+ S        K EGRFLGWV+SL
Sbjct: 238 IVGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASL 297

Query: 291 INAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           INAAFT+QGTELVGITAGEAANPRK+VPRAI KVVFRI+ FYI SL FIGLLVP+ D +L
Sbjct: 298 INAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL 357

Query: 351 TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLA 410
           +  T+ +++SPF+I+IEN+GTK+LP IFNA+++ T++SAANSN+YVGSR+L+ L+  K+A
Sbjct: 358 SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVA 417

Query: 411 PKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISIS 470
           PK  +R T+ GVP++ V  T+  G LA++      +  F WL++I+ +AG  AWLFIS++
Sbjct: 418 PKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLA 477

Query: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAA 530
           H+RFMQ LK RGISRD+LPFKAK MP  +YYAA ++ +II +QGF AF+P F+  +F   
Sbjct: 478 HVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTD 537

Query: 531 YISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           YIS+ L   V+I  Q  +RCRF+WK+ DVDIDSDRR+IE  +WED EPKT WDKFW  +A
Sbjct: 538 YISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/512 (63%), Positives = 394/512 (76%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +Q  +VKR LK RH                    PL++AGPVGALI+Y+FMGS+ Y VTQ
Sbjct: 49  LQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQ 108

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           S+GEMATFIPVTSS TVFS RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT  
Sbjct: 109 SMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKA 168

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI IFWV IT+ N FPV++YGE EFWVASIKV+AI+G+L+Y   +VCG    GP+
Sbjct: 169 VPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSKQGPI 228

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WG GIIS DK++GRFLGWV+SLINA+FT+QGTELVGITAGEAANPRK+VP
Sbjct: 229 GFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKTVP 288

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           +AI KV FRIL FYI SL F+GLLVPYN P L + TS +++SPF+I+I+++GT++LP IF
Sbjct: 289 KAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRILPDIF 348

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L TIISAANSN+YVGSRILF L+   +APK  S  T  GVPY+ V  TA  G LA+
Sbjct: 349 NAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGLLAF 408

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +      ++ F WL+NI+ +AG  AWLFISISHIRFMQ LK RGISRD+LPFK+KLMP  
Sbjct: 409 LVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYG 468

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA ++ +II +QGF AF PKF    F   YIS+ L   V+ L Q  +RCRF  ++ D
Sbjct: 469 AYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNRLED 528

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DIDSDRR+I+A++WE+ EP T W KFW  VA
Sbjct: 529 IDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/512 (62%), Positives = 396/512 (77%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +Q  +VKR LK RH                    PL+ +GPVGALI+Y+FMG++ Y VTQ
Sbjct: 110 MQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQ 169

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           S+GEMATFIPVTSS TVFS RFLSPAFG ANGYMYWF+WAITFA+ELSV GQVI++WT  
Sbjct: 170 SMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEA 229

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VP AAWI+IFWV++T+ N FPV++YGE EFWVASIKVLAI+G+LIY   +VCG    GP+
Sbjct: 230 VPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGSKQGPI 289

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWRNPG WG GIISKDK+EGRFLGWV+SLINA+FT+QGTELVGITAGEAANPR++VP
Sbjct: 290 GFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRTVP 349

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KV FRIL FYI SL F+GLLVPYN   L ++T+ +++SPF+I+I+N+GT+ LP IF
Sbjct: 350 RAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIASSPFVISIQNAGTRALPDIF 409

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L TIISAANSN+YVGSR+LF L+   +APK  S  T  GVP++ V VT+  G LA+
Sbjct: 410 NAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGLLAF 469

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +   ++ F WL+NI+ +AG  AWLFISISHIRFMQ LK RGISRD+LPFK+KLMP  
Sbjct: 470 LVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLMPYG 529

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA ++T+II +QGF AF+P F    F  +YIS+ L + V+   Q  +RCRF  ++ D
Sbjct: 530 AYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRFFNRLED 589

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DIDSDRR+ +A++WED EP T W KFW  VA
Sbjct: 590 IDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/511 (64%), Positives = 406/511 (79%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  EVKR LK RH                    PL+ +GPVGALI+Y+F+GS+ Y VTQS
Sbjct: 52  RETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQS 111

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E++VVGQVIQ+WT  V
Sbjct: 112 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAV 171

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWI+IFWV++T+ N FPVK+YGE EFWVAS+KV+AI+G+LIY   +VCG    GP+G
Sbjct: 172 PLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQGPIG 231

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWRNPG WGPGIISKD NEGRFLGWVSSLINAAFT+QGTELVGITAGEAANPRK+VPR
Sbjct: 232 FRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 291

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KV FRIL FYI SL FIGLLVPY+D +L+ +T+ +++SPF+I+I+N+GTKVLPHIFN
Sbjct: 292 AINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLPHIFN 351

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+++ TIISAANSN+YVGSR+L+ L+ +  APK     TK GVPY+ V VTA  G LA++
Sbjct: 352 AIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFL 411

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             +   ++ F WL+NI+ +AG  AWLFIS+SH+RFMQ LK+RGISR++LPFKAKLMP  A
Sbjct: 412 VVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGA 471

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYAA F+ +IIIIQGF AF PKF    F  +YIS+ L   +++  Q  +RCRFIW + D+
Sbjct: 472 YYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWSLDDI 531

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DIDSDRR+I+AIVWED EPK  W+KFW  VA
Sbjct: 532 DIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  671 bits (1731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/508 (62%), Positives = 402/508 (79%), Gaps = 1/508 (0%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V   +VKR LKQRH                    PL+ AGPVG+LI+Y+FMG++ Y VTQ
Sbjct: 87  VHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQ 146

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+E+SV+GQVIQ+WT  
Sbjct: 147 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKA 206

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           VPLAAWI+IFWV++T+MN FPVK YGE EFW+A +KVLAI+G+LIY   +VCG    GP+
Sbjct: 207 VPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPI 266

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWR+PGA+GPGIISK+KN G+FLGWV+SLINAAFT+QGTELVGITAGEAANPRK+VP
Sbjct: 267 GFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVP 326

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           RAI KVVFRI+ FYI SL FIG+L+PYND +L+   + +++SPF+I+I+N+ TKVLP IF
Sbjct: 327 RAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIF 386

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV++ T++SAANSN+YVGSR+L+ L+    APK  S  T+ GVPY+ V  TA+ G LA+
Sbjct: 387 NAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAF 446

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +   +  F WL+NI+ +AG  AWLFIS++HIRFMQALK+RGISRD+LPFKAKLMP  
Sbjct: 447 LVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWG 506

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA F+T+II IQG+ AF P ++  +F  +YIS+ L   + +  Q  +R RF+ K+ D
Sbjct: 507 AYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLED 565

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
           +DID+DRR+IE+IVWED EPKT WDKFW
Sbjct: 566 IDIDTDRREIESIVWEDDEPKTLWDKFW 593

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/512 (60%), Positives = 394/512 (76%), Gaps = 1/512 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
              EVKR LK RH                    PL  AGPVG+LI+Y+FMG++ YS+TQS
Sbjct: 56  HETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQS 115

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+ELSVVGQ+I +WT  V
Sbjct: 116 LGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVV 175

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PL AWI+IFW+I+T++N FPV++YGE EFW+AS+KV+ I+G+LIY F +VCG    GP+G
Sbjct: 176 PLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGSSQGPIG 235

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FR WRNPG WG G+IS ++ E RFLGWVSSLI AAFT+QGTELVGITAGE+ NPRK+VP+
Sbjct: 236 FRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 295

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ-STSYVSTSPFIIAIENSGTKVLPHIF 378
           AI KV FRIL FYI SL F+GLLVPYNDP++   S + V+ SPF+I+I N+GTK+LP IF
Sbjct: 296 AINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIF 355

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAV+L T++SAANSN+Y+GSR+++ L+++  APK      + GVP + V VTA  G +A+
Sbjct: 356 NAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAF 415

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  +      F WL+NI+ +AG  AWLFIS++HIRFMQ LK RGISRD LPFKAK MP  
Sbjct: 416 LVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWA 475

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA+F+ +II IQG+TAF+PKF+   F  AYIS+ L L V+I  Q  ++CRF+WK+ D
Sbjct: 476 AYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLED 535

Query: 559 VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           +DID++RR+I+AIVWED EPK  WDKFW+ +A
Sbjct: 536 IDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/510 (62%), Positives = 395/510 (77%), Gaps = 2/510 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            + +VKR+LK RH                    P+  AGPVG+L++YLFMG++A+ VTQS
Sbjct: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSSFT+++QRFLSPA GAANGY+YWFSW +TFALELS++GQ+IQ+WT+ V
Sbjct: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PL+ WI +FW+++T  N+ PV++YGE EFW+A++KVL+I GFLIY   MVCG    G +G
Sbjct: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYW+NPG WG G+IS +K E RFLGWVSSLI AAFT+QGTELVGITAGE+ NPRK+VP+
Sbjct: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           AI KV FRIL FYI SL F+GLLVPY DP+L T S S ++TSPF++AI+NSGTKVLP +F
Sbjct: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           N VIL TI+SA NSNIY+GSR+L+GLSK+ LAP    +T K GVP+ AV  ++ FG LAY
Sbjct: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S    KVF+WLL IT VAGFFAWL IS+SHIRFMQ LK RGISR++LPFKAK MP  
Sbjct: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
           AYYAA F+T+II+IQGF +FAP+F    F A YIS+FLF+  W+ FQ +F+ R I +  D
Sbjct: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537

Query: 559 VDIDSDRRDIEAIVW-EDHEPKTFWDKFWN 587
           VDID+DRR+I+A+VW +D EPKT   K W 
Sbjct: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/579 (58%), Positives = 419/579 (72%), Gaps = 23/579 (3%)

Query: 13  KHMYNEPVTTLFHDVEASQTHHRRGSIPLKD-EKSKELYPLRSFPTRVNGEDTFSMXXXX 71
           K M++    TL    +A +      SI L D + S ELY          GE  F      
Sbjct: 23  KGMFSTDSGTLSKRSKAGED-----SIELSDVQVSSELY---DHAESEEGEGDF------ 68

Query: 72  XXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGS 131
                      EVKR LK RH                    PL+ +GPVG+LI+Y+FMGS
Sbjct: 69  --------HETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGS 120

Query: 132 LAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQV 191
           + Y VTQSLGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAIT+A+ELSV+GQ+
Sbjct: 121 VVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQI 180

Query: 192 IQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG 251
           I +WT  VPLAAWI+IFWV++T  N FPVK+YGEFEF VASIKV+AI+G+L+Y   +VCG
Sbjct: 181 INYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCG 240

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
               GP+GFRYWRNPG WG G I+K+ N+ RFLGWV SL+NA+FT+QGTELVGITAGEA+
Sbjct: 241 GSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEAS 300

Query: 312 NPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGT 371
           NPRK+VP+AI KV FRIL FYIGSL F+GLLVPYN P+L  +++ +++SPF+I+I+N+GT
Sbjct: 301 NPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQNAGT 360

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           KVLP IFNAV+L TI+SA NSN+YVGSR+L+ L+ +  APK  S  TK GVPY+ V  TA
Sbjct: 361 KVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTA 420

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
             G LA++ T+   +  F WL+NI+ +AG  AW FIS++HIRFMQ LK RGISRD LPFK
Sbjct: 421 LLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFK 480

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           AKLMP  AYYAA F+ +I+ IQGFTAFAP+F+   F  AYIS+ L + ++IL Q  +RCR
Sbjct: 481 AKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCR 540

Query: 552 FIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           F+ KI D+DIDSDRR+I+AI+WED EPK  W+KFW  +A
Sbjct: 541 FLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/513 (59%), Positives = 393/513 (76%), Gaps = 2/513 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           Q  EVKR LK RH                    PL  AGPVG+L++Y+F+G++ YS+TQS
Sbjct: 51  QETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQS 110

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVFS+RFLSPAFG ANGYMYWF+WAITFA+ELSVVGQ+IQ+WT +V
Sbjct: 111 LGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           P+AAWI IFWV++T++N FPV++YGE EFW+AS+KVL I+G+LIY F +VCG    GP+G
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIG 230

Query: 260 FRYWRNPGAWGPGIISKD-KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
                   A G    S+  +    FLGWVSSLI AAFT+QGTELVGITAGE+ NPRK+VP
Sbjct: 231 LPATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVP 290

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPHI 377
           +AI KV FRIL FYIGSLLF+GLLVPY+DP+L ++S++ V+ SPF+I+I+N+GTK+LP I
Sbjct: 291 KAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKILPDI 350

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
           FNAV+L T+ISAANSN+Y+GSR+ + L+    APK L+  TK GVPY  V +T+  G ++
Sbjct: 351 FNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMS 410

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  +      F+WL+NI+ +AG  AWLFIS++HIRFMQ LK+RGISRD+LPFKAK MP 
Sbjct: 411 FLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPW 470

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
            AYYA  F+T+II IQG+TAF PKF+  +F  +YIS+FL L V+I  Q  ++CRF+W + 
Sbjct: 471 AAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVE 530

Query: 558 DVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           D+DIDSDRR+I+AIVWE+ EPK  WDKFW+ VA
Sbjct: 531 DIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/511 (58%), Positives = 386/511 (75%), Gaps = 1/511 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            + +VKR LK RH                    PL+ +GPVG+LI+Y+FMGS+ Y VTQS
Sbjct: 98  HDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQS 157

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSS TVF++RFLSPA G +NGYMYWF+WAITFA ELSV GQ+IQ+WTYKV
Sbjct: 158 LGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKV 217

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           PLAAWI IFWVI+ ++N FPVK YGE EFWV+S+KVLAI+G+LIY   +VCG    GP+G
Sbjct: 218 PLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQGPIG 277

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYWR+  A+G G ISK+K+E RFLGWVSSLINAAFT+QGTELVGI+AGEAANPRK+VPR
Sbjct: 278 FRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRKTVPR 337

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AI KV+FRI  FYI SL FIGLLVPYND +L+  ++ +++SPF+I++ N+GT  LP IFN
Sbjct: 338 AINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALPDIFN 397

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AVIL T++SAANS++Y+ SR+L+ L+    APK  +   + GVPY+ VFVT   G LA++
Sbjct: 398 AVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGWLAFL 457

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S   +  F WL+NI+ +AG  AW FI  +HIRFMQALK++GISRD+LPFKA+ MP  A
Sbjct: 458 VVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFMPWGA 517

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDV 559
           YYAA F+ +II IQG+ AF P ++  SF  +YIS+ LF  +++     +R R + KI D+
Sbjct: 518 YYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIKIEDI 576

Query: 560 DIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590
           DID+DR+++EA VWE+  P+ +W+KFW  VA
Sbjct: 577 DIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/509 (60%), Positives = 392/509 (77%), Gaps = 3/509 (0%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             ++VKRELK RH                    P+ NAGPVG+L++Y+F+ ++AY VTQS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGEMATFIPVTSSFTVF+ RF+SPA GAANGY+YW SW ITFALE+SV+G++I +W+  V
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
           P+ AW++IFWV++T +NL PVK+YGEFEFW+AS+KV+AI+ FL Y   +VCG    G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FRYW++PG WG GI+S++ +  +FLGWVSSLI AAFTFQGTELVG+TAGE  NPR++VP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ--STSYVSTSPFIIAIENSGTKVLPHI 377
           AI  V FRIL FYIGSLL IGLLV Y+DP+L Q  ST+  + SPF++AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VI+ TIISA NSNIYVGSR+L+GL ++ LAP F+SRTT  GVPY+AV  T+ FGAL 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           Y+  S+    VF+WLL+IT V+GFF WL IS+SHIRFMQ LK RGISRD+LPFKAK MP 
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
            AYYAA F+ +II++QGFTAF P F+ V F A YIS F+F+ +W+LFQ +F+ R+   + 
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 558 DVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
           ++DID+DRRDI+AI+W+D +P T W K W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  339 bits (869), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 186/506 (36%), Positives = 293/506 (57%), Gaps = 11/506 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
               +K+ELK RH                     L   GP   LI+Y F+G L + V   
Sbjct: 46  DGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMAC 105

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W  + 
Sbjct: 106 LGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRE 164

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF V+I I+N   V+Y+GEFEFW++S K++ + G +++ F ++ G G    
Sbjct: 165 TVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHD 224

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F + G EL GI A EA NPR++
Sbjct: 225 RLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRN 284

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSYVSTSPFIIAIENSGTKV 373
           +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L     +++  + SPF++AI+NSG + 
Sbjct: 285 IPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRA 344

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++T + GVPY A+F    F
Sbjct: 345 LPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLF 404

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  ++F + +N+  + G  +W+ I I++I F +A   + + R+   ++A 
Sbjct: 405 CLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAP 464

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFI 553
             P  AY    F  +I  I+ FT F  +F+  SF   YI + L++  +  ++ I++ + +
Sbjct: 465 FQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV 524

Query: 554 WKIGDVDIDSDRRDIEAIVWEDHEPK 579
            K  + D+ S +   EAI  E+ E K
Sbjct: 525 -KAEEADLYSFK---EAIDREEAEGK 546

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/508 (37%), Positives = 302/508 (59%), Gaps = 13/508 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +K+EL+ RH                     L+ AGPV  LI+Y F+G L Y V   LGE
Sbjct: 54  RLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGE 113

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY--KVP 200
           MAT+IP+   FT ++ R+  PA G A GY Y F + I    +L+    V+Q+W    KV 
Sbjct: 114 MATYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VG 259
              WI+IF VII  +N+  VK++GEFEFW++S KVL ++  ++  F ++ G G +   +G
Sbjct: 173 PGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           FR++++PGA+ P   +   ++G+F+ +V+  + A F + GTEL GI A E  NPR++VPR
Sbjct: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENSGTKVLPH 376
           AIK  ++RI+ FY+ ++  +G+ V YNDP L Q+   ++  + SPF++AI+N+G  VLPH
Sbjct: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPH 352

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           IFNA +L  + SA NS++YV SR L+GL+ +  APK  ++T K GVPY ++ +   F  L
Sbjct: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AYM  S+G  +VF + +N+  + G  +W+ I I++I F +AL+ +G+ +  L + A L  
Sbjct: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472

Query: 497 GLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555
             AY+A  F  +I +I+ FT F   KF+  +F   YI I +F+  +  ++ I   +F+ K
Sbjct: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFV-K 531

Query: 556 IGDVDIDSDRRDIEAIVWEDHEPKTFWD 583
             + D+ + +   E I  E+ E K  WD
Sbjct: 532 PEEADLYTFK---ELIDLEEEEGK-LWD 555

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  338 bits (867), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 298/511 (58%), Gaps = 13/511 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  ++++LK RH                     L  AGP+   I+Y F+G L +    +
Sbjct: 82  EHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAA 141

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW--TY 197
           LGEMA++IP+   FT ++ R+  PA G A GY Y   + I    +L+    VIQ+W    
Sbjct: 142 LGEMASYIPL-DGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
           +V    WI+IF VII  MN   VK++GEFEFW+++ KV+ +IG +I  F ++ G G T  
Sbjct: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFR++ +PGA+ P   S D ++G+F+ +V+ L+ A F + G EL GI A EAANPRKS
Sbjct: 261 RLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKS 320

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ---STSYVSTSPFIIAIENSGTKV 373
           +P+AIK  ++RI+ FY+ ++  +G+ V Y+DP L +   S +  + SP+++AI NSG K 
Sbjct: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKA 380

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFNA +L  + SA NS++YV SR L+GL+ +  APK  + T + GVPY ++ +++ F
Sbjct: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  K+F + +N+  + G  +W+ I I+++ F +A+K + + R    ++A 
Sbjct: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             P  +Y+   F  +I  I+ FT F    F+  +F   YI I +F+  +  ++ + + + 
Sbjct: 501 FQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTK- 559

Query: 553 IWKIGDVDIDSDRRDIEAIVWEDHEPKTFWD 583
           IWK  +VD+ + +  I+    E+ E     D
Sbjct: 560 IWKPEEVDLYTFKAAID----EEEEQGKIAD 586

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/498 (37%), Positives = 297/498 (59%), Gaps = 9/498 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+EL+ RH                     L +AGPV  LISY F+G L Y+V   
Sbjct: 46  EGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSC 105

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+QFW  + 
Sbjct: 106 LGEMAAFIPL-DGFTSYASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRD 164

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF  +I ++N   V+++GEFEFW++S+KVL ++G ++  F ++ G G    
Sbjct: 165 RVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHD 224

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
             GFR+WR+PGA+ P   +   ++G+F+ + S    A F + GTEL GI A EA NPR+S
Sbjct: 225 RTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRS 284

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVST---SPFIIAIENSGTKV 373
           VPRAIK  ++RI+ FY+ ++L +G+ V YNDP+L ++    ++   SPF++AIEN+   V
Sbjct: 285 VPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPV 344

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFN  +L  + SA NS++YV SR L+GL+ +  AP+  + T K GVPY ++ ++  F
Sbjct: 345 LPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLF 404

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  +VF + +N+  + G  +W+ I I++IRF +A++ +   +  L + A 
Sbjct: 405 CLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAA 464

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             P   Y A  F  +I +I+ +T F   KF+  +F + YI I ++L  ++ ++ ++R + 
Sbjct: 465 FQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKL 524

Query: 553 IWKIGDVDIDSDRRDIEA 570
           I K  DVD+ + +  I+A
Sbjct: 525 I-KPEDVDLYTFKDAIDA 541

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  332 bits (850), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 190/510 (37%), Positives = 299/510 (58%), Gaps = 15/510 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N  +K+ELK RH                     L   GPV  LI+Y F+G L +     
Sbjct: 76  ENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMAC 135

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  + 
Sbjct: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G    
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYWR+PGA+     +   + G+F  +V+  + + F++ G EL GI   EA NPRKS
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENSGTKV 373
           VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +   +   + SPF++AI+NSG KV
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T+K GVPY A+ ++  F
Sbjct: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  + A 
Sbjct: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
                AY+A +F  +I +I+ FT F   KF+  +F   YI + +++  W  ++ I++ + 
Sbjct: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554

Query: 553 IWKIGDVDIDS-----DRRDIEAIVWEDHE 577
           I K  DVD+ +     DR + E  + +D E
Sbjct: 555 I-KSTDVDLYTFKEIYDREEEEGRI-KDQE 582

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  330 bits (847), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 183/522 (35%), Positives = 293/522 (56%), Gaps = 21/522 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ L+ RH                     L+  GP G L SY+ +  + Y V  +LGEM
Sbjct: 49  LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEM 108

Query: 144 ATFIPVTS-----SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
             ++P +      S +    R+  P+ G A G+ Y++ + I  A E +    V+ +WT  
Sbjct: 109 VCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTV 168

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP- 257
           VP AAWI+IF  ++T++N  PVK+YGE EFW A +K+L I+G L   F +  G G +   
Sbjct: 169 VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDR 228

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKS 316
           +GFRYW+ PGA+   I +   N GRFL   + +I   F F  G ELV +T+ EA + R++
Sbjct: 229 LGFRYWQKPGAFAYHITTG--NTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRN 286

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIENSGTK 372
           + +A ++  +R++ FY+ S L IG++V  NDP     L    +  ++SPF+IAI+N+  K
Sbjct: 287 IEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIK 346

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432
           +LPHI NA IL++  S+ NS ++  SR L  ++++ +APK   +  + GVPY AV V+AA
Sbjct: 347 ILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAA 406

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           F  LAY+  S+G  K F W  NI+ ++GF  W+ I ++++RF +A+ +RG+  D +PFK+
Sbjct: 407 FSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKS 465

Query: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQCIFRCR 551
              P   Y+    ++II +  G+  F P+F  G  F AAYI++ +F+ +W+  +   R  
Sbjct: 466 PFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTL 525

Query: 552 FIWKI--GDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWN 587
             W I   +VD+ +   +IE +  E       P + W+KF +
Sbjct: 526 STWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  331 bits (848), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 184/506 (36%), Positives = 297/506 (58%), Gaps = 14/506 (2%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ L+ RH                     L+ AGP    I+Y F+G L +    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK--VPL 201
           A++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  +  V  
Sbjct: 159 ASYIPM-DGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGF 260
             WI+IF V+I I+N+  VK++GEFEFW++S KVL ++G ++  F ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320
           RYW++PGA+ P   + D + G+F+ +VS  + A F + G EL GI A EA NPRKSVPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST---SYVSTSPFIIAIENSGTKVLPHI 377
           +K  V+RI+ FY+ ++  +G+ V YNDP+L  +    +  + SPF++AI+NSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
           FNA +L  + SA NS++YVGSR L+ L+ +  AP    RTT  G+P+ ++ V   F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           YM  S+G  +VF + +N+  + G  +W+ I I++I FM+A+K +G+ R +  + A   P 
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 498 LAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI 556
             Y++  +   I  I+ FT F    F+  +F   YI + +F+  +  ++ I + + + K 
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIV-KS 576

Query: 557 GDVDIDS-----DRRDIEAIVWEDHE 577
            +VD+ +     D+++IE  + +  +
Sbjct: 577 HEVDLFTGKEVFDQQEIEGKILDQEK 602

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  329 bits (843), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/590 (32%), Positives = 314/590 (53%), Gaps = 35/590 (5%)

Query: 24  FHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDT-----FSMXXXXXXXXXXX 78
             D+ +S+   +     L D +++++    S   R N +D+      ++           
Sbjct: 14  LEDIPSSKNELKE----LGDMEAQQMNLDDSLDDRFNKKDSGLNKVLTVSSDTSTNSLEE 69

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
                +K+ LK RH                     L   GP G  I+Y  + S+ Y +  
Sbjct: 70  DYTNTLKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMN 129

Query: 139 SLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQ 193
           ++GEM  ++P        S T   +R++  +   A G+ Y++ + I  A E +    V++
Sbjct: 130 AVGEMVCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVE 189

Query: 194 FWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253
           +WT  VP AAWI+IF  II ++N+  VKY+GE EFW ASIK+L I+G +I  F +  G G
Sbjct: 190 YWTLAVPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGG 249

Query: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAA 311
            +   +GFRYW+NPGA+   +   D + G FL   S +I  AF F  G ELV +T+ E +
Sbjct: 250 PSHDRLGFRYWKNPGAFAHHV--TDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECS 307

Query: 312 NPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIE 367
           + R+++ +A K+ ++R++ FYI   L IG++V +NDP     L+ +T    +SPF+I I+
Sbjct: 308 DQRRNIAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQ 367

Query: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAV 427
           N+G +VLPHI NA ILT+  S+ N+ ++  SR LF +++N  APK   R  K GVPY+AV
Sbjct: 368 NAGIEVLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAV 427

Query: 428 FVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487
            ++     LAY+  S+   +VF WL NI+ ++GF  W+   I+++RF +A+ Y  +  D 
Sbjct: 428 ILSTLISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDR 486

Query: 488 LPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQC 546
           +PFK    P L  ++ T ++II I  G+  F PKF  VS F AAYI++ +FLA+++  + 
Sbjct: 487 MPFKTWGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKV 546

Query: 547 IFR-------CRFIWKIGDVDIDSDRRDIEAIVWEDHE----PKTFWDKF 585
                      +  + + D+D+ +   +IE    E  E    P   W++F
Sbjct: 547 YNHFKNDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERF 596

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 299/509 (58%), Gaps = 14/509 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K++L+ RH                     L+ AGP+  LI+Y  MG + ++V   
Sbjct: 54  KGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSC 113

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY-- 197
           LGEMA +IP+   FT ++ R+  PA G A GY Y F + +    +L+    V+Q+W    
Sbjct: 114 LGEMAAYIPL-DGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRG 172

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-G 256
           KV    WI++F  +I  +N+  VK++GEFEFW++S KVL ++  +     +V G G +  
Sbjct: 173 KVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHN 232

Query: 257 PVGFRYWRNPGAWGP--GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
            +GFRYW++PG + P  G +S    +G+F+ + S  + A F + GTEL GI A E  NPR
Sbjct: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST---SYVSTSPFIIAIENSGT 371
           ++VPRAIK  ++RI+ FY+ ++  +GL V YNDP L Q+    +  + SP+++AI+N+G 
Sbjct: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGI 352

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
            VLPHIFNA +LT + SA NS++YVGSR L+GL+ +K APK  ++T   GVPY ++ +  
Sbjct: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            F  LAYM  S+  + +F + +N+T + G  +W+ I I++I F +A + +GI ++ L ++
Sbjct: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
           A   P  A+ A  F  ++ +++ FT F    F+  +F   YI I +++  ++ ++ + + 
Sbjct: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532

Query: 551 RFIWKIGDVDIDSDRRDIEAIVWEDHEPK 579
           ++I K  +VD+ + +  I+    E+ E K
Sbjct: 533 KWI-KSANVDLFTYKTAIDL---EEEEGK 557

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 300/512 (58%), Gaps = 15/512 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N  ++++LK RH                     L   GPV  LI+Y F+G L +     
Sbjct: 78  ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMAC 137

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  + 
Sbjct: 138 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF V+I  +N+  VK++GEFEFW++S KV+ ++G ++  F ++ G G    
Sbjct: 197 RVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHD 256

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYWR+PGA+     +    +G+F+ +V+  + + F++ G EL GI   EA NPRKS
Sbjct: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENSGTKV 373
           VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +   +   + SPF++AI+NSG +V
Sbjct: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T++ GVPY A+ ++  F
Sbjct: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  K+F + +N+  + G  +W+ I I +I F +A + +GI + +  + A 
Sbjct: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
                AY+A  F  +I +I+ FT F   KF+  +F   YI + +++  W  ++ I++ + 
Sbjct: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556

Query: 553 IWKIGDVDIDS-----DRRDIEAIVWEDHEPK 579
           I K  DVD+ +     DR + E  + +D E +
Sbjct: 557 I-KSTDVDLYTFKEIYDREEEEGRM-KDQEKE 586

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  326 bits (836), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 199/582 (34%), Positives = 321/582 (55%), Gaps = 36/582 (6%)

Query: 21  TTLFHDVEASQTHHRRGSIPLKDEKSKELYPL-----------RSFPTRVNGEDTFSMXX 69
           ++L  D +A  +     S P+K++   E+Y +            +F +    +D+F++  
Sbjct: 17  SSLDSDRDAYYSKQNPDSFPVKEQ---EIYNIDLEENNVSSRSSTFTSPSARDDSFAVPD 73

Query: 70  XXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFM 129
                     +   ++++LK RH                     L   GPV  LI+Y F+
Sbjct: 74  GKD-------ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFV 126

Query: 130 GSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVG 189
           G L +     LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+   
Sbjct: 127 GLLVFFTMACLGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAA 185

Query: 190 QVIQFWTYK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFC 247
            VIQ+W  +  V    WI+IF V+I  +N+  VK++GEFEFW++S KVL ++G ++  F 
Sbjct: 186 LVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFI 245

Query: 248 MVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGIT 306
           ++ G G     +GFRYWR+PGA+     +    +G+F+ +++  + + F++ G EL GI 
Sbjct: 246 IMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIV 305

Query: 307 AGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV---STSPFI 363
             EA NPRKSVP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +       + SPF+
Sbjct: 306 CSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFV 365

Query: 364 IAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVP 423
           +AI+NSG KVLPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  S+T K GVP
Sbjct: 366 VAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVP 425

Query: 424 YIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGI 483
           Y A+  +  F  LAYM  S G  K+F + +N+  + G  +W+ I I +I F +A + +GI
Sbjct: 426 YNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGI 485

Query: 484 SRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWI 542
            + +  + A      AY+A  F   I +I+ FT F   KF+  +F   YI + +++  W+
Sbjct: 486 DKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWV 545

Query: 543 LFQCIFRCRFIWKIGDVDIDS-----DRRDIEAIVWEDHEPK 579
            ++ I++ + I K  DVD+ +     DR + +  + ED E +
Sbjct: 546 GYKLIYKTKVI-KSTDVDLYTFKEIYDREEEQGKI-EDQEKE 585

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 180/515 (34%), Positives = 293/515 (56%), Gaps = 17/515 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
               +K++LK RH                     L  AGP   LI+Y F+G+L +    +
Sbjct: 78  DGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAA 137

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMA +IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W  + 
Sbjct: 138 LGEMAAYIPL-DGFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRD 196

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF V+I  +N   VKY+GEFEFW++S K++ +IG +I+ F ++ G G    
Sbjct: 197 TVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHD 256

Query: 258 -VGFRYWRNPGAWGP---GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            +GFRYW+ PGA+ P    +++ + + G+F+ +V+  + A F + G EL GI A EA NP
Sbjct: 257 RLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENP 316

Query: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSYVSTSPFIIAIENSG 370
           R+++PRAIK  V+RIL FY+ ++  +G+ V Y+DP L     + +  + SPF++AI+NSG
Sbjct: 317 RRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSG 376

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
             VLPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++T + GVPY A+   
Sbjct: 377 VDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGC 436

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
             F  LAYM  S+G  ++F + +N+  + G  +W  I I+ I F +A++ +GI R    +
Sbjct: 437 VLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAY 496

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFR 549
            A   P  +Y+A  F  ++ +I+ F+ F   +F+  +F   YI + ++   +I ++  ++
Sbjct: 497 VAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYK 556

Query: 550 CRFIWKIGDVDIDS-----DRRDIEAIVWEDHEPK 579
            + + K  + D++S     DR + E  + E    +
Sbjct: 557 TKTV-KPHEADLNSYKAAVDREEEEGKIKEAERKE 590

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  324 bits (830), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 191/495 (38%), Positives = 295/495 (59%), Gaps = 26/495 (5%)

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L  AGPV  LI+Y F+G L +    SLGEMA++IP+   FT ++ R+  PA G A GY Y
Sbjct: 101 LATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPL-DGFTSYATRYADPALGFAVGYCY 159

Query: 174 WFSWAITFALELSVVGQVIQFWT--YKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVA 231
            F + I    +L+    VIQ+W    KV    WI+IF V+I  +N   V+++GEFEFW++
Sbjct: 160 LFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLS 219

Query: 232 SIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSL 290
           S KVL +   +I  F ++ G G     +GFR+W++PGA+     +   + G+F+ +VS  
Sbjct: 220 SFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKFVAFVSVF 279

Query: 291 INAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL 350
           + A F + GTELVGI  GEA NPRKSVP+AIK  ++RI+ FY+ S+L +G+ V Y+DP L
Sbjct: 280 VYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLL 339

Query: 351 ----TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSK 406
               T+STS  + SPF++AI NSG KVLPHIFNA +L  + SA NS++YV SR L+ L+ 
Sbjct: 340 LEAKTKSTS-AAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAI 398

Query: 407 NKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLF 466
           +  APK  +RT + G+PY ++ ++  F  LAYM  S+G  K+F + +N+  + G  +W+ 
Sbjct: 399 DNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWIC 458

Query: 467 ISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGV 525
           I ++++ F +A++ +GI +    + A      AY+A  F ++I +I+ FT F   +F+  
Sbjct: 459 ILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYK 518

Query: 526 SFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVD-------IDSDRRD--IEAIVWEDH 576
           +F   YI I +F   +  ++ I++ + I  + +VD       ID +  D  +E I  ++ 
Sbjct: 519 TFITGYIGIPVFFISYFGYKLIYKTKIIDPL-EVDLYTFKAAIDQEEEDGKLEDIARKER 577

Query: 577 EPKT------FWDKF 585
                     F+DKF
Sbjct: 578 IKANGRNFEWFYDKF 592

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  323 bits (827), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/521 (35%), Positives = 293/521 (56%), Gaps = 19/521 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +K+ LK RH                     L  AGP    I+Y F+G L +     LGE
Sbjct: 63  RLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGE 122

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL- 201
           MA FIP+   FT ++ R++ PA G A GY Y   + I  A +L+    V+Q+W  +  L 
Sbjct: 123 MAAFIPL-DGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLN 181

Query: 202 -AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VG 259
              +I+IF ++I  +N+F VK +GEFEFW++S KVL ++G ++  F ++ G G     +G
Sbjct: 182 PGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLG 241

Query: 260 FRYWRNPGAWGP---GIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
           FRYWR+PG++ P    IIS   + G+F+ + S  + A F + G EL GI A EA NPRK+
Sbjct: 242 FRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKN 301

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST---SYVSTSPFIIAIENSGTKV 373
           +P+AIK  ++RI+ FY+ ++L + + V YNDP L ++T   +  + SPF++AIENSG  +
Sbjct: 302 IPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINI 361

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFN  +L  ++SAANS++YV SR L+ L+ +  APKF  +T K G+PY ++  + AF
Sbjct: 362 LPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAF 421

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+    VF + +N   + G  +W+ I +++I F +A K +G+ +    + A 
Sbjct: 422 SCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAP 481

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             P  AY+A  F  ++ +++ FT F   +F+  +F   YI I +F   ++ ++ +++ + 
Sbjct: 482 WQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTK- 540

Query: 553 IWKIGDVD-------IDSDRRDIEAIVWEDHEPKTFWDKFW 586
             +  +VD       ID +  D +    E  E     +K W
Sbjct: 541 THRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDW 581

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/498 (36%), Positives = 294/498 (59%), Gaps = 9/498 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+ L+ RH                     L +AGP   LISY F+G L Y+V   
Sbjct: 47  EGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMAC 106

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY-- 197
           LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+Q+W    
Sbjct: 107 LGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSRE 165

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
           KV    WI+IF V+I ++N   V+++GEFEFW++S+KVL ++G ++  F ++ G G    
Sbjct: 166 KVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHD 225

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
             GFRYWR+PGA+ P   +   ++G+F+ + S    A F + GTEL GI A EA NPR+S
Sbjct: 226 RTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRS 285

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS---TSYVSTSPFIIAIENSGTKV 373
           VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L ++   ++  + SPF++AI+N+G  V
Sbjct: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPV 345

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFNA +L  + SA NS++YV SR L+GL+ ++ APK  ++T   GVPY ++ V+  F
Sbjct: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+G  ++F + +N+  + G  +W+ I I+++RF +A+  +   +    + A 
Sbjct: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             P   + +  F  +I +I+ +T F    F+  +F + YI I ++   ++ ++ + R + 
Sbjct: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKL 525

Query: 553 IWKIGDVDIDSDRRDIEA 570
           I K  DVD+ + +  I+A
Sbjct: 526 I-KPEDVDLYTFKAAIDA 542

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  321 bits (822), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/592 (33%), Positives = 315/592 (53%), Gaps = 39/592 (6%)

Query: 1   MTNSKEDADIEEKHMYN------EPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRS 54
           ++    D DIE++ ++       E  + LF+D ++    H   S    D K+     + +
Sbjct: 11  LSRVDTDEDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKN-----VVT 65

Query: 55  FPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
             +  +G+                     +K+ L+ RH                     L
Sbjct: 66  HTSEFDGKH----------------DGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSL 109

Query: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYW 174
             AGP   LI+Y F+G L + V   LGEMA +IP+   FT +S R+  PA G A GY Y 
Sbjct: 110 ALAGPAAILIAYAFVGLLVFFVMSCLGEMAAYIPL-DGFTSYSTRYADPALGFAVGYAYL 168

Query: 175 FSWAITFALELSVVGQVIQFWTY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVAS 232
           F + I    +L+    VIQ+W    KV    WI+I  V I  +N   V+++GE E+++++
Sbjct: 169 FKYWIIVPNQLTAGALVIQYWVDRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISA 228

Query: 233 IKVLAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 291
           +K+  ++G +I    + CG G    V GF+YW+NPGA+     +    +GRF+ + S  +
Sbjct: 229 VKITVMLGLIILLLVLACGGGPNHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFV 288

Query: 292 NAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
            A F + GTEL GI   E  NPRK+VP+AIK  ++RI+ FY+ S+  +G+ VP+NDP L 
Sbjct: 289 LALFAYLGTELCGIVVSECKNPRKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLI 348

Query: 352 QSTS---YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
            + S     S SPF++AI N+G  VLPHI NA IL  + SAANS++YV SR L+GL+ + 
Sbjct: 349 SAKSAKTSASASPFVVAIVNAGIPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDN 408

Query: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
            AP+  ++T K GVPY ++ V   F  LAYM  S+G  +VF + +N   + G  +W+ I 
Sbjct: 409 KAPRIFAKTNKQGVPYWSLLVGVLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISIL 468

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSF 527
           I++IRF +A + +GI +  L +++ L P  A+++  F  +I +I+ F AF    F+  SF
Sbjct: 469 ITYIRFDKAFRVQGIDKSTLAYQSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSF 528

Query: 528 AAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHEPK 579
              YI I  ++  +I ++  ++ + I    +VD+ S +   EA+  E+ E K
Sbjct: 529 ITGYIGIPTYIISYIGYKLWYKTKII-PSEEVDLVSFK---EAVDLEEEEGK 576

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/466 (37%), Positives = 275/466 (59%), Gaps = 5/466 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K++LK RH                     L  AGPV  LI+Y F+G + +     
Sbjct: 61  EGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMAC 120

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMATFIP+   FT ++ R+  PA G A GY Y   + I    +L+    V+Q+W  + 
Sbjct: 121 LGEMATFIPL-DGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRD 179

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFC-MVCGAGVTG 256
            V    W+++ + +IT++N+F V+++GEFEFW++S+KVL +IG +I  F  M+ GAG   
Sbjct: 180 TVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHD 239

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYW++PGA+         + G+F+ +V+ L+   F + G EL GI A EA+NPR+S
Sbjct: 240 RLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRS 299

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLP 375
           VP+AIK   +RIL FY+ S+  +G+ VPYND KL T + + ++ SPF IAI N+G  VLP
Sbjct: 300 VPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLP 359

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            IFN  +L  + SAANS++YV SR L+ L+ +  APK  + T + G+PY ++FV+  F  
Sbjct: 360 DIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCL 419

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LAYM  S+   +VF++ +N+  +AG   W+ I I++I F +A++ + + +    + A   
Sbjct: 420 LAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQ 479

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVW 541
           P  AY +  F  +I II+ FT F   F+  +F   YI + +F+  +
Sbjct: 480 PYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCY 525

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/511 (35%), Positives = 294/511 (57%), Gaps = 13/511 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   ++++LK RH                     L   GPV  LI+Y F+G L +     
Sbjct: 76  ETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMAC 135

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK- 198
           LGEMA++IP+   FT ++ R++ PA G A GY Y F + I    +L+    VIQ+W  + 
Sbjct: 136 LGEMASYIPL-DGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRD 194

Query: 199 -VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            V    WI+IF V+I  +N+  V+++GEFEFW++S KV+ ++G ++  F ++ G G    
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYWR+PGA+     +   ++G+F+ + S  + + F++ G EL GI   EA NPRKS
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKS 314

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV---STSPFIIAIENSGTKV 373
           VP+AIK  V+RI+ FY+ ++  +G+ V YNDP+L  +       + SPF++AI+NSG KV
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKV 374

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHIFN  +L  + SA NS++YV SR L+ L+ +  APK  ++T+K GVPY A+ V+  F
Sbjct: 375 LPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLF 434

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S G  K+F + +N+  + G  +W+ I I +I F +A + +G+ + +  + A 
Sbjct: 435 CCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAP 494

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
                AY+A  F  +I +I+ FT F    F+  +F   YI + +++  W+ ++ I++ + 
Sbjct: 495 GQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKV 554

Query: 553 IWKIGDVDIDSDR----RDIEAIVWEDHEPK 579
           + K  D D+ + +    R+ E    +D E +
Sbjct: 555 V-KPADADLYTLKEIYDREEEQGKLQDQEKE 584

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  317 bits (812), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 185/510 (36%), Positives = 280/510 (54%), Gaps = 21/510 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           + ++K+ +K RH                     L N GP G +I Y  MGS  Y + Q+ 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GE+A  +  ++  F  +    + PA G +  ++Y   W     LEL      I++WT  V
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPV 258
               +++IF+V+I  +N+F  + Y E EF+  + KVL I GFLI    + CG AG  G +
Sbjct: 213 NPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYI 272

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG++     S DK    F G VS+L+ AAF F  TE + +TA E ANPRKS+P
Sbjct: 273 GGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHI 377
            A KK+++RIL  Y+GS++ IG LVP+N  +L  S  S    SP++IAI + G KV+PH+
Sbjct: 328 SAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHL 387

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NAVIL ++IS  NS  Y  SR+L  L++   AP FL    + G P +A+ +++ FG ++
Sbjct: 388 INAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLIS 447

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S   + VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL FK+++   
Sbjct: 448 FVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVW 507

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK-- 555
            +YYA   M +I+I Q +TA AP   G   A A+   +L + + I     ++   +WK  
Sbjct: 508 GSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYK---VWKRD 564

Query: 556 ------IGDVDIDSDRR--DIEAIVWEDHE 577
                    +D+ S+RR  D + +  ED E
Sbjct: 565 WTLYIPASKIDLISNRRIFDEDVLKQEDAE 594

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  317 bits (812), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/519 (34%), Positives = 289/519 (55%), Gaps = 21/519 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ L+ RH                     L+  GP G L SY+ +  + Y V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 144 ATFIPVTS-----SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
             F+P ++     S +    R+  P+ G A G+ Y++ + I  A E +    V+ +WT  
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP- 257
           VP  AWI+IF  ++T++N  PVK YGE EFW A +K+L I+G L   F +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKS 316
           +GFRYW++PGA+   I +   N GRFL   + +I   F F  G ELV IT+ EA + R++
Sbjct: 285 LGFRYWQHPGAFAYHITTG--NTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIENSGTK 372
           + +A ++  +R++ FY+ S L IG++V   DP     L +  +   +SPF+IAI+N+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432
           VLPHI NA IL++  S+ NS ++  SR L  ++++  AP+ L R  + GVPY AV ++AA
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
           F  LA++  S+G  K F W  NI+ ++GF  W+ I +++++F +A+ +RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
            L P   Y+    +++I +  G+ +F   +N   F AAYI++ +F+ +W+  +   R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 553 IW--KIGDVDIDSDRRDIEA----IVWEDHEPKTFWDKF 585
            W   + +VD+ +   +IE     +  +   P   W KF
Sbjct: 581 TWLLPVAEVDVTTGLAEIEEETKILDAQRIPPANAWQKF 619

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  313 bits (801), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/521 (34%), Positives = 288/521 (55%), Gaps = 19/521 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           E+K+ LK RH                     L   GP G  ISY  + S+ Y + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 143 MATFIPVTSS----FTVF-SQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           M  ++P + S    F  +   +++  + G A+ + Y++ + I  A E +    V+++WT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            VP AAWI+IF   + I+N   VK+YGE EFW ASIK+L I+G +I  F +  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 315
            +GFRYW+NPG +   I  +  + G FL   + +I   F F  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHI--RGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGT 371
           ++ +A ++ V+R++ FYI   L I ++V YNDP L     Q+     +SPF+I I+N+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           KVLPHI NA IL++  SA N+ ++  SR L  +++N  AP+  ++  + GVPY AV +++
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
           A   LAY+  S+    VF W  NI+ ++GF  W+ + I++IRF +A+ + G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQCIFRC 550
           A+ MP L Y+    ++II +  G+  F P+F +  +F AAYI++ +F  +WI  +   R 
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRK 550

Query: 551 RFI---WK-IGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWN 587
            F    WK I ++D+ +   +IE    E    +    K+W 
Sbjct: 551 IFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWE 591

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  310 bits (795), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 177/512 (34%), Positives = 285/512 (55%), Gaps = 12/512 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +++ L  RH                     L N GP+   +S++ +  + Y V  +L E
Sbjct: 45  NLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAE 104

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           M  ++P   +    + R++ P+ G A G+ Y +S++I  A ELS    V+Q+WT KV +A
Sbjct: 105 MICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKVHVA 164

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            WI+IF VI+  +N  PVK+YGE EFW AS+K++ I+G LI    +  G   +   +GFR
Sbjct: 165 VWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFR 224

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKSVPRA 320
           YW NPG +   I     N GRFL   +++I + F F    EL+G+   EA + R+++ +A
Sbjct: 225 YWNNPGPFAYHI--TGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKA 282

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY----VSTSPFIIAIENSGTKVLPH 376
            ++ ++RI+ FYI S L IG ++  +DPKL Q+ +      ++SPF+  I N+G  VL H
Sbjct: 283 SRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNH 342

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL++  S+ANS +Y  SR +  L+K   APK  +R  + GVPY AV ++ A   L
Sbjct: 343 IINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCL 402

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            Y+  S+   +VF WL NI  ++GF  W  I I+++RF +A+ Y  +  + +PFK+ L P
Sbjct: 403 TYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQP 461

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555
              Y+   F+ ++ +  G+  F PK+ N   F AAYI++ +F  +++  +  F+ R+   
Sbjct: 462 YFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIP 521

Query: 556 IGDVDIDSDRRDI--EAIVWEDHEPKTFWDKF 585
             ++D+ +   D   EA + +   PK  W+KF
Sbjct: 522 FREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  311 bits (796), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 189/598 (31%), Positives = 306/598 (51%), Gaps = 23/598 (3%)

Query: 12  EKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXX 71
           EK+     V +   D   + T    G++P KD+ +K +  +     +     T S     
Sbjct: 4   EKYPGLTVVGSSSDDAATTHTIGSAGALPAKDKYNKTIEFVDVESQQSTSSATISEKLGD 63

Query: 72  XXXXXXXVQN-AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMG 130
                    N   +++ LK RH                     L   GP G  ISY+ + 
Sbjct: 64  GDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIIS 123

Query: 131 SLAYSVTQSLGEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALEL 185
           S+ Y +    GEM  ++P      + S      R++  + G A  + Y++ + I  A E 
Sbjct: 124 SVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAEC 183

Query: 186 SVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYC 245
           +    V+++WT  VP   WI IF  I+ I+N  PVKYYGE EFW ASIK+L I+G +I  
Sbjct: 184 TAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILS 243

Query: 246 FCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELV 303
           F +  G G     +GFRYW+ PGA+   I+      GRFL   S +I   F F  G ELV
Sbjct: 244 FILFWGGGPNHDRLGFRYWQRPGAFTEHIMKG--GFGRFLDIYSGVIKGGFAFILGPELV 301

Query: 304 GITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY----VST 359
            +T+ E  + R+++ +A ++ ++R++ FY+   L I ++V YNDP L  + +       +
Sbjct: 302 CLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGS 361

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTK 419
           SPF+I I+N+G +VLPHI NA IL++  SA N+ ++  +R L  +++N  AP+   +  +
Sbjct: 362 SPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINR 421

Query: 420 GGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            GVPY+A+ ++     LA++  S+    VF W  NI+ ++GF  W+   +++IRF +A+ 
Sbjct: 422 FGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIF 481

Query: 480 YRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPK-FNGVSFAAAYISIFLFL 538
           + G+  D LPFK    P   YY+   +++I +  G+  F PK + G  F AAYI++ +F+
Sbjct: 482 FNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFV 540

Query: 539 AVWI---LFQCIFRCRFIWKIGDVDIDSDRRDIE---AIVWEDH-EPKTFWDKFWNVV 589
            +W+   L+   F  R+  ++  +D+ +   DIE    I+ E   EP T W KF + V
Sbjct: 541 VLWVGHKLWTRTFTKRWWRRVDQIDVTTGLVDIEERTKILDETRVEPSTRWQKFMDAV 598

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  310 bits (795), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 198/612 (32%), Positives = 312/612 (50%), Gaps = 34/612 (5%)

Query: 2   TNSKEDADIEEKHMYNEPVTTLFH---DVEASQTHHRRGSIP--LKDEKSKELYPLRSF- 55
           +N K +    E +  N     L     D+EA+ ++      P  + +EKS     L++  
Sbjct: 11  SNRKNENHQSENYEVNNNGIDLVDVDIDIEATASNDNNKKNPQIIYNEKSYSQDELQTTS 70

Query: 56  PTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
           PT +   D+                N E+K+ LK RH                     L 
Sbjct: 71  PTII---DSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALA 127

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFS-----QRFLSPAFGAANG 170
           N GP G  ISYL + +  Y +  +LGEM  F+P   S +  S      +++ P+ G A  
Sbjct: 128 NCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAAS 187

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEF 228
           + Y++ + I  A E+S    VI++W +   VP  AWI+IF  +I I+N  PV  YGE EF
Sbjct: 188 WNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEF 247

Query: 229 WVASIKVLAIIGFLIYCFCMVCGAG--VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGW 286
           W ASIK+L I G +I  F +  G G    G +GFRYW+NPG++   I       G FL  
Sbjct: 248 WFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGGGG--GNFLDI 305

Query: 287 VSSLINAAFT-FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPY 345
            + +I   F+   G ELV +T+ E A+ R+++ +A K+ V+R++ FYI   L IG++V Y
Sbjct: 306 YTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAY 365

Query: 346 NDP----KLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRIL 401
           NDP     L QS +   +SPF+I I+N+G + +PHI N  ILT+  SA N+ ++  SR L
Sbjct: 366 NDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSL 425

Query: 402 FGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGF 461
             +++N  APK   R  + GVPY AV  +     LAY+  S+    VF W  NI+ ++GF
Sbjct: 426 LTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGF 485

Query: 462 FAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPK 521
             W+   +++IRF +A+ Y  ++   +PF+AK      +Y+  ++++I +  G+  F P+
Sbjct: 486 IGWICACVAYIRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPR 544

Query: 522 -FNGVSFAAAYISIFLFLAVWILFQCIFRC---RFIWKIGDVDIDSDRRDIEAIVW---- 573
            +N   F AAYI++ +F+ +WI  +   R     ++  I  +D+ +   +IE +      
Sbjct: 545 NWNVKDFIAAYITLPIFIVLWIGHKVFTRTLLKAWLRPIDKIDVYTGLEEIEELTEELNA 604

Query: 574 EDHEPKTFWDKF 585
               PK  W+KF
Sbjct: 605 NRQAPKNKWEKF 616

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  310 bits (794), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 184/525 (35%), Positives = 284/525 (54%), Gaps = 21/525 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ L+ RH                     L   GP G  ISY+ + ++ Y +  +LGE
Sbjct: 105 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGE 164

Query: 143 MATFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           M  F+P   S +  S      R++ P+ G A G+ Y++ + I  A E +    V+++WT 
Sbjct: 165 MVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 224

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            VP   WI+IF  ++ I+N   VK YGE EFW ASIK+L I+G +I  F +  G G    
Sbjct: 225 AVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 284

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 315
            +GFRYW++PGA+   +     + G F    + +I  AF F  G ELV +T+ E A+ R+
Sbjct: 285 RLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRR 342

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGT 371
           ++ +A ++ V+R++ FY+   L I ++VPYNDP L     Q      +SPF+I I+N+G 
Sbjct: 343 NIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGI 402

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           KVLPHI N  ILT+  SAAN+ ++  +R L  +++   APK L R  K GVPY+AV V+ 
Sbjct: 403 KVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSF 462

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
               LAY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ Y G+  D LPFK
Sbjct: 463 LCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFK 521

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQCIFRC 550
               P   +++   + II I  G+  F PK+  V+ F AAYI++ +FL +W   +   R 
Sbjct: 522 TWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRT 581

Query: 551 RFIW--KIGDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
              W   + ++D+ +   +IE    E  E    P  F DKF + +
Sbjct: 582 WRQWWLPVSEIDVTTGLVEIEEKSREIEEMRLPPTGFKDKFLDAL 626

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  308 bits (789), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/512 (35%), Positives = 289/512 (56%), Gaps = 15/512 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+ LK RH                     L  AGPV  LI+Y F+G L +     
Sbjct: 64  EGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMAC 123

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT--Y 197
           LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I    +L+    VIQ+W    
Sbjct: 124 LGEMATYIPL-DGFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKE 182

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
           KV    W++IF V+I  +N+F V+++GEFEFW++S KVL ++G ++  F ++ G G    
Sbjct: 183 KVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHD 242

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +GFRYWR+PG++     +   + GRF+ +VS  + A + + G EL GI A EA NPRKS
Sbjct: 243 RLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKS 302

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP---KLTQSTSYVSTSPFIIAIENSGTKV 373
           +P+AIK  ++RI+ FY+ S+  +G+ V Y+DP   K   S++  + SPF++AI NSG   
Sbjct: 303 IPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINA 362

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHI NA +L  + SA NS++YV SR L+ L+ +  APK  ++T + G+PY A+ V+  F
Sbjct: 363 LPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLF 422

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAYM  S+   K+F + +N+  + G  +W+ I I++I F +A++ +G+ +    + A 
Sbjct: 423 CLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAP 482

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             P  A+++  F  +I +I+ FT F   +F+  +F   YI + +F      F C F  +F
Sbjct: 483 FQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVF------FFCYFGYKF 536

Query: 553 IWKIGDVD-IDSDRRDIEAIVWEDHEPKTFWD 583
            +K   +D +  D    +A + ++ E     D
Sbjct: 537 TYKTKVIDPLKVDLYTFKAAIDQEEEDGKMAD 568

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  306 bits (785), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 173/514 (33%), Positives = 280/514 (54%), Gaps = 12/514 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +K+ L  RH                     LT  GP    +S++ + ++ Y +  +L E
Sbjct: 50  NLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAE 109

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           M  ++P   S      R++ P+ G A G+ Y +S+A+  A EL+    ++++WT +VP  
Sbjct: 110 MVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQG 169

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMV-CGAGVTGPVGFR 261
            WI+IF +++ ++N   V++YGE EFW AS+K++ I+  L+    +   GA     VGFR
Sbjct: 170 VWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFR 229

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKSVPRA 320
           YWRNPGA+G  I     N GRFL   +++I +AF F    ELVG+   EA + R+++ +A
Sbjct: 230 YWRNPGAFGYHI--TGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKA 287

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGTKVLPH 376
            ++ ++RI+ FY+ S L IG++V  ND  L     ++    ++SPF+  I NSG  VL H
Sbjct: 288 SRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNH 347

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           + N  ILT+  SA NS  Y  SR +  LSK   APK  S+  + GVPY AVF+ +    L
Sbjct: 348 VINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACL 407

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AY+  S+   KVF+WL NI  ++GF  W  I +++IRF +A+ +  +  D +P+++ L P
Sbjct: 408 AYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQP 466

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555
             AY+    + II +  G+  F   +++   F  +YIS+ +FLA ++  + I++ RF   
Sbjct: 467 FSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIP 526

Query: 556 IGDVDIDSDRRDIEAIVWED--HEPKTFWDKFWN 587
           +  +D+ +   + E          PK  W+KF N
Sbjct: 527 VDQIDVITGLEEAEEEAKLSVVRVPKNAWEKFIN 560

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  306 bits (784), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 193/583 (33%), Positives = 294/583 (50%), Gaps = 46/583 (7%)

Query: 4   SKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIP--LKDEKSKELYPLRSFPTRVNG 61
           SK   ++  +++  EPV+       +++ H R G      K  +  EL P  +   R+  
Sbjct: 13  SKGGDNVVVENISQEPVSYDQSQGSSTEAHSRWGRFKESFKRAEEMELDPNLTEAERI-- 70

Query: 62  EDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVG 121
                               + +K  LK RH                     L  AGP G
Sbjct: 71  --------------AIKTAQSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAG 116

Query: 122 ALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITF 181
            LI +   G++ YS+  ++GE+A   PV   FT ++ RF+  +FG A  ++Y   W +  
Sbjct: 117 ILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVL 176

Query: 182 ALELSVVGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
            LE+      + +W T       ++++F+V+I I+N+F VK YGE EF  + IKV+ +IG
Sbjct: 177 PLEIVAASITVNYWGTDPKYRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIG 236

Query: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQG 299
           F+I    ++CG G     +G +YW NPGA+       D    +F G+ +  + AAF+F G
Sbjct: 237 FIIMAIVLICGGGKDHKYIGAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAG 291

Query: 300 TELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VS 358
           +ELVG+   EA  PRKSVP A K+V +RI  FYI  LL IG+LVP + P+L  ++S   +
Sbjct: 292 SELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAA 351

Query: 359 TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTT 418
            SPF+IAI N G K LP + N VIL  ++S  NS IY  SR L  L+     P       
Sbjct: 352 ASPFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYID 411

Query: 419 KGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQAL 478
           +GG P + + ++A FG +A++  S     VF WL+ ++G++  F W  I + HIR+  AL
Sbjct: 412 RGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGAL 471

Query: 479 KYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTA--FAP--KFNGVSFAAAYISI 534
             +G S DELPF+A      +Y+   FM I++ I  F    F P  K N   F  AY+S 
Sbjct: 472 AAQGRSTDELPFQAPAGVWGSYW-GFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSF 530

Query: 535 FLFLAVWILFQCIFRCRFIWK--------IGDVDIDSDRRDIE 569
            +F+A++   +       IWK        + D+DID+ RR+++
Sbjct: 531 CIFIALYAFHK-------IWKRNWKLFIPLKDLDIDTGRREVD 566

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  307 bits (787), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 181/519 (34%), Positives = 281/519 (54%), Gaps = 35/519 (6%)

Query: 80  QNAE-VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           QN E +K+ +K RH                     L NAGP G +I Y  MGS  Y + Q
Sbjct: 138 QNQENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQ 197

Query: 139 SLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GE+A  +  +   F  +    + PA G +  ++Y   W     LEL      I++WT 
Sbjct: 198 ACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTV 257

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           KV    ++ IF+V+I ++N+F  K Y E +F+    K+L IIGF I    + CG AG  G
Sbjct: 258 KVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDG 317

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEG--RFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
            +G RYW NPGA+         N G  RF G V++ + AAF F  +E + +TA E +NPR
Sbjct: 318 YIGSRYWHNPGAF-------RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPR 370

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTQSTSYVSTSPFIIAIENSGTKV 373
           K++P A KK+++RIL  ++GSL+ +G LVPY +D  L  S S    SP++IA+ + G +V
Sbjct: 371 KAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRV 430

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           +PH  NAVIL +++S AN   Y  SRIL  L+K   APK      + G P +A+ V++ F
Sbjct: 431 VPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIF 490

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
           G +A+  +S   + VF WLL I+G++  F W+ I +SHIRF +A+K +G S  E+ +K++
Sbjct: 491 GIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQ 550

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIF 548
           +    + YA   M + +I Q + A +P     K +  SF   Y+++ + +A+++ ++   
Sbjct: 551 VGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYK--- 607

Query: 549 RCRFIWK--------IGDVDIDSDRR--DIEAIVWEDHE 577
               +WK           +D+ +DR+  D E +  ED E
Sbjct: 608 ----VWKKDWTLFIPADKIDLVTDRQIFDEELLKQEDEE 642

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  308 bits (788), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 188/583 (32%), Positives = 298/583 (51%), Gaps = 30/583 (5%)

Query: 28  EASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRE 87
             S+THH       KD+  +     ++     NG     +                +K+ 
Sbjct: 109 SGSRTHHYEAE---KDDAIRMEKISKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQG 165

Query: 88  LKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFI 147
           L+ RH                     L   GP G  ISY+ + ++ Y +  +LGEM  F+
Sbjct: 166 LQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFL 225

Query: 148 PVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           P   S +  S      R++  + G A G+ Y++ + I  A E +    V+++WT  VP  
Sbjct: 226 PGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTTAVPKG 285

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            WI+IF  ++ ++N   VK YGE EFW ASIK+L I+G +I  F +  G G     +GFR
Sbjct: 286 VWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFR 345

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKSVPRA 320
           YW++PG++   +     + G F    + +I  AF F  G ELV +T+ E A+ R+++ +A
Sbjct: 346 YWQHPGSFAHHL--AGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKA 403

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGTKVLPH 376
            ++ V+R++ FY+   L I ++VPYNDP L     Q      +SP++I I+N+G KVLPH
Sbjct: 404 SRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPH 463

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I N  ILT+  SAAN+ ++  +R L  +++   APK L +  + GVPY+AV V+     L
Sbjct: 464 IINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCL 523

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           AY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ + G+  D LPFK    P
Sbjct: 524 AYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTWGQP 582

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQCIFRCRFIW- 554
              +++ T ++II I  G+  F PK+ N   F AAYI++ +FL +W+  +   R    W 
Sbjct: 583 YTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRTWNHWW 642

Query: 555 --------KIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVV 589
                     G V+I+   RDIE +      P TF +KF + +
Sbjct: 643 HSVSEIDVTTGLVEIEEKSRDIEEL---RLPPATFKEKFMDAL 682

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  306 bits (784), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 180/518 (34%), Positives = 277/518 (53%), Gaps = 30/518 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+ +K RH                     L NAGP G +I Y  MGS  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A  +  +   F  +    + PA G +  +++   W     LEL      I++WT K
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++ IF+V+I ++N+F  K Y E +F+    K+L IIGF I    + CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PGA+       D    RF G V++ + AAF F  +E + +TA E +NPRK++
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTQSTSYVSTSPFIIAIENSGTKVLPH 376
           P A KK+++RIL  ++ SL  +G LVPY +D  L  + S    SP++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS  Y  SRIL  L+K   APK      + G P +A+ V+A FG +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+  +S   + VF WLL I+G++  F W+ I +SHIRF +A+K +G S  E+ +K+++  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
             + YA   M + +I Q + A AP     K +  SF   Y+++ + +A++I F+      
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYIFFK------ 609

Query: 552 FIWK--------IGDVDIDSDRR--DIEAIVWEDHEPK 579
            +WK           VD+ S R   D E +  ED E K
Sbjct: 610 -VWKNDWSLFIPANKVDLVSHRNIFDEELLKQEDEEYK 646

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  305 bits (780), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 187/508 (36%), Positives = 277/508 (54%), Gaps = 14/508 (2%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            A +K  LK RH                     L  AGP G +I +    ++ Y +  +L
Sbjct: 92  KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMAL 151

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKV 199
           GE+A   PV+  FT ++ RF+  +FG A+ + Y   W  T  LE+      + +W T + 
Sbjct: 152 GELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPER 211

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++FW++I I+NLF V+ +GE EF  ++IKVL +IGF+I    +V G G  G   
Sbjct: 212 YRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFV 271

Query: 260 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             RYW NPGA+       D    +F G  S  + AAF+F G+ELVGITA EAANPRKSVP
Sbjct: 272 GGRYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHI 377
           RA K+VV+RI+ FY+GSL+ IGLLVPY DP+L  ++S   S SPF+IAI   G + LP +
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSV 386

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VIL  ++S  NS I+ GSR +  LS+    P+      + G P + + V + FG +A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF WL+ ++G++  F W  I + HIRF  ALK +G S +ELPF +     
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 498 LAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFI 553
            + +    + ++ I Q + A  P   K +   F  +Y+S  + LA +   +   +  +  
Sbjct: 507 GSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLF 566

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            K  D+DID+ RR  D+E +  E  E K
Sbjct: 567 IKAEDMDIDTGRRETDLELLKQEIEEEK 594

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  306 bits (784), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 194/576 (33%), Positives = 300/576 (52%), Gaps = 39/576 (6%)

Query: 36  RGSIPL--KDEKSK---ELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQ 90
            GS P+  KD  S+   EL P  S+ T V+G    S             +   +K+ +K 
Sbjct: 101 NGSTPISTKDSSSRLDNELNPKSSYIT-VDGIKQSSQEQEP--------KQENLKKSIKP 151

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPV 149
           RH                     L NAGP G +I Y  MGS  Y + Q+ GE+A  +  +
Sbjct: 152 RHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDL 211

Query: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFW 209
              F  +    + PA G +  +++   W     LEL      I++WT KV    ++ IF+
Sbjct: 212 IGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVKVNADVFVIIFY 271

Query: 210 VIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGA 268
           V+I ++N+F  K Y E +F+    K+L I GF I    + CG AG  G +G RYWR+PGA
Sbjct: 272 VLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGA 331

Query: 269 WGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRI 328
           +       D +  RF G V++ + AAF F  +E + +TA E +NPRK++P A KK+++RI
Sbjct: 332 F-----RGDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRI 386

Query: 329 LTFYIGSLLFIGLLVPY-NDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTII 387
           L  ++ SL  +G LVPY +D  L  + S    SP++IA+ + G +V+PH  NAVIL +++
Sbjct: 387 LFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHFINAVILLSVL 446

Query: 388 SAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDK 447
           S ANS  Y  SRIL  L+K   APK      + G P +A+ V+A FG +A+  +S   + 
Sbjct: 447 SVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEED 506

Query: 448 VFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMT 507
           VF WLL I+G++  F W+ I +SHIRF + +K +G S  E+ +K+++    + YA   M 
Sbjct: 507 VFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMV 566

Query: 508 IIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD-VDI 561
           + +I Q + A +P     K +  SF   Y+++ + +A++I ++   R   ++   D +D+
Sbjct: 567 LALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDL 626

Query: 562 DSDRR--DIEAIVWEDHEPKT------FWDK---FW 586
            S R   D E +  ED E K       FW +   FW
Sbjct: 627 VSHRNIFDEELLKQEDEEYKDRLRNGPFWKRVLDFW 662

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  303 bits (777), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 178/526 (33%), Positives = 288/526 (54%), Gaps = 21/526 (3%)

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
            ++++ L  RH                     L   GP G  ISY+ + ++ Y +  + G
Sbjct: 54  GKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFG 113

Query: 142 EMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT 196
           EM  ++P        S +    R++ P+   A G+ Y++ + I  A E +    V+++WT
Sbjct: 114 EMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWT 173

Query: 197 YKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTG 256
             VP AAWI+IF  I+ ++NL  VKYYGE EFW ASIKVL I+G +I  F +  G G   
Sbjct: 174 DAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNH 233

Query: 257 P-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPR 314
             +GFRYW+NPG +   I     N G FL   S +I  AF F  G EL+ + + E  + R
Sbjct: 234 DRLGFRYWKNPGGFAHHITGG--NLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQR 291

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY----VSTSPFIIAIENSG 370
           +++ +A K+ V+R++ FYI   L I ++V  NDP LT + +       +SPF+I I+N+G
Sbjct: 292 RNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAG 351

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
            K+LPHI NA ILT+  SA N+ ++  SR L  ++ N  APK   +  + GVP++AV  +
Sbjct: 352 IKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFS 411

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           A    LAY+  S+    VF W  NI+ ++GF  W    ++++RF +A+KY G+  + LP+
Sbjct: 412 ALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL-ENRLPY 470

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQCIFR 549
             +    + +++   +T++I   G+  F P+F  VS F AAYI++ LF+ +WI  +   R
Sbjct: 471 APRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTR 530

Query: 550 --CRFIWKIGDVDIDSDRRDIEA---IVWEDH-EPKTFWDKFWNVV 589
              ++ + + ++D+ +   +IE    I+ E+  EPK  + KF + +
Sbjct: 531 DFKKWWYPVEEIDVVTGLTEIEERTRILDEERVEPKGAFPKFMDAL 576

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  304 bits (778), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 196/581 (33%), Positives = 295/581 (50%), Gaps = 16/581 (2%)

Query: 9   DIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYP-LRSFPTRVNGEDTFSM 67
            +E+K  +           +A  + +  GS P + + SK  +   +    RV  E+    
Sbjct: 2   SLEDKKNFVYAQEEPLEAQDAGHSSYETGSSPGQTQASKSRWQDFKDGFKRVELEELDPN 61

Query: 68  XXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
                       Q+  ++R LK RH                     L   GP G LI + 
Sbjct: 62  LTEAEKIAIITAQS-PLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWG 120

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
            +G + Y V  S+GE+A   PV+  FT ++ RF+  +FG A  Y Y   W +   LE+  
Sbjct: 121 LIGLMIYCVVMSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVA 180

Query: 188 VGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCF 246
               + FW T       ++++F+++I I+N F V+ YGE EF  + IKV+ +IGF+I   
Sbjct: 181 ASITVNFWGTPPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGI 240

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            +VCG G  G     +YW NPGA+     S D    RF G  S  + AAF+F GTELVG+
Sbjct: 241 VLVCGGGPVGGYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGL 295

Query: 306 TAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFII 364
            + E ANPRK++PRA K+V +RIL FYI SL  IGLLVP+   +L  ++S   + SPF++
Sbjct: 296 ASAETANPRKALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVL 355

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424
           AI+  G K LP + N VIL +++S  NS +Y  SR +  L++    P   +   + G P 
Sbjct: 356 AIQTHGIKGLPSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPL 415

Query: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           +A+  T  FG L+++  S     VF WLL ++G++  F+W  I I HIRF +AL  +G S
Sbjct: 416 VAIITTCVFGLLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRS 475

Query: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVW 541
            DEL F +      +Y+    + +++I Q + A  P     N   F +AY+S  + LA +
Sbjct: 476 TDELAFVSYAGIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFY 535

Query: 542 ILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           I  +   R  +   +  D+DID+ RR  D EA+  E  E K
Sbjct: 536 IFHKIWKRNWKLFTRAKDIDIDTGRREMDTEALRQEIAEEK 576

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  303 bits (776), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 175/513 (34%), Positives = 276/513 (53%), Gaps = 17/513 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           +  +K+ LK RH                     L   GP G   SY  +  + Y V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 141 GEMATFIPVTSSFTV-----FSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           GEM  ++P   S +         R++ P+ G A G+ Y++ + I  A E +    V+Q+W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255
           T  VP  AWI+IF  ++ ++N   VK+YGE EFW AS+K+L I+G L   F +  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 256 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANP 313
              +GFRYW+ PGA+   I S   N GRFL   + +I   F F  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSG--NTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT----QSTSYVSTSPFIIAIENS 369
           R+++ +A ++ V+R++ FY+ S L IG +V YND  L+    Q      +SPF+I I+N+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFV 429
           G KVLPHI N  IL++  S+ NS ++  SR L  +S+   APK L R  + GVPY AV +
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 430 TAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           T+    +AY+  S+    VF W  NI+ ++GF  W+ I I+++RF +A+ ++ +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 490 FKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIF 548
           FK    P   ++    +++I +  G+  F P  +N   F AAY+++ +FL +WI  +   
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWT 524

Query: 549 RCRFIWKI--GDVDIDSDRRDIEAIVWEDHEPK 579
           R    W I   ++D+ +  ++IE    E  E +
Sbjct: 525 RTWKTWAIPVPEIDVTTGLKEIEEESKECDEKR 557

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  303 bits (776), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 179/525 (34%), Positives = 284/525 (54%), Gaps = 21/525 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ L+ RH                     L   GP G  ISY+ + ++ Y +  +LGE
Sbjct: 109 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGE 168

Query: 143 MATFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           M  F+P   S +  S      R++  + G A G+ Y++ + I  A E +    V+++WT 
Sbjct: 169 MVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 228

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            VP   WI+IF  ++ ++NL  VK YGE EFW ASIK+L I+G +I  F +  G G    
Sbjct: 229 AVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 288

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 315
            +GFRYW++PGA+   +     + G F    + +I  AF F  G ELV +T+ E A+ R+
Sbjct: 289 RLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRR 346

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGT 371
           ++ +A ++ V+R++ FY+   L I ++VPYNDP L     Q      +SPF+I I+N+G 
Sbjct: 347 NISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGI 406

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           KVLPHI N  IL++  SAAN+ ++  +R L  +++   APK L R  + GVPY+AV V+ 
Sbjct: 407 KVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSF 466

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
               LAY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ Y G+  D LPFK
Sbjct: 467 LCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFK 525

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQCIFRC 550
               P   + +   + II +  G+  F PK+  ++ F AAYI++ +FL +W   +   R 
Sbjct: 526 TWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

Query: 551 RFIW--KIGDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
              W   + ++D+ +   +IE    E  E    P +F DKF + +
Sbjct: 586 WSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  299 bits (765), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 166/476 (34%), Positives = 258/476 (54%), Gaps = 5/476 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N  + RELK R                      L   GP+   I+YLF GSL   V  S
Sbjct: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  +AI  +  L+  G VI +W   V
Sbjct: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDV 147

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV- 258
            +  W+++ +V +  +N   VKY+GE E  +   K+L ++   I C  + CG        
Sbjct: 148 NVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFRYWR  GA  P ++      G+FLGW + ++ + F F G+E++GI  GE ANP+K++P
Sbjct: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLV-PYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHI 377
           ++   V FRI   Y+  +  +GL + P N   +   ++  + SPF+IAI +SG KVLP+ 
Sbjct: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NA +L  IIS+AN++IY+ SR L+GL+K+  APK      +  VP +     +  G LA
Sbjct: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           YM T      VF ++ +   V G   W +I I++I + +A+K +GIS D++PF+    P 
Sbjct: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFI 553
            AY    F+TII    G+ AF  KF+  +F  +YI +F  + + I ++  F+ +F+
Sbjct: 445 AAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  301 bits (770), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 174/493 (35%), Positives = 269/493 (54%), Gaps = 12/493 (2%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           ++ +LK RH                     L  AGP G LI ++  GS+ Y +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKVPLA 202
           A   PV   FT ++ RF+  ++G AN + Y   W +T  LE+      + +W T K    
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FWV+I I+N+F V+ YGE EF  +  K+L I+GF+I    ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA+     + D +  +F G+ S  + AAF+F G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RI  FY+  LL IG+LVPY DP+L   +S   + SPF+IAI+N G   LP + N 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNV 378

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL  ++S  NS +Y  SR L  L+     PK  S   + G P + + VT+AFG +A++ 
Sbjct: 379 VILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVA 438

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S    +VF+WL+ ++G++  F W  I + HIRF +AL  +G S +EL F +      A 
Sbjct: 439 QSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAA 498

Query: 501 YAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKI 556
           +      I++  Q + A  P     +   F   Y+S+ + LA+W+  +   +  +   K 
Sbjct: 499 WGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKA 558

Query: 557 GDVDIDSDRRDIE 569
            D+DID+ RR+++
Sbjct: 559 EDMDIDTGRRELD 571

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  300 bits (769), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 180/564 (31%), Positives = 287/564 (50%), Gaps = 22/564 (3%)

Query: 24  FHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAE 83
           F   E  +   R    PL  E      P        +G +++++            +++ 
Sbjct: 15  FKPAETYKQSSRNDMSPLTSEA-----PDFKKADAASGNESWALENVESTSGTSDAEDSR 69

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
             ++L  RH                     LT  GP   +I ++ + +  +++  +LGE+
Sbjct: 70  YNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGEL 129

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
           ++  PV   F V+  RF+ P+FG A    Y   WA+   LEL      I++W   +   A
Sbjct: 130 SSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTINSDA 189

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-RY 262
           W++IF+ II + NL  VK +GE EF ++ +K+LAIIGF I    + CG G  G     +Y
Sbjct: 190 WVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKY 249

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           W NPGA+       + +  RF G  S  + AAF++ GTEL+ ++A E+ NPR ++P+A K
Sbjct: 250 WSNPGAF-----VGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACK 304

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHIFNA 380
           +  + I   YI  L  +G LVP +DP+L   +S V  + SP +IAIEN G K LP + NA
Sbjct: 305 RTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMNA 364

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           +IL  ++S ANS +Y  SR +  +++    PK  S   + G P  A+  T  FG L+++ 
Sbjct: 365 IILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIA 424

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL-- 498
            S   + VF WL  ++G++  F W  I++SHIRF   +K RG S DELPF +  M G+  
Sbjct: 425 ASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVS--MTGVWG 482

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGV----SFAAAYISIFLFLAVWILFQCIFRC-RFI 553
           +YY    + +++++  +TA  P   GV    SF   Y+S  + L  +I  +   +  R +
Sbjct: 483 SYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLL 542

Query: 554 WKIGDVDIDSDRRDIEAIVWEDHE 577
               ++DIDS RR ++  V +D +
Sbjct: 543 TPTTEIDIDSGRRAVDIEVLKDEK 566

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  302 bits (774), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 179/512 (34%), Positives = 272/512 (53%), Gaps = 18/512 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+ +K RH                     L NAGP G +I Y  MGS  Y + Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +   F  +    + P FG A  ++Y   W     LEL      I++WT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V   A++ IF+V+I  + +F  + Y E EF+    K+L IIGF I    +   GAG  G 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 258 VGFRYWRNPGAW-GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
           +G +YW +PGA+ G   I       RF G +++ ++AAF F  TE + +TA E +NPRK+
Sbjct: 318 LGAKYWHDPGAFRGTNGIQ------RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKA 371

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLP 375
           +P A KKV++R++  ++G++  +G LVP++  +L  +  S    SP+++AI   G +V+P
Sbjct: 372 IPSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVP 431

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL ++ S ANS  Y  SR+L GL++   APKF     + G P+ A+   A FG 
Sbjct: 432 HFINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGV 491

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           +A+   S   D+VF WLL I+G++  F W+ I +SHIRF +A+  +G S  E+ FKA+L 
Sbjct: 492 IAFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLG 551

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFRC---- 550
              +YYA   M + +I Q + A AP   NG   A  +   +L + + I F   ++     
Sbjct: 552 VYGSYYATIMMVLALIAQFWVAIAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRD 611

Query: 551 -RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            R   +  D+D+DS R+  D E +  ED E K
Sbjct: 612 WRLFIRAKDIDLDSYRQVFDEELLKQEDEEYK 643

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/530 (32%), Positives = 285/530 (53%), Gaps = 26/530 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N ++K+ L  RH                     L   GP G +ISY+ + ++ Y +  +L
Sbjct: 55  NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNAL 114

Query: 141 GEMATFIP-----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           GEM  ++P        S      R++  +   A G+ Y++ + I  A E +    V+ +W
Sbjct: 115 GEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW 174

Query: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255
           T  VP A WI+IF  I+T++N   VKY+GE EFW ASIK+L I+G ++  F +  G G +
Sbjct: 175 TTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPS 234

Query: 256 G-PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANP 313
              +GF YW++PG +   I     + G FL   + +I  AF F  G ELV +T+ E  + 
Sbjct: 235 HVRLGFHYWKDPGTFAHHI--TGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQ 292

Query: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIENS 369
           R+++ +A K+ ++R++ FYI   L I ++V YNDP     L +     ++SPF+I I+N+
Sbjct: 293 RRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNA 352

Query: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFV 429
           G KVLPHI NA IL++  SA NS ++  SR L  ++ N  APK   +  + GVPY +V +
Sbjct: 353 GIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGL 412

Query: 430 TAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489
           +A    LA++  S+   +VF+W  NI+ ++GF  W+   I+++RF +A+ Y  +  D LP
Sbjct: 413 SAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLP 471

Query: 490 FKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQCIF 548
           FK    P L +Y+   +++I +  G+  F P+F +G  F AAYI++ LFL +W+  +   
Sbjct: 472 FKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWA 531

Query: 549 R-------CRFIWKIGDVDIDSDRRDIEAIVWEDH----EPKTFWDKFWN 587
           R        +  + + ++D+ +   + E +  +       P T+W KF N
Sbjct: 532 RYKHAVPLLKLYYPVDEIDVITGLAEAEEVAEKLDMNRIPPSTYWGKFIN 581

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  300 bits (769), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 192/588 (32%), Positives = 290/588 (49%), Gaps = 24/588 (4%)

Query: 6   EDADIEEKHMYNEPVTTLFHDVEASQTH-HRRGSIPLKDEKSKELYPLRSFPTRVNGEDT 64
            ++ +  K      V  L  DVE+ Q H + +  + + D               +  ED 
Sbjct: 11  SESSLNGKLAIKTAVEELSPDVESDQNHDYYKDKVHVNDPNKSRFQNFVDGFRELRMEDV 70

Query: 65  FSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALI 124
                           ++ +KR LK RH                     L   GP   +I
Sbjct: 71  -DPNLTAAERAAIATASSPLKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVI 129

Query: 125 SYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALE 184
           +++  GS+ YSV Q+LGE+A  +PV+ S+  +  RF+ P+FG A  Y Y     IT  LE
Sbjct: 130 AWIMTGSMVYSVVQALGELAVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLE 189

Query: 185 LSVVGQVIQFWTYKVPLA-AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLI 243
           L      + +W      A A++++F+++I  +NLF VK YGE EF  + IKV AI+GF+I
Sbjct: 190 LIAASITVNYWDVDSKYADAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFII 249

Query: 244 YCFCMVCGAGVT--GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTE 301
               +VCG G +  G +G RYW NPG +  G          F G+ +  + +AF+F G+E
Sbjct: 250 LGIVLVCGGGPSDEGYIGARYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSE 299

Query: 302 LVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTS 360
           +  + A E  NPRK +PRA K+V +RI  FY+ SL  IG LVPY D  L   S+   S S
Sbjct: 300 MFALAAAETENPRKDLPRAAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS 359

Query: 361 PFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKG 420
           PF+IAI  +G K LP + N VIL  ++S  N  +Y  SR +  L+     P+      + 
Sbjct: 360 PFVIAIARAGIKGLPSVVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRK 419

Query: 421 GVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKY 480
           G P + + + A FG L+++  S+   +VF+W+L I+G+  FF W  I + H+RF +AL  
Sbjct: 420 GRPLVGILLCAIFGLLSFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSV 479

Query: 481 RGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAV 540
           +G S DEL +KA+     + Y    + I++  Q + A  P   G   A  + S +L L V
Sbjct: 480 QGRSTDELSYKAQTGIWGSLYGIGLIFIVLCFQFWVALFP-IGGSPNANHFFSAYLSLPV 538

Query: 541 WILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPKTF 581
            I F    +       F+ K  D+DID+ RR  D+E +  E  E + +
Sbjct: 539 VIFFYTCHKLYTRSWTFLIKSSDIDIDTGRREMDLELLKQEIQEEQQY 586

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  301 bits (770), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/511 (34%), Positives = 271/511 (53%), Gaps = 21/511 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N E+K+ +K RH                     L NAGP G LI Y  MG+  Y + Q+
Sbjct: 102 KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQA 161

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A ++  ++  F V+    + PAFG +  ++Y   W     LEL      I++WT  
Sbjct: 162 AGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT 221

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V+I ++N F  + Y E EF+    K+L +IGF I    +   GAG  G 
Sbjct: 222 VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY 281

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G RYW  PGA+     + D+    F G +++++ AAF F  TE + +TA E +NPRK++
Sbjct: 282 IGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAI 336

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A KKV++RIL  ++GS+  +G LVPY+  +L  S  S    SP+++A+   G KV+PH
Sbjct: 337 PSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPH 396

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  NS  Y  SR+L+ L++   APKF     + G P+ A+     F  +
Sbjct: 397 FINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAII 456

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           ++   S   ++VF WLL I+G++  F W  I +SHIRF +A+  +  S  E+ FKA+   
Sbjct: 457 SFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGV 516

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK- 555
             +YY    + +I+I Q + A AP   G   A  +   +L + + ILF   ++   IWK 
Sbjct: 517 WGSYYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYK---IWKK 573

Query: 556 -------IGDVDIDSDRR--DIEAIVWEDHE 577
                    ++D+D  R+  D E +  ED E
Sbjct: 574 DWSLFIRANNIDLDKHRQIFDEELLKQEDEE 604

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  300 bits (769), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 175/525 (33%), Positives = 279/525 (53%), Gaps = 21/525 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++++ ++L  RH                     L   GP   +++++ + +  +++  +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+A   PV   F V+  RF+ P+FG A    Y   WA+   LEL      I++W   +
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
              AW++IF+  I + N+  VK +GE EF ++ IK+LAIIGF I    + CG G +G  +
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G RYW +PGA+       D    RF G  +  + AAF++ GTELV ++A E+ NPR ++P
Sbjct: 264 GGRYWNDPGAF-----VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPH 376
           +A K+  + I   YI  L  IG LVPYND +L    S V  + SP +IAIEN G K LP 
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPS 378

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           + NA+IL  I+S ANS +Y  SR +  +++    PK L+   K G P  A+F T  FG L
Sbjct: 379 LMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLL 438

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           +++  S   ++VF WL  ++G++  F W  I++SHIRF QA+K +  S +ELPF +    
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGV 498

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
             ++Y    + +++I   +T+  P      +  SF   Y+S+ +F+  ++  +   +  R
Sbjct: 499 YGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWR 558

Query: 552 FIWKIGDVDIDSDRRDIEAIVW--------EDHEPKTFWDKFWNV 588
              K  D+D+D+ RR+I+  +         E    K F+ +F NV
Sbjct: 559 LYVKTKDMDLDTGRREIDLDILKQEIRLEREQMAQKPFYIRFLNV 603

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  299 bits (765), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/482 (34%), Positives = 273/482 (56%), Gaps = 14/482 (2%)

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L N G    L+S++ + ++ Y +  SL EM  ++P   S      R++ P+ G A G+ Y
Sbjct: 76  LHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNY 135

Query: 174 WFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASI 233
            +++AI  A ELS    V+ +W   VP+AAWI+IF V++  +N   VKYYGE EFW ASI
Sbjct: 136 AYAYAILVAAELSAAASVVSYWDNPVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASI 195

Query: 234 KVLAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 292
           K++ I+G L+    +   GA      GFRYW+NPG +   +     + GRFL    ++I 
Sbjct: 196 KLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPGPFAMSL--APGSTGRFLDVWRAVIK 253

Query: 293 AAFTF-QGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT 351
           +AF F    EL+GI   EA + R++  +A ++ ++RI+ FY+   L IG+++   DPKL 
Sbjct: 254 SAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLI 313

Query: 352 QSTSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           ++        ++SPF+  I N+G  VL H+ N  IL++  SA NS +Y  +R++  L++ 
Sbjct: 314 EALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALARE 373

Query: 408 KLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             APKFL++  + GVPY AV V      LAY+   T    VF+WL NI  ++GF  W  +
Sbjct: 374 GNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAM 433

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIII-QGFTAFAP-KFNGV 525
            I+ IRF + + +  + +  +P++  L P +AYY  TFMT+++ +  GF  F   ++N V
Sbjct: 434 GIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYY-FTFMTVVVCLTNGFHVFLKGRWNVV 491

Query: 526 SFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSD--RRDIEAIVWEDHEPKTFWD 583
            F AAY+++ ++L +++  +  FR R+   +  +D+ +     + E+ +     PK  W+
Sbjct: 492 DFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVITGLVEAEEESKMTPPRIPKNLWE 551

Query: 584 KF 585
           KF
Sbjct: 552 KF 553

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  299 bits (766), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 187/499 (37%), Positives = 288/499 (57%), Gaps = 11/499 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
             +  +K++LK RH                     L  AGPV  LISY F+G L + V  
Sbjct: 57  CSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMS 116

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT-- 196
            +GEMA +IP+   FT ++ R+  PA G A GY Y   + I    +L+    VIQ+W   
Sbjct: 117 CIGEMAAYIPL-DGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPR 175

Query: 197 YKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTG 256
            KV    WI+I  V+I ++N F VK++GEFEFW++S KV+ ++G +I  F ++ G   T 
Sbjct: 176 EKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTH 235

Query: 257 P-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
             +GFRYW++PGA+     S   + GRF+ +VS  +   F + G EL GI A EA NPRK
Sbjct: 236 DRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRK 295

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAIENSGT 371
           ++P+AIK  ++RI+ FYI ++  +G+ V  NDP L    T+STS  + SPF++AI NSG 
Sbjct: 296 NIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTS-AAASPFVVAIVNSGI 354

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           + LPHIFNA +L  + SA NS++YV SR L+ L+ +  APK  ++T + G+PY ++ V  
Sbjct: 355 EALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAV 414

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            F  LAYM  S+G  K+F + +N+  + G   W+ I I++I F +A++ +GI +    + 
Sbjct: 415 LFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYV 474

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
           A L P  AY++  F  ++ +I+ FT F   KF+  +F   YI + LF   +  ++ + + 
Sbjct: 475 APLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKT 534

Query: 551 RFIWKIGDVDIDSDRRDIE 569
           + I K  +VD+ S +  I+
Sbjct: 535 K-IRKPEEVDLFSFKAAID 552

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  299 bits (765), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 184/520 (35%), Positives = 280/520 (53%), Gaps = 24/520 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           + ++K+ +K RH                     L N GP G +I Y  MGS  Y + Q+ 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GE+A  +  ++  F  +    + PA G +  ++Y   W     LEL      I++WT  V
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPV 258
               +++IF+V+   +N+F  + Y E EF+  + KVL I GF I    + CG AG  G +
Sbjct: 213 NPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYI 272

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG++     S DK    F G VS+L+ AAF F  TE + +TA E ANPRKS+P
Sbjct: 273 GGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHI 377
            A KKV++RI+  ++GS+  +G LVP+N  +L  S  S    SP++IAI + G KV+PH 
Sbjct: 328 SAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHF 387

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NAVIL +++S  NS  Y  SR+L  L++   AP FL    + G P +A+ ++A FG ++
Sbjct: 388 INAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLIS 447

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S   + VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL FK+++   
Sbjct: 448 FVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVW 507

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK-- 555
            +YYA   M +I+I Q +TA AP   G   A A+   +L + + I     ++   +WK  
Sbjct: 508 GSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYK---VWKRD 564

Query: 556 ------IGDVDIDSDRR--DIEAIVWEDHEPKTFWDKFWN 587
                    +D+ S+RR  D + +  ED E   F +K  N
Sbjct: 565 WTLYIPASKIDLISNRRIFDEDVLKQEDAE---FREKLRN 601

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  298 bits (764), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 178/496 (35%), Positives = 272/496 (54%), Gaps = 18/496 (3%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K  LK RH                     L  AGP   +I +   GS+ YS+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA- 202
           A   P++  FT ++ RF+  +FG AN + Y   W +   LE+      + +W        
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FW++I I+NLF VK YGE EF  ++IKV+ ++GF+I    +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA+            +F G+ S  + AAF+F G+EL+GI   EA NPRK+VP A 
Sbjct: 269 YWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RIL FYI SLLFIGLLVP ND +L  S++   + SPF+IAI   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL  ++S  NS IY  SR L  L++    PK +S   + G P + + +++ FG +A++ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S     VF WLL I+G++ FF W  I + HIRF  ALK +  S DELPF + L    +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 501 YAATFMTIIIIIQGFTAFAPKFN---GVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI- 556
           +    + +++  Q + A  P  +     +F +AY+S+ + L ++I  +   +    WKI 
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKN---WKIF 560

Query: 557 ---GDVDIDSDRRDIE 569
              G +D+D+ R+ ++
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  299 bits (766), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 170/495 (34%), Positives = 272/495 (54%), Gaps = 14/495 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ E+K  +K RH                     L N+GP G +I Y  MGS  Y + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +   F  +    + PA G +  ++Y   W     LEL      I++WT K
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 199 VPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           V    ++ IF+V+I ++N+      Y E EF+  S K+L ++GF I    ++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G RYW +PGA+       +    RF G VS+L+NAAF F  +E++G+TA E +NPRK+
Sbjct: 299 YIGGRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLP 375
           +P A KK+++RI+  Y+GS++ +G LVP+N D  L  S   V  SP+++A+   G +V+P
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVP 413

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL +++S ANS  Y  SR+L GL++   APK      + G P + + V A    
Sbjct: 414 HFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNV 473

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           +++  TS   D+VF WLL I+G++  F W  I +SHIRF +A+  +G S  E+ FK++  
Sbjct: 474 ISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCG 533

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
              ++YA   M +I+I Q + A AP    + +  +F   Y++  + +A++  ++   +  
Sbjct: 534 VWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDW 593

Query: 551 RFIWKIGDVDIDSDR 565
           R   +  D+D+D +R
Sbjct: 594 RLFIRAKDIDLDINR 608

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  299 bits (765), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 176/518 (33%), Positives = 275/518 (53%), Gaps = 30/518 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K+ +K RH                     L NAGP G +I Y  MGS  Y + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A  +  +   F  +    + PA G +  +++   W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++ IF+V+I ++N+F  K Y E +F+    K+L I+GF I    + CG AG  G 
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PGA+       D    RF G V++ + AAF F  +E + +TA E +NPRK++
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLTQSTSYVSTSPFIIAIENSGTKVLPH 376
           P A KK+++RIL  ++ SL  +G LVPY +D  L  + S    SP++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S AN   Y  SRIL  L+K   APK      + G P  A+ V+A FG +
Sbjct: 436 FINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVI 495

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+  +S   + VF WLL I+G++  F W+ I +SHIRF +A+K +G S  E+ +K+++  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
             + YA   M + +I Q + A AP     K +  SF   Y+++ +++A++I ++      
Sbjct: 556 WGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYK------ 609

Query: 552 FIWK--------IGDVDIDSDRR--DIEAIVWEDHEPK 579
            +WK           VD+ S R   D E +  ED E K
Sbjct: 610 -VWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYK 646

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  297 bits (761), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 180/506 (35%), Positives = 271/506 (53%), Gaps = 16/506 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           E+K+ +K RH                     L N+GP G +I Y  MGS  Y + Q+ GE
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 143 MAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           +A  +  +T  F  +    + PAFG A  ++Y   W     LEL      I++WT KV  
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 202 AAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVG 259
             ++ IF+ +I  +N+      Y E EF+  S K+L + GF I    ++CG AG  G +G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
            R W NPG++       DK   RF G VS+L+NAAF F  +E +G+TA E +NPRK++P 
Sbjct: 288 TRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPS 342

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           A KK+++RI+  Y+GS+  +G LVPY+ D  L  S +    SP+++AI   G +V+PH  
Sbjct: 343 AAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFI 402

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +++S  NS  Y  SR L  LS+   AP FL+   + G P  A  V+A  G +A+
Sbjct: 403 NAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAF 462

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
             TS   D+VF WLL I+G++  F W  I +SH+RF +A++ +G S  E+ FK+++    
Sbjct: 463 CATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYG 522

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RFI 553
           + Y+   M +I+I Q +TA  P   G     A+   +L + ++I+    F+      R  
Sbjct: 523 SLYSCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLF 582

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHE 577
            +  D+D+ S R   D E +  ED E
Sbjct: 583 IRAEDIDLVSHREIFDEELLKQEDEE 608

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  298 bits (762), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 179/515 (34%), Positives = 280/515 (54%), Gaps = 29/515 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L +AGP G LI Y  MGS+ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V++  +N+F  + Y E EF+    K+L + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+  G  S D    RF G V++L+ AAF F G+E + IT  E ANPRK+V
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAV 346

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376
           P A K++++RIL  ++ +++ +G LVPYN  +L  S+      SP++IA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS+ Y  +RIL  LS+   AP+  +   K G P IA+ V+A FG +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   D+VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL F+++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             + YA   M +I+I Q + A AP    K +  +F   Y+++ + +A+++ ++       
Sbjct: 527 WGSTYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYK------- 579

Query: 553 IWK--------IGDVDIDSDRR--DIEAIVWEDHE 577
           IWK           +D+ S R+  D E I  ED E
Sbjct: 580 IWKKDWKLFIRADKIDLISHRQIFDEELIKQEDEE 614

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  295 bits (756), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 177/545 (32%), Positives = 286/545 (52%), Gaps = 26/545 (4%)

Query: 43  DEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXX 102
           D K K+L         ++G +T ++            Q+A   ++L  RH          
Sbjct: 40  DSKQKDL---------MSGSETKALENLDSTSQEVEDQDARYNKDLSVRHLLTLAVGGAI 90

Query: 103 XXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      LT  GP   +I ++ + +  +++  +LGE+++  PV   F V+  RF+ 
Sbjct: 91  GTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVE 150

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKY 222
           P+FG A    Y   WA+   LEL      I++W + +   AW++IF+ II + NL  VK 
Sbjct: 151 PSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTINSDAWVAIFYTIILLANLLDVKS 210

Query: 223 YGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEG 281
           +GE EF ++ +K+LAIIGF I    + CG G  G     +YW NPGA+  G  + D    
Sbjct: 211 FGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAF-VGHTAGD---- 265

Query: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGL 341
           RF G  S  + AAF++ GTEL+ ++A E+ NPR ++P+A K+  + I   YI  L  +G 
Sbjct: 266 RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLVGC 325

Query: 342 LVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSR 399
           LV  +DP+L   +S V  + SP +IAIEN G K LP + NA+IL  ++S ANS +Y  SR
Sbjct: 326 LVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYACSR 385

Query: 400 ILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVA 459
            +  +++    PK  +   + G P  A+  T  FG L+++  S   ++VF WL  ++G++
Sbjct: 386 CMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALSGLS 445

Query: 460 GFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL--AYYAATFMTIIIIIQGFTA 517
             F W  I++SHIRF + +K RG + DELPF +  M G+  +YY    + I++++  +T+
Sbjct: 446 TLFCWFAINVSHIRFRRTMKERGRTLDELPFVS--MTGVWGSYYGCIVIFIVLVVCFWTS 503

Query: 518 FAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRRDIEAIV 572
             P      N  SF   Y+S  + LA +   +   R  R +    ++D+DS RR ++  +
Sbjct: 504 LFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVDLEL 563

Query: 573 WEDHE 577
            +D +
Sbjct: 564 MKDEK 568

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  296 bits (758), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 192/608 (31%), Positives = 306/608 (50%), Gaps = 30/608 (4%)

Query: 2   TNSKEDADIEEKHMYNEPVTTLFHDVEASQ-THHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           T   +  D  E+   +  VT L  D E S+ ++  RG      +  +    +R  P  +N
Sbjct: 15  TEKSDSIDPIEQGDSDLQVTVL--DEEKSEFSNGLRGRFDEFIDSFRRAEDVRILPNEMN 72

Query: 61  ----GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTN 116
                E  F             + N ++K+ ++ RH                     L++
Sbjct: 73  PILSHESVFDTAVVEISAVDNQI-NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSH 131

Query: 117 AGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175
           AGP G +I Y  M +  Y V Q++GEMA  ++ +   F+ +    + P    A  ++Y  
Sbjct: 132 AGPAGLIIGYAIMSTCIYCVMQAVGEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCI 191

Query: 176 SWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIK 234
            W     LEL      IQ+WT KV    ++ IF++++  +N+F   + Y E EF+    K
Sbjct: 192 QWFCVCPLELVTASMTIQYWTTKVNADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCK 251

Query: 235 VLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINA 293
           +L + GF I    ++CG AG +G +G RYW +PGA+       D    RF G VS+L+ A
Sbjct: 252 ILMMTGFFILGIILICGGAGNSGFIGARYWHSPGAF-----RGDNGINRFKGIVSTLVTA 306

Query: 294 AFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS 353
           AF F GTE + ITA E ANPRK++P A KKV++R L  Y+GS++ +G LVPYN  +L  S
Sbjct: 307 AFAFGGTEFLAITASEQANPRKAIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGS 366

Query: 354 TS-YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
           +      SP++IA+ + G +V+PH  NAVIL ++ S A+S  Y  SR+L  L++   APK
Sbjct: 367 SGPATKASPYVIAVASHGIRVVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPK 426

Query: 413 FLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
             +   K G P +   V A    +++   S+    VF WLL+I+G++  F W  IS+SHI
Sbjct: 427 IFTYVDKRGRPTLGFVVGAIIAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHI 486

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFA 528
           RF +A+K +G S DE+ FK++     + YA   M +++I Q +    P      + VSF 
Sbjct: 487 RFRRAMKVQGRSLDEIGFKSQAGVWGSVYAFVMMILVLIGQFWVGIVPVGEDSADAVSFF 546

Query: 529 AAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPKT----- 580
            AY+++ +F+ ++  ++   R  R   +  ++D+ + R   D E +  E  E +      
Sbjct: 547 QAYLAMPVFIVLYFGYKIWNRDWRLFIRAKNIDLIAHRHIYDPELLRQERKEMRERARNA 606

Query: 581 -FWDKFWN 587
             W K +N
Sbjct: 607 PLWRKIYN 614

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  297 bits (760), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 190/560 (33%), Positives = 297/560 (53%), Gaps = 23/560 (4%)

Query: 31  QTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQ 90
           QT+H   +  L++E +  + P      + +G+                 +   +K+ +K 
Sbjct: 78  QTNHNSAAEDLENELTTCVSPATLSDYKKSGDSG------SVDELEGKTKEEHLKKSIKP 131

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPV 149
           RH                     L +AGP G  I Y  MGS  Y + Q+ GEMA T+  +
Sbjct: 132 RHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNL 191

Query: 150 TSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFW 209
              F  +    +SP  G A  ++YW  WA    LEL      I++WT KV    ++ IF+
Sbjct: 192 VGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTKVNPDVFVVIFY 251

Query: 210 VIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGA 268
            +I ++N+F  + Y E EF+    KVL I GF I    + CG AG  G +G +YW +PGA
Sbjct: 252 FLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGA 311

Query: 269 WGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRI 328
           +       DK   RF G  ++L+ AAF F G+E + +TA E +NPRK++P A KK+++RI
Sbjct: 312 F-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRI 366

Query: 329 LTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSGTKVLPHIFNAVILTTII 387
           +  ++GS++ +G LVP+N  +L  S +S    SP++IAI + G +V+PH  NAVIL +++
Sbjct: 367 IIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVNAVILLSVL 426

Query: 388 SAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDK 447
           S  NS  Y  SRIL  LS+   APKF +   + G P  A+ + A F  +A+   S+  + 
Sbjct: 427 SVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEED 486

Query: 448 VFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMT 507
           VF WLL I+G++  F W  I +SHIRF +A+  +G S  E+ FK++L    +YYAA  M 
Sbjct: 487 VFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMF 546

Query: 508 IIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWI--LFQCIFRCRFIWKIGDVDI 561
           +++I Q +   AP    K +  SF  +Y+++ + +A ++  +F       FI +  D+D+
Sbjct: 547 LVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFI-RAKDIDL 605

Query: 562 DSDRR--DIEAIVWEDHEPK 579
           D  R+  D + +  ED E K
Sbjct: 606 DHHRQIFDEDVLRQEDEETK 625

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  295 bits (755), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 175/499 (35%), Positives = 280/499 (56%), Gaps = 18/499 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            + ++R+LK RH                     L  AGP G LI +  M ++   +  SL
Sbjct: 81  QSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSL 140

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GEMA   PV+  +T ++ RF+  ++G AN   Y     +   LE+      + +W  K  
Sbjct: 141 GEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQ 200

Query: 201 L-AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
             AA++++FW+ I  +N+F VK YGE EF  + IKV+ +IGF+I    +VCG G T   +
Sbjct: 201 YRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYI 260

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G ++W NPGA+       D    +F G  S  + AAF+F  TELVG+ A E  +PRKSVP
Sbjct: 261 GSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVP 315

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHI 377
           +A K+V +RI  FYI SLL +GLLVPY DP+L  S+    + SPF++A++N G K LP +
Sbjct: 316 KAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSV 375

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VILT ++S  NS+++  SR L  LS+    P       + G P +++  ++AFG L 
Sbjct: 376 INVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLC 435

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    ++F+W+L+++G++  F WL IS+ HIRF +AL  +  S DEL F + +   
Sbjct: 436 FLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIW 495

Query: 498 LAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIW 554
            +YY+   + +++I+Q + A  P   K +  +F  AY+S+ + +A+++  +   +    W
Sbjct: 496 GSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKN---W 552

Query: 555 KI----GDVDIDSDRRDIE 569
           K+      +DID+ RR+++
Sbjct: 553 KLLIDPKYMDIDTGRRELD 571

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 190/575 (33%), Positives = 296/575 (51%), Gaps = 43/575 (7%)

Query: 10  IEEKHMYNEPVTTLFHDVEASQTH-HRRGSI------PLKDEKSKELYPLRSFPTRVNGE 62
           +E + +  EP++   HD+ ++ +  H++G +        ++ +  E+ P  S   ++   
Sbjct: 19  VESEFISQEPLS---HDLSSTGSEEHKKGKVWTRFVDSFRERERLEVDPNMSELDQI--- 72

Query: 63  DTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
                             N+ ++  LK RH                     L  AGP G 
Sbjct: 73  -------------AFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGI 119

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           LI +   G++ YS+  +LGE+A   PV+  FT ++ RF+  ++G AN   Y   W +   
Sbjct: 120 LIGWGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLP 179

Query: 183 LELSVVGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGF 241
           LE+      + +W T       ++++FW+ I I+NLF VK YGE EF  + IKV+ ++GF
Sbjct: 180 LEIVAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGF 239

Query: 242 LIYCFCMVCGAG-VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT 300
           +I    + CG G V G +G RYW +P     G    D    RF G  S  + AAF+F G+
Sbjct: 240 IILGIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGS 295

Query: 301 ELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VST 359
           ELVG+ + E ANPRKSVP+A K+V +RI  FY+ +L  +GLLVPY + +L  ++S   + 
Sbjct: 296 ELVGLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAA 355

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTK 419
           SPF+IAI   G + LP + N VIL  ++S  NS IY  SR L  L++    PKF     +
Sbjct: 356 SPFVIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDR 415

Query: 420 GGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P  ++ VT+ FG +A++  S    +VF WLL ++G++  F W  I + HIRF +AL 
Sbjct: 416 SGRPLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALS 475

Query: 480 YRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFL 536
            +G   DEL F +      +Y+    + ++ I Q + A  P   K N  +F  AY+S  +
Sbjct: 476 AQGRGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPI 535

Query: 537 FLAVWILFQCIFRCRFIWKI----GDVDIDSDRRD 567
            +A + L   I++    WKI     D+DID+ R+D
Sbjct: 536 VIACY-LGHKIYKKN--WKIFIKAEDMDIDTGRKD 567

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 164/508 (32%), Positives = 271/508 (53%), Gaps = 24/508 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +K  L+ RH                     L N GP   +ISY+ + ++ Y +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 143 MATFIPVTSS-------FTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
           M  ++P                 +++  + G A  + Y++ + +  A E +    ++++W
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255
           T K+P A  I +F  +I ++N  PVK+YGE EFW A IK+  I G +I  F + CG    
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 256 GP----VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEA 310
                 VGF YW+NP ++   +   + + G FL   ++LI  AF F  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYV--TNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 311 ANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY----VSTSPFIIAI 366
            + R+++ +A ++ V+R++ FYI   L I ++VPYNDP L  + +       +SPF+I I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIA 426
           +N+G  +LPHI N  ILT+ +SA N+ ++  +R L  + KN  AP+  SR  + GVPY+A
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 427 VFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRD 486
           + ++     LA++  S    KVF+W  NI+ ++GF  W    I+++RF + + Y G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 487 ELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVW---I 542
            LPFK K    L +Y+  F+ I+I+  G+    PKF N   F AAYI++ +FL ++   I
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHI 531

Query: 543 LFQCIFRCRFIWK-IGDVDIDSDRRDIE 569
           ++   +R R  WK + ++D+ +   +IE
Sbjct: 532 IYSGRWRQRKWWKPVDEIDVVTGLEEIE 559

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  295 bits (755), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 171/508 (33%), Positives = 278/508 (54%), Gaps = 15/508 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L +AGP G LI Y  MGS+ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V++  +N+F  + Y E EF+    K+L + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+  G  + D    RF G  ++L+ AAF F G+E + IT  E +NPRK++
Sbjct: 292 IGGKYWHDPGAFN-GKHAID----RFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376
           P A K++++RIL  ++ +++ +G LVPYN  +L  ST      SP++IA+ + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS+ Y  +R+   LS+   APK  S   + G P IA+ V+A F  +
Sbjct: 407 FINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVI 466

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   ++VF WLL I+G++  F W  I +SH+RF +A+K +G S  EL FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
             + YA   M +I+I Q + A AP    K +  +F   Y+++ + +A+++ ++   +  +
Sbjct: 527 WGSAYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWK 586

Query: 552 FIWKIGDVDIDSDRR--DIEAIVWEDHE 577
              +   +D+DS R+  D E I  ED E
Sbjct: 587 LFIRADKIDLDSHRQIFDEELIKQEDEE 614

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  295 bits (754), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 170/508 (33%), Positives = 270/508 (53%), Gaps = 16/508 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N ++K+ ++ RH                     L +AGP G +I Y  M S  Y + Q++
Sbjct: 96  NEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAV 155

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GEMA  ++ +   F  +    + PA   +  ++Y   W     LEL      IQ+WT KV
Sbjct: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 200 PLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
               ++ IF++++  +N+F   + Y E EF   S K+L +IGF I    ++CG AG  G 
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PGA+            RF G VS+L+ AAF+F  TE + ITA E +NPRK++
Sbjct: 276 IGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 330

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376
           P A KKV++R L  Y+ S++ +GLLVPY+  +L  S+S  +  SP+++A+   G +V+PH
Sbjct: 331 PSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPH 390

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL ++ S A+S  Y  SR+L  L++   APK  +   + G P +   V A    +
Sbjct: 391 FINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVM 450

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S+   +VF WLL I+G++  F W  I +SHIRF +A+K +G S DE+ +K+++  
Sbjct: 451 AFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGV 510

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----R 551
             + YA   M +I+I Q +    P   G +   A+   +L + V+I+    ++      R
Sbjct: 511 WGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWR 570

Query: 552 FIWKIGDVDIDSDR--RDIEAIVWEDHE 577
              +  D+D+ S R   D E +  E  E
Sbjct: 571 LFIRAKDIDLISHRHIHDPEILRQEREE 598

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  294 bits (753), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 180/576 (31%), Positives = 289/576 (50%), Gaps = 23/576 (3%)

Query: 13  KHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFS------ 66
           K  Y   V   FH  + + + + R S P   E S    P+R   +    +D         
Sbjct: 7   KKQYWTEVIDGFHSPDRTDSANDRSSSPDNFELSSVNSPVRVNVSSSGNDDILKGDTKEY 66

Query: 67  ----MXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
                           + N  + ++L  RH                     LT  GP   
Sbjct: 67  PRDVKATPEAASYVEDINNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASL 126

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           +I ++ + +  ++V  SLGE+A   PV   F V+  RF+ P+F  A    Y   W +   
Sbjct: 127 VIGWVIVSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLP 186

Query: 183 LELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFL 242
           LEL      I++W  K+   AW++IF+  I + N+  VK +GE EF ++ +K+LAIIGF 
Sbjct: 187 LELVAASITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFG 246

Query: 243 IYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTE 301
           I    + CG G  G     +YW NPGA+            +F G  S  + AAF++ G E
Sbjct: 247 ILGIVLTCGGGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIE 301

Query: 302 LVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--ST 359
           +  ++A E+ NP++++P+A K+  + I   Y+G L  IG LVPYNDP+L   +S V  + 
Sbjct: 302 MTAVSAAESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAA 361

Query: 360 SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTK 419
           SP +IAIEN G K LP + NA+IL  I+S ANS +Y  SR +  ++     PKFLS+  K
Sbjct: 362 SPLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDK 421

Query: 420 GGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALK 479
            G P  A+ +T  FG L+++  S   ++VF WL  ++G++  F W+ I++S IRF  A+K
Sbjct: 422 RGRPLNAILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMK 481

Query: 480 YRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIF 535
            +G S DE+PF ++     A+Y    + ++++   +T+  P      +  SF   Y+S+ 
Sbjct: 482 AQGRSLDEMPFLSQSGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLP 541

Query: 536 LFLAVWILFQCIFRC-RFIWKIGDVDIDSDRRDIEA 570
           + +A ++  +   R  R +  + ++D+DS RR ++A
Sbjct: 542 ILIACYVGHKLWKRDWRLLVPLMEMDLDSGRRVLDA 577

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  294 bits (753), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 186/522 (35%), Positives = 279/522 (53%), Gaps = 26/522 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K  LK RH                     L   GP   LI +   G++ YS+  +LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKVPLA 202
           A   P++  FT ++ RF+  +FG AN + Y   W +   LE+      + FW T      
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FW++I I+N+F VK YGE EF  + IKV+ ++GF+I    + CG G  G     +
Sbjct: 206 GFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGK 265

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA+     + D    +F G  S  + +AF+F G+ELVG+ A E+ +PRKSVP+A 
Sbjct: 266 YWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAA 320

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RI  FYI SLL +GLLVPYNDP L  ++S   + SPF+IAI+  G K LP + N 
Sbjct: 321 KQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNV 380

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL  ++S  NS IY  SR +  L++ +  P+  +   + G P + + VT+AFG +A++ 
Sbjct: 381 VILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVA 440

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S     VF WLL ++G++  F W  I I HIRF +AL  +G   DEL FK+      +Y
Sbjct: 441 ASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVWGSY 500

Query: 501 YAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI- 556
           +    + I+ I Q + A  P     +   F  AY+S  L +A+++  +   R    WK+ 
Sbjct: 501 WGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRN---WKLF 557

Query: 557 ---GDVDIDSDRR--DIEAIVWEDHEPKTF------WDKFWN 587
               D+DID+ RR  D+E +  E  E K        W + WN
Sbjct: 558 IPAEDMDIDTGRREVDLELLKQEIAEEKAIMATKPKWYRIWN 599

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  295 bits (755), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 174/508 (34%), Positives = 271/508 (53%), Gaps = 15/508 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L +AGP G LI Y  MGS+ Y + Q+
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V++  +N+F  + Y E EF+    K+L + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGY 291

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW  PGA+  G+ + D    RF G V++L+ AAF F G+E + IT  E +NPRK++
Sbjct: 292 IGGKYWHEPGAFN-GVHAID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLPH 376
           P A K++++RIL  ++ +++ +G LVPYN D  L  S      SP++IAI + G +V PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS+ Y  +R+   LS+   APK  S   + G P IA+ V+A F  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVI 466

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   D+VF WLL I+G++  F W  I +SHIRF +A+K +G S  EL FK++   
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----R 551
             + Y+   M +I+I Q + A AP   G   A A+   +L + + I+    ++      +
Sbjct: 527 WGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWK 586

Query: 552 FIWKIGDVDIDSDRR--DIEAIVWEDHE 577
              +   +D+ S R+  D E I  ED E
Sbjct: 587 LFIRADKIDLTSHRQIFDEELIKQEDDE 614

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  294 bits (752), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 177/508 (34%), Positives = 264/508 (51%), Gaps = 14/508 (2%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            + ++R LK RH                     L   GP   LI +  +G + YSV  ++
Sbjct: 77  RSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAM 136

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+A   PV   FT +  RF+  +FG A  Y+Y   W +   LE+      + +W     
Sbjct: 137 GELAVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAK 196

Query: 201 LA-AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++F+V+I I+N+F VK YGE EF  + IKV  ++GF+I    ++CG G  G   
Sbjct: 197 YRDGFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYV 256

Query: 260 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             +YW NPGA+     + D    RF    S  + AAF+F GTELVG+ A E  NPRK++P
Sbjct: 257 GGKYWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALP 311

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHI 377
           RA K+V +RI  FYI SL  IGLLVPY    L  S+S   + SPF++AI+  G   LP +
Sbjct: 312 RAAKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSV 371

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VIL +++S  NS++Y  SR L  L+     P+  S   + G P + +  T  FG L 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S     VF WL+ ++G++  F W FI I H+RF +AL  +G S DEL F + +   
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKF---NGVSFAAAYISIFLFLAVWILFQCIFRC-RFI 553
            +Y+    + ++ I Q + A  P     N   F  AY+S+ + L  ++  +   R   F 
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            +  D+DID+ RR  D++A+  E  E K
Sbjct: 552 KRAKDIDIDTGRRELDLDALKQEIAEEK 579

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  295 bits (754), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 173/508 (34%), Positives = 278/508 (54%), Gaps = 15/508 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L +AGP G LI Y  MGS+ Y + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A  +  +T  +  +    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V++  +N+F  + Y E EF+    K+L + GF I    + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+  G  S D    RF G V++L+ AAF F G+E + IT  E +NPRK++
Sbjct: 292 IGGKYWHDPGAFN-GKHSID----RFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376
           P A K++++RIL  ++ +++ +G LVPYN  +L  S       SP++IAI + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS+ Y  +R+   LS+   APKF S   + G P IA+ V+A F  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   ++VF WLL I+G++  F W  I  SHIRF +A+K +G S  EL FK++   
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
             + YA   M +I+I Q + A AP    K +  +F   Y+++ + +A+++ ++   +  +
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWK 586

Query: 552 FIWKIGDVDIDSDRR--DIEAIVWEDHE 577
              +   +D++S R+  D E I  ED E
Sbjct: 587 LFIRADKIDLESHRQIFDEELIKQEDEE 614

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  293 bits (751), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 183/493 (37%), Positives = 274/493 (55%), Gaps = 12/493 (2%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           ++ +LK RH                     L  AGP G LI +   G++ +++  +LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA- 202
           A   PV+  FT ++ RF+  +FG A  + Y   W +   LE+      + +W   V    
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++FW+++ I+N+F V+ YGE EF  + IKV A+IGF+I    +VCG G  G     R
Sbjct: 208 GFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGAR 267

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW NPGA+  G  S  K    F G+ S  + AAF+F G+EL+G+   EA NPRK+VP A 
Sbjct: 268 YWHNPGAF-VGSTSGQK----FHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAA 322

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RIL FYI  LL IG LVPYNDP+L + S+   S SPF+IAI   G   LP + N 
Sbjct: 323 KQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINV 382

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL +++S  NS IY  SR L  LS+    PK +S   + G P + + +++ FG +A++ 
Sbjct: 383 VILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVA 442

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S   +++F WLL I+G++ FF W  I I HIRF  ALK +G   DELPF +      +Y
Sbjct: 443 ASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVIGSY 502

Query: 501 YAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKI 556
           +      +++I Q + A  P     +   F +AY++  + LA +I  +   +  +F+  +
Sbjct: 503 WGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPL 562

Query: 557 GDVDIDSDRRDIE 569
            DVDID+ RRD +
Sbjct: 563 EDVDIDTGRRDTD 575

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  293 bits (750), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 176/511 (34%), Positives = 269/511 (52%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQA 146

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P + ++F  +S  F+S +FG A  ++Y F W     LEL      IQFW  K
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDK 206

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF     K+L I GF+I    + CG AG  G 
Sbjct: 207 INPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGY 266

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW NPGA+     + D + GRF      L+ A F+F G EL  ++  E +NPRKS 
Sbjct: 267 IGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKST 321

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RI+  Y+ +++ IG  VPYND +L  +  S    SP+++A    G K++PH
Sbjct: 322 PVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPH 381

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL +++S ANS++Y G R++  L++   APKFL    + G P  A+ V   FG +
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVI 441

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S DEL +KA    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILF---QCIFRCRF 552
             + Y   F  ++ + Q + A AP  NG    A ++   +L   +W+ F     ++   F
Sbjct: 502 WGSIYGVFFNILVFVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNRDF 561

Query: 553 --IWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
             +  +  +D+D  RR  D E +  ED E K
Sbjct: 562 TLLNPLDKIDLDFHRRIYDPELMRQEDEENK 592

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 178/510 (34%), Positives = 285/510 (55%), Gaps = 19/510 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +K++L+ RH                     L  AGP   LI+Y  MG + ++V   
Sbjct: 55  EGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSC 114

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW--TY 197
           LGEMA +IP+   FT ++ R+  PA G A G+ Y F + +    +L+    VIQFW    
Sbjct: 115 LGEMAAYIPL-DGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAA 173

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
           +V    WI++   +I ++N   V+++GEFEFW++S KVL ++  +I    +  G G T  
Sbjct: 174 RVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHD 233

Query: 258 -VGFRYWRNPGAWGPGIISKDKNE-----GRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
            +GFRYW +PGA+     SK         G+F+ ++S  + A F + GTEL GI A E  
Sbjct: 234 RLGFRYWSDPGAFKE--YSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECK 291

Query: 312 NPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS---PFIIAIEN 368
           +PR++VPRAIK  ++RI+ FY+ ++  +G+ V YNDP L Q++S   ++   P+++AIEN
Sbjct: 292 DPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIEN 351

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428
           +   VLP++FNA +LT + SA NS++YVGSR L+GL+ +  APK  +RT K GVPY A+ 
Sbjct: 352 AVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALA 411

Query: 429 VTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
               F  LAYM  S      F + +N+T + G  +W+ I I++I F +A + +GI +  L
Sbjct: 412 CCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTL 471

Query: 489 PFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGV-SFAAAYISIFLFLAVWILFQCI 547
            + A   P   + A  F   + +I+ F AF  K   V +F   YI + +++  +I ++ +
Sbjct: 472 SYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIV 531

Query: 548 FRCRFIWKIGDVDIDSDRRDIEAIVWEDHE 577
            + ++I    +VD+ + +   EAI  E+ E
Sbjct: 532 HKTKWI-PSKEVDLFTFK---EAIDLEEEE 557

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  292 bits (747), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/524 (32%), Positives = 280/524 (53%), Gaps = 21/524 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +++++ ++L  RH                     L+  GP   +I++  + +  +++  S
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE++   PV   F V+  RF+ P+FG A  + Y   WAI   LEL      I++W   +
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSI 179

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
              AW+SIF+V I   N+  VK +GE EF ++ +K+LAIIGF I    ++CG G +G   
Sbjct: 180 NPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFI 239

Query: 260 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             +YW +PGA+       D    RF G  +  I AAF++ G ELVG++A E+ NPR ++P
Sbjct: 240 GGKYWNDPGAF-----VGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLP 294

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPH 376
           +A K+  + I   Y+  L  IG LVP NDP L   TS V  + SP +IAI+N G K LP 
Sbjct: 295 KAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPS 354

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           + NA+IL  ++S ANS +Y  SR +  +++    P+ L+   K G P  A+ +T   G L
Sbjct: 355 LMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLL 414

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           +++  S   D+VF WL  ++G++  F W  I+++H+RF  A+K++  S +ELP+ +    
Sbjct: 415 SFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGE 474

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPK----FNGVSFAAAYISIFLFLAVWILFQCIFR-CR 551
             ++Y    + +++I   +T+  P      +  SF  +Y+S+ +F+A ++  +   R  R
Sbjct: 475 WGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKRNLR 534

Query: 552 FIWKIGDVDIDSDRRDIEAIVWEDHEP--------KTFWDKFWN 587
              K+ +VD+DS R D +A   +  +         K F+ + WN
Sbjct: 535 LYIKLSEVDVDSGRTDTDAATLKQEKEAEAELMKTKPFYIRLWN 578

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  293 bits (751), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/529 (33%), Positives = 281/529 (53%), Gaps = 30/529 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +++ +K RH                     L  AGP G +I Y  MGS  Y + Q+
Sbjct: 127 KDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQA 186

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +  +F  +    +  AFG +  ++Y   W     LEL      IQ+WT  
Sbjct: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V+I  +N+F  K Y E EF+  S KVL + GF I    +   GAG  G 
Sbjct: 247 VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW NPGA+       DK+  RF   +S+   AAF F  +E + I A E +NPR+++
Sbjct: 307 IGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAI 361

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376
           P A K +++RIL  ++ S+  +G LVPYN  +L  S S  +  SP++IA+ + G +V+PH
Sbjct: 362 PSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPH 421

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS  Y   RIL+ LS+   AP + +   + G P  A+ ++A F  +
Sbjct: 422 FINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVI 481

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S+  + VF WLL I+G++  F W+ I +SHIRF +A+K +G S DE+ FK+++  
Sbjct: 482 AFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGV 541

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             + YAA  MT+ +I + + + AP      +  +F   Y+++ + + ++  ++    C+ 
Sbjct: 542 WGSSYAAIMMTLALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKI---CKR 598

Query: 553 IWKI----GDVDIDSDRR--DIEAIVWEDHEPKT------FWDK---FW 586
            WK+     D+D+ S R+  D E I  E+ E K       FW K   FW
Sbjct: 599 DWKLFIRAKDIDLVSHRKIYDGELIKQEEEEFKERLRNGPFWKKVVAFW 647

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  292 bits (747), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 186/524 (35%), Positives = 281/524 (53%), Gaps = 24/524 (4%)

Query: 82  AEVKRE----LKQ----RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLA 133
           AEV R+    LKQ    RH                     L N GP G +I Y  MGS  
Sbjct: 80  AEVARQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCL 139

Query: 134 YSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVI 192
           Y + Q+ GE+A ++  ++ +F  +    +  AFG +  ++Y   W     LEL      I
Sbjct: 140 YCIIQAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITI 199

Query: 193 QFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG- 251
           ++WT  V    +++IF+V+I ++N+F  + Y E EF+    KVL IIGF I    + CG 
Sbjct: 200 KYWTTSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGG 259

Query: 252 AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA 311
           AG  G +G RYW NPGA+        K    F G +S+++ AAF F  TE + +TA E A
Sbjct: 260 AGNDGYIGGRYWNNPGAF-----YGTKPIHHFKGIISTMVTAAFAFGATEFIALTAAEQA 314

Query: 312 NPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSG 370
           NPR+++P A KKVV+RIL  ++  ++ IG LVP+N P+L  S +S    SP++IA+ + G
Sbjct: 315 NPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHG 374

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
            +V+PH  NAVIL +++S  NS  Y  SR+L  L+    AP +L    + G P  A+ V+
Sbjct: 375 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVS 434

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
             FG ++++  S   + VF WLL I+G++  F W+ I +SHIRF +AL  +G    EL +
Sbjct: 435 CVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGY 494

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQC 546
           K++     +YYA   M  I+I Q + A AP    K +  SF   Y+++ LF+ ++  F+ 
Sbjct: 495 KSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKI 554

Query: 547 IFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHE-PKTFWDKFW 586
             R  R    +  +D+DS R+  D E +  ED E  +   +K W
Sbjct: 555 WKRDWRLYIPLEQIDLDSHRKTFDEELLKQEDAEYEENIRNKGW 598

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  291 bits (746), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 177/509 (34%), Positives = 266/509 (52%), Gaps = 16/509 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++++K+ +K RH                     L   GP   +I Y  +  + Y + Q+
Sbjct: 87  SDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQA 146

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      I+FW   
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDT 206

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF     K+L I GF+I    + CG AG  G 
Sbjct: 207 INPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGY 266

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWRNPGA+     + D + GRF      L+ A F+F G EL  ++  E ANPRK+ 
Sbjct: 267 IGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTT 321

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RIL  Y+ +++ IG  VPYND +L  +  S    SP+++A    G KV+PH
Sbjct: 322 PVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPH 381

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS ANS++Y G R++  L++    PKFL    + G P IA+ V + FG +
Sbjct: 382 IINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVI 441

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S DEL +KA    
Sbjct: 442 GFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAA-AYISIFLFLAVWILFQCIFRC----- 550
             + Y   F  ++ I Q + A AP  NG   +A ++   +L   +WI F   +       
Sbjct: 502 WGSAYGVFFNILVFIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNRDF 561

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHE 577
            F+  +  +D+D  R   D E +  ED E
Sbjct: 562 TFLNPLDKIDLDFHRHIYDPELMRQEDLE 590

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  292 bits (747), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 276/510 (54%), Gaps = 23/510 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  ++K+ L  RH                     L   GP G + SYL + ++ Y +   
Sbjct: 98  RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNV 157

Query: 140 LGEMATFIPVTSSFTVFS-----QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
           LGEM  ++P   S +  S     +R+L  +   A G+ Y++ + +  A E +    V+++
Sbjct: 158 LGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEY 217

Query: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV 254
           WT  VP  AWI +F +II  +N+ PV+ YGE EFW A  K+L I+G +I  F +  G G 
Sbjct: 218 WTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGP 277

Query: 255 TGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAAN 312
               +GFRYW  PG++   I   + + G FL     +I  AF+F  G ELV + + E ++
Sbjct: 278 NHDRLGFRYWITPGSFANTI--TNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSD 335

Query: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT----QSTSYVSTSPFIIAIEN 368
           PR+++ +A K+ ++R++ FYI   L I ++V YNDP L+    Q      +SPF+I I+N
Sbjct: 336 PRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQN 395

Query: 369 SGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVF 428
           +G  VLPHI N  IL +  S+ N+ ++  SR L  ++ N  APK L +  + GVPY+AV 
Sbjct: 396 AGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVI 455

Query: 429 VTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDEL 488
           V+     +AY+  S     VF+W  N++ ++GF  W+ +S++++RF +A++Y G+ +D L
Sbjct: 456 VSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGM-KDRL 514

Query: 489 PFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPK-FNGVSFAAAYISIFLFLAVWI----- 542
           P+     P L  Y+     II I  GF    P+ +N   F AAY+++ +FL +WI     
Sbjct: 515 PYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFY 574

Query: 543 --LFQCIFR-CRFIWKIGDVDIDSDRRDIE 569
              F+   R CR+ +++ D+D+ +   +IE
Sbjct: 575 KYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  291 bits (746), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 284/525 (54%), Gaps = 21/525 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ L+ RH                     L   GP G  ISY+ + ++ Y +  +LGE
Sbjct: 104 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGE 163

Query: 143 MATFIPVTSSFTVFSQ-----RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           M  F+P   S +  S      R++  + G A G+ Y++ + I  A E +    V+++WT 
Sbjct: 164 MVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 223

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
            VP   WI++F +++ ++N   VK YGE EFW ASIK+L I+G +I  F +  G G    
Sbjct: 224 AVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHD 283

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 315
            +GFRYW++PGA+   +     + G F    + +I  AF F  G ELV +T+ E A+ R+
Sbjct: 284 RLGFRYWQHPGAFAHHLTGG--SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRR 341

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIENSGT 371
           ++ +A ++ V+R++ FY+   L I ++VPYNDP     L Q      +SPF+I I+N+G 
Sbjct: 342 NIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGI 401

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           KVLPHI N  ILT+  SAAN+ ++  +R L  +++   APK L +  + GVPY+AV  + 
Sbjct: 402 KVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASF 461

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
               LAY+  S+    VF W  NI+ ++GF  W+   I+++RF +A+ Y G+  D LPFK
Sbjct: 462 LCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFK 520

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQCIFRC 550
               P   +++   ++II I  G+  F PK+  V+ F AAY+++ +FL +W+  +   R 
Sbjct: 521 TWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRT 580

Query: 551 RFIW--KIGDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
              W   + ++D+     +IE    E  E    P +  DKF + +
Sbjct: 581 WHQWWLPVSEIDVTRGLVEIEEKSREIEELRLPPTSIKDKFMDTL 625

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  293 bits (750), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 174/507 (34%), Positives = 263/507 (51%), Gaps = 15/507 (2%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           NAE+++ +K RH                    PL  AGP   +I Y  MG+  Y + Q+ 
Sbjct: 156 NAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQAC 215

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GEMA  +  +T SF  F    + P F  A  ++Y   W     LEL      IQ+WT KV
Sbjct: 216 GEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKV 275

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPV 258
               ++ IF+V+I ++N F  K Y E EF   + KVL I GF I   C+  GA G  G +
Sbjct: 276 DPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYI 335

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PGA+      + K E RF G + + + AAF F  TE + +TA E +NPRK++P
Sbjct: 336 GAKYWNDPGAFR----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 390

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHI 377
            A KK+++R+L  ++ +++ IG LVPY+  +L  S  S    SP+++AI   G +V  H 
Sbjct: 391 SAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHF 450

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NAVIL ++IS  NS  Y  SR+L  L++   APK      + G P IA+  +A    +A
Sbjct: 451 VNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIA 510

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           +  TS    +VF WL+ I G++  F W  I +SH+RF +A+K +G S  E+ + ++    
Sbjct: 511 FCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGIL 570

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RF 552
            + YAA  M + +I Q + A  P       A ++ S +L + + I+F   ++      R 
Sbjct: 571 GSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRL 630

Query: 553 IWKIGDVDIDSDRR--DIEAIVWEDHE 577
             +  D+D+ S R   D E +  ED E
Sbjct: 631 FIRAKDIDLISHRTIYDEELLRQEDEE 657

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  290 bits (741), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 176/530 (33%), Positives = 285/530 (53%), Gaps = 23/530 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N ++K+ LK RH                     L   GP G   SYL + +  Y +  +
Sbjct: 66  ENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNA 125

Query: 140 LGEMATFIPVTSSFTVFS-----QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
            GEM  ++P   S +  S     ++++  + G A+ + Y++ + I  A E +    V+++
Sbjct: 126 FGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEY 185

Query: 195 WTY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA 252
           W +  KVP  AWI+IF   +  +N+ PV +YGE EFW ASIK+L I+G +I  F +  G 
Sbjct: 186 WAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGG 245

Query: 253 GVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEA 310
           G +   +GFRYW+ PGA+   I   D   G FL   + +I   F F  G ELV +T+ E 
Sbjct: 246 GPSHDRLGFRYWQRPGAFADHI--TDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSEC 303

Query: 311 ANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL----TQSTSYVSTSPFIIAI 366
            + R+++ +A ++ V+R++ FY+   L I ++V YNDP L     QS     +SPF+I I
Sbjct: 304 HDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGI 363

Query: 367 ENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIA 426
           +N+G KVLPHI N  I+T+  SA N+ ++  SR L  ++ +  APKF S+  + GVPY+A
Sbjct: 364 QNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVA 423

Query: 427 VFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRD 486
           V  +  F  LAY+  S+    VF W  NI+ ++GF  W+   +++IRF +A+ +  +  D
Sbjct: 424 VGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YD 482

Query: 487 ELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKF-NGVSFAAAYISIFLFLAVWILFQ 545
            LP+K      L +Y+   +++I +  G+  F P+F +   F AAYI++ +F+ +WI  +
Sbjct: 483 RLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHK 542

Query: 546 CIFRCRFIWKI--GDVDIDSDRRDIEAIVWEDHE----PKTFWDKFWNVV 589
            + R    W I    +D+ +   +IE +  E  E    P   WDKF + +
Sbjct: 543 LVTRSWRQWYIPVDKIDVFTGLEEIEELTNELDEKRVPPNNAWDKFLDAL 592

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  290 bits (741), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 173/513 (33%), Positives = 274/513 (53%), Gaps = 22/513 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N ++++ ++ RH                     L NAGP G LI Y+ M S  Y + Q+ 
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GEMA  ++ +   F  +    +  A+  A  ++Y   W     LEL      I++W  KV
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196

Query: 200 PLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
               +++IF+++I  +NLF   + Y E EF+    K+L I GF I    ++CG AG +G 
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 258 VGFRYWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
           +G  YW NPGA+    PG         RF G VS+L+ AAF+F  TE + ITA E +NPR
Sbjct: 257 IGVSYWNNPGAFRGHTPGT--------RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPR 308

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSGTKV 373
           K++P A KKV++R L  Y+GS++ +G LVPYN P+L  S +S    SP++IA+ + G ++
Sbjct: 309 KAIPSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRI 368

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
            PH  NAVIL +++S ANS+ Y  SR+L  L+K   APK  +   + G P   +   +  
Sbjct: 369 APHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLL 428

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             +A+  +S    +VF WLL I+G++  F W  I +SHIRF +A+K +G S +EL +K++
Sbjct: 429 ATIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQ 488

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC--- 550
           +    + YAAT M +I+I Q + A  P  +  +    +   +L + + +LF   ++    
Sbjct: 489 VGVWGSIYAATVMFLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

Query: 551 --RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
                 +  D+D+ S R   D + +  E ++ K
Sbjct: 549 DWNLFIRAKDIDLISHRHIYDEDVLKQEKNQYK 581

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  287 bits (734), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 155/424 (36%), Positives = 241/424 (56%), Gaps = 5/424 (1%)

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           L   GP+   ++YLF GS+   V  SL EMA F P+   F+ +  +++ PAFG A G+ Y
Sbjct: 63  LARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNY 122

Query: 174 WFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASI 233
           +  +AI  +  L+  G VI +W   + +A W+++ +    ++N   V+Y+G+ E ++   
Sbjct: 123 FLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVA 182

Query: 234 KVLAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 292
           K+  ++   I C  + CG G     +GFRYWR  G + P ++    N G+FLGW + +I 
Sbjct: 183 KLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPYLV--KGNTGKFLGWWACVIQ 239

Query: 293 AAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ 352
           + F F G+E++GI  GE ANPRK++P+A + V+ RI  FYI  +  +GL V  ++ KL  
Sbjct: 240 SIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVH 299

Query: 353 STSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
           + S   + SPF+IAI  SG KVLP   NA +L  I S+A ++IY+ SR L+GL+K+  AP
Sbjct: 300 AHSTDANASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAP 359

Query: 412 KFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K   R  K  +P +   V +  G LAYM T      VF ++ +   V G   W +I +++
Sbjct: 360 KIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAY 419

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAY 531
           I + + +K  G+  DE+PF+    P  AY A  F+++I    G++AF  KFN   F  +Y
Sbjct: 420 IHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSY 479

Query: 532 ISIF 535
           I IF
Sbjct: 480 IGIF 483

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  289 bits (739), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 171/537 (31%), Positives = 275/537 (51%), Gaps = 16/537 (2%)

Query: 43  DEKSKELYPLRSFPTRVNGEDTFSMXX-XXXXXXXXXVQNAEVKRELKQRHXXXXXXXXX 101
           +EK   L PL S  ++V  E   +             + N  + + L  RH         
Sbjct: 33  EEKDSTLSPLASLDSKVPHEKIQTTTDFASVISHEDDINNVNLNKNLSIRHLLTLAVGGS 92

Query: 102 XXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFL 161
                       L + GP   +I ++ + +  ++V  +LGEMA   PV   F V+  RF+
Sbjct: 93  IGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFI 152

Query: 162 SPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVK 221
            P+ G A    Y   W +   LEL      I++W   +   AW++IF+ +I + N+  VK
Sbjct: 153 DPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETINSDAWVAIFYCVIALANMLEVK 212

Query: 222 YYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNE 280
            +GE EF ++ IK+LAIIGF I    + CG G  G     +YW +PG++         N 
Sbjct: 213 SFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSF------VGHNS 266

Query: 281 G-RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFI 339
           G +F G  S  + AAF++ G E+  ++A E+ +PR ++P+A K+  + I   Y+  L  I
Sbjct: 267 GTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLI 326

Query: 340 GLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVG 397
           G LVPY+DP+L   TS V  ++SP +IAIEN G K LP + NA+IL +IIS ANS +Y  
Sbjct: 327 GCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLMNAIILISIISVANSAVYAC 386

Query: 398 SRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITG 457
           SR +  ++     P+ L+R    G P  A+  T  FG L+++  S     VF WL  ++G
Sbjct: 387 SRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALSG 446

Query: 458 VAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTA 517
           ++  F W+ I++SHIRF Q++  +  S DELPF ++     ++Y    + ++++   +T+
Sbjct: 447 LSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWTS 506

Query: 518 FAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR-FIWKIGDVDIDSDRRDIE 569
             P      +  SF   Y+S  + LA +   +   R R F+  + D+D+D+ RR ++
Sbjct: 507 LFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVD 563

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  287 bits (734), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 174/528 (32%), Positives = 279/528 (52%), Gaps = 25/528 (4%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + + L  RH                     L++ GP   ++ ++ + +  ++V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE+A   P+   F V+  RF+ P+ G A    Y   W +   LEL      I++W  K
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+V I + N+  VK +GE EF ++ +K+LAIIGF I    +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 259 G-FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
             F+YW NPGA+  G      N  +F G  S  + AAF+F G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGG-----TNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + + + Y+  L  +G LVPYND +L  + + V  + SP +IAIEN G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL  I+S ANS +Y  SR +  ++     PK LS+  K G P  A+ VT  FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S   ++VF WL  ++G++  F W+ I+ S IRF +A++ +  S DELP+ ++  
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFI-- 553
              A+Y    + ++I+   +T+  P  +  + A ++   FL L   IL  C F  +    
Sbjct: 453 IWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLP--ILLVCYFGHKLYFA 510

Query: 554 --WKIG----DVDIDSDRR--DIEAIVWEDHEPK-----TFWDKFWNV 588
             W++     ++DIDS R+  D E +  E  E +     +F  KFW+V
Sbjct: 511 RNWRLQIGAEEMDIDSGRKIIDEEGLKQEREEEEKAMNSSFLIKFWHV 558

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  288 bits (737), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 198/580 (34%), Positives = 301/580 (51%), Gaps = 41/580 (7%)

Query: 9   DIEE-----KHMYNEPVTTLFHDVEASQTHHRRGSIPLK------DEKSKELYPLRSFPT 57
           DIE        + +EP +TL  +   +  +  RGSI  K        K  EL  L   P 
Sbjct: 17  DIESTTFGMDDIVHEPCSTLSSN---NNDNESRGSIRCKWTRFVDSFKRIELEELD--PN 71

Query: 58  RVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
             + E                   + +K  LK RH                     L  A
Sbjct: 72  LTDAEKI-----------AIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTA 120

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GP G LI +   G++ YS+  ++GE+A   PV+  FT ++ RF+  +FG A  + Y   W
Sbjct: 121 GPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYMLQW 180

Query: 178 AITFALELSVVGQVIQFWTYKVPLA-AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVL 236
            IT  LE+      + +W         ++++FWV   I+NLF VK YGE EF  A IKV+
Sbjct: 181 LITLPLEIVSASITVNYWGVDAKYRDGFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVV 240

Query: 237 AIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAF 295
            IIGF+I    ++CG G  G     +YW +PGA+       D    +F G+ +  I A+F
Sbjct: 241 TIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF-----VGDTAGQKFKGFCTVFITASF 295

Query: 296 TFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTS 355
           +F G+E+VG+   E+ NPRKSVP A K+V +RI  FY+  LL IG+LVPYND +L  ++S
Sbjct: 296 SFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASS 355

Query: 356 Y-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
              + SPF+IA+ N G + LP + N VIL +++S  NS+IY+ SR L  L++    PK +
Sbjct: 356 VDAAASPFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIV 415

Query: 415 SRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
           +   + G P +A+ + +AFG +A++  S+   +VF WLL ++G++  F+W  I I HIRF
Sbjct: 416 AYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRF 475

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKF---NGVSFAAAY 531
            +AL  +G S DELPF + +    +Y+      +++I Q +    P     N   F  AY
Sbjct: 476 RRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAY 535

Query: 532 ISIFLFLAVWILFQCIFRC--RFIWKIGDVDIDSDRRDIE 569
           +S  + LA +I F  I++   +   K  D+DID+ RR+++
Sbjct: 536 LSFPIVLAFYI-FHKIWKKNWKLYIKAEDMDIDTGRREVD 574

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  288 bits (737), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 169/502 (33%), Positives = 269/502 (53%), Gaps = 19/502 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + ++L  RH                     L+  GP   +I ++ +G+  ++V  
Sbjct: 81  INNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVIN 140

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE++   PV   F V+  RF+ P+F  A    Y   W +   LEL      I++W  K
Sbjct: 141 SLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+  I + N+  VK +GE EF ++ IK+L+IIGF I    + CG G  G  
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGY 260

Query: 259 GF-RYWRNPGAWGPGIISKDKNEG-RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
              +YWRNPGA+         N G +F G  S  + AAF++ G E+  ++A E+ NPR++
Sbjct: 261 IGGKYWRNPGAF------VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRET 314

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVL 374
           +P+A K+  + I   Y+  L  IG LVP NDP+L   +S V  ++SP +IAIEN   K L
Sbjct: 315 IPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGL 374

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           P + NA+IL  ++S ANS +Y  SR +  ++     PKFL+R  K G P  A+ +T  FG
Sbjct: 375 PSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFG 434

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            L+++  S    +VF WL  ++G++  F W+ I++SHIRF +A+K +  S DELPF ++ 
Sbjct: 435 LLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQT 494

Query: 495 MPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCR--- 551
               ++Y    + +++I   +T+  P   G S A+A      +L+  IL  C F  +   
Sbjct: 495 GVLGSWYGFVVLFLVLIASFWTSLFPI--GSSGASAESFFEGYLSFPILIVCYFGHKIYT 552

Query: 552 ----FIWKIGDVDIDSDRRDIE 569
                + KI D+D+D+ R+ ++
Sbjct: 553 RNWTLMVKIEDIDLDTGRKQVD 574

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  289 bits (740), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 182/557 (32%), Positives = 282/557 (50%), Gaps = 25/557 (4%)

Query: 43  DEKSKELYPLRSFPTRV----------NGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRH 92
           DE + E Y ++ F   +          + E  ++             +NA++K+ +K RH
Sbjct: 99  DENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQTIKPRH 158

Query: 93  XXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTS 151
                               PL  AGP   +I Y  MG+  Y + Q+ GE+A  +  V  
Sbjct: 159 VIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAYSKVNG 218

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVI 211
           SF  F    + P F  A  ++Y   W     LEL      I++WT KV    ++ IF+V+
Sbjct: 219 SFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTKVDPDVFVVIFYVL 278

Query: 212 ITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWG 270
           I ++N F  K Y E EF+    KV+ +IGF I   C+  GA G  G +G +YW +PGA+ 
Sbjct: 279 ILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYWNDPGAFR 338

Query: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILT 330
                + K E RF G + + + AAF F  TE + +TA E +NPRK++P A KKV +RIL 
Sbjct: 339 ----GQTKIE-RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVAYRILL 393

Query: 331 FYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISA 389
            ++ S++ IG LVPYN D  +  S+   S SP+++A    G  V+ H  NAVIL +++S 
Sbjct: 394 IFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHFINAVILLSVLSV 453

Query: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVF 449
           ANS  Y  SR+L GL++   APK+     + G P  ++   A    +A+  TS     VF
Sbjct: 454 ANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCATSPKETDVF 513

Query: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTII 509
            WLL I+G++  F W  I +SHIRF + ++ +G S  EL F+A+     +YYAA  + + 
Sbjct: 514 TWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSYYAAIMLFLA 573

Query: 510 IIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSD 564
           ++ Q + A  P      +  +F   Y+++ + LA+++ F+   R  R   +  ++D+ S 
Sbjct: 574 LVAQFWVALVPMNTHTLDAENFFQNYLAMPILLALYVGFKLWRRDFRLFIRAKNIDLISH 633

Query: 565 RR--DIEAIVWEDHEPK 579
           R   D E +  ED E K
Sbjct: 634 RIIFDEELLRQEDEEYK 650

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 166/499 (33%), Positives = 266/499 (53%), Gaps = 13/499 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + +EL  RH                     L+  GP   +I ++ + +  ++V  
Sbjct: 81  INNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I++W  K
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+  I + N+  VK +GE EF ++ IK+LAIIGF I    + CG G  G  
Sbjct: 201 INSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGY 260

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW +PGA+    +  D    +F G  S  + AAF++ G E+  ++A E+ NPR+++
Sbjct: 261 IGGKYWNDPGAF----VGHDSGT-KFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + I   Y+  L  IG LVP NDP+L   +S V  ++SP +IAIEN   K LP
Sbjct: 316 PKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLP 375

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL  ++S ANS +Y  SR +  ++     PKFL R  K G P  A+ +T  FG 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGL 435

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+K++  S DELPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPFISQTG 495

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
              + Y    + +++I   +T+  P      N  SF   Y+S  + +  +   +   R  
Sbjct: 496 VWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYFGHKIYTRDW 555

Query: 551 RFIWKIGDVDIDSDRRDIE 569
           R + K+ D+D+D+ R+ ++
Sbjct: 556 RLLVKLEDMDLDTGRKQVD 574

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  287 bits (735), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 163/499 (32%), Positives = 266/499 (53%), Gaps = 13/499 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + ++L  RH                     L+  GP   +I ++ + +  ++V  
Sbjct: 81  INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I++W  K
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+  I + N+  VK +GE EF ++ IK+L+IIGF I    + CG G  G  
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW +PGA+         +  +F G  S  + AAF++ G E+  ++A E+ NPR+++
Sbjct: 261 IGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + I   Y+  L  IG LVP NDP+L   +S V  ++SP +IAIEN G K LP
Sbjct: 316 PKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLP 375

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL  ++S ANS +Y  SR +  ++     PKFL+R  K G P  A+ +T  FG 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+K +  S DELPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
              ++Y    + +++I   +T+  P      N  SF   Y+S  + +  +   +   R  
Sbjct: 496 VKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFFEGYLSFPILIVCYFGHKIYTRNW 555

Query: 551 RFIWKIGDVDIDSDRRDIE 569
             + K+ D+D+D+ R+ ++
Sbjct: 556 TLMVKLEDIDLDTGRKQVD 574

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  288 bits (736), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 179/545 (32%), Positives = 284/545 (52%), Gaps = 21/545 (3%)

Query: 58  RVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNA 117
            V+G+    M             ++++ + L  RH                     L   
Sbjct: 83  EVDGKRYKEMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTG 142

Query: 118 GPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSW 177
           GP   LI++  + +  +++  SLGE+A+  PV   F V+  RF+ P+FG A    Y   W
Sbjct: 143 GPGSILIAWTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQW 202

Query: 178 AITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLA 237
           A+   LEL+     I++W  K+   AW++IF+V I + N+  VK +GE EF ++ +K+LA
Sbjct: 203 AVLLPLELAAASITIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILA 262

Query: 238 IIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFT 296
           I GF I    ++CG G  G     +YW +PGA+       D    +F G  S  + AAF+
Sbjct: 263 IFGFAILGTVLICGGGPVGGFIGAKYWHDPGAF-----VGDTPGAQFKGLCSVFVTAAFS 317

Query: 297 FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY 356
           + GTELVG++A E+ NPR ++PRA K+  + I + Y+  L   G LVP NDP+L    S 
Sbjct: 318 YSGTELVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSS 377

Query: 357 --VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
             V+ SP +IAIEN G + +P + NA+IL  IIS ANS++Y  SR +  +++    PK  
Sbjct: 378 VDVAASPLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVF 437

Query: 415 SRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
           +   + G P +A+  T  FG L+++  S   + +F WL  ++G++  F W  I+ISHIRF
Sbjct: 438 NYIDRKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRF 497

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTA-FAPKFNG---VSFAAA 530
            +A+  +  S DELP+ +      ++Y A  +  ++++  +T+ F P  +G    SF   
Sbjct: 498 RRAMCAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEG 557

Query: 531 YISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAI----VWEDHE--PKTF 581
           Y+S  +FL  +I  +   R  R     G +D+DS RR  DIE +    + E  E   K F
Sbjct: 558 YLSFPIFLICYISHKLYKRDWRLFIPAGQIDVDSGRRALDIEELKEQKLREQAETAKKPF 617

Query: 582 WDKFW 586
           + ++W
Sbjct: 618 YVRWW 622

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  285 bits (729), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 172/494 (34%), Positives = 266/494 (53%), Gaps = 15/494 (3%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           ++R  KQRH                     L   GP   LI+++F GSL   V  SL EM
Sbjct: 46  LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEM 105

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
           A+F P+  SF+ ++ R++ PA G A G+ Y+  +AI  A ELS +G ++Q+W   + +A 
Sbjct: 106 ASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAI 165

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           +I +F V++  +N   +K+YGE EFW A +K L +I   +    + CG G +   +GFRY
Sbjct: 166 FIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRY 225

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           WR   A+ P ++      GRFLGW + +I + + + G+E +G+  GEA NP+K++P A +
Sbjct: 226 WREY-AFVPYLV--KGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATR 282

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSGTKVLPHIFNAV 381
            V+FRI  FYI  +L +GL++  +D  L  + TS  S SPF+IA  N+G K LP   NA+
Sbjct: 283 NVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAM 342

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441
           ++  I SAAN+ +YV SR  +GL+K+ +APK      + GVP+    +      L++M  
Sbjct: 343 LIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNI 402

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S     +F +L +   V G   WL + IS+I + +A  +  + RD +PF+    P  AY 
Sbjct: 403 SNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYV 462

Query: 502 AATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDI 561
              F+++II   G++AF   F   SF  +YI I +F+   + ++        WK      
Sbjct: 463 CLFFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWK-------FWKKSAATR 515

Query: 562 DSDRRDI---EAIV 572
             D R I   EAIV
Sbjct: 516 PEDLRSIMVEEAIV 529

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  286 bits (733), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 172/513 (33%), Positives = 273/513 (53%), Gaps = 20/513 (3%)

Query: 80  QNAE---VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSV 136
           QNA+   +K+ +K RH                     L + GP G+ I +L MG   Y V
Sbjct: 83  QNAKHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCV 142

Query: 137 TQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195
            Q+ GE+A  +  +   F  +    + PA G A  ++Y   W   F LEL      I+FW
Sbjct: 143 IQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFW 202

Query: 196 --TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA- 252
             +  V    +++IF+V+I ++N F  + Y E EF+  S KVL +IGF I    +  GA 
Sbjct: 203 PGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAV 262

Query: 253 GVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312
           G +G +G +YWR+PG+ G        +   F G V++L+NAAF+   +E V +TA E AN
Sbjct: 263 GTSGYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGT 371
           PRKS+P A KK++++I   ++GS++ IG LVP +  +L  S  S +  SP++IA+   G 
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGV 377

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
            V+P   NAVIL +++S  NS  Y  SR+L  L++   APK      + G P +A+ ++ 
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            FG + ++  S   ++VF+WLL I+G++  F W  I +SHIRF +AL  +G S DEL FK
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
           A+     +Y +A  M + +I Q + +  P       A ++ + +L + +++LF   ++  
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 551 ----RFIWKIGDVDIDSDRR--DIEAIVWEDHE 577
               R   +   +D+ S RR  D + +  ED E
Sbjct: 558 NKDWRLFIRADQIDLVSHRRIFDADVLKQEDIE 590

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  286 bits (731), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 200/598 (33%), Positives = 298/598 (49%), Gaps = 40/598 (6%)

Query: 10  IEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKS--KELYPLRSFPTRVNGEDTFSM 67
           I+ + +  EP+T   +    S      GS   +D K   K + P+   P     E     
Sbjct: 22  IDSEFLTQEPITIPSNGSAVSIDETGSGS-KWQDFKDSFKRVKPIEVDPNLSEAEKV--- 77

Query: 68  XXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
                           +K  LK RH                     L   GP   LI + 
Sbjct: 78  --------AIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
             G++ Y++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+  
Sbjct: 130 STGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 188 VGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCF 246
               + FW T       ++++FW+ I I+N+F VK YGE EF  + IKV+ ++GF+I   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + CG G TG     +YW +PGA+     + D    +F G  S  + AAF+F G+ELVG+
Sbjct: 250 ILNCGGGPTGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGL 304

Query: 306 TAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFII 364
            A E+  PRKSVP+A K+V +RI  FYI SLL IGLLVPYND  L  ++S   + SPF+I
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVI 364

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424
           AI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  P+  S   + G P 
Sbjct: 365 AIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPL 424

Query: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + + VT+AFG +A++  S    +VF WLL ++G++  F W  I I HIRF +AL  +G  
Sbjct: 425 VGIAVTSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRG 484

Query: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS---FAAAYISIFLFLAVW 541
            DEL FK+      +Y+    + I+ I Q + A  P  +  S   F  AY+S  L + ++
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMY 544

Query: 542 ILFQCIFRCRFIWKI----GDVDIDSDRR--DIEAIVWEDHEPKTF------WDKFWN 587
           I  +   R    WK+      +DID+ RR  D++ +  E  E K        W + WN
Sbjct: 545 IGHKIYKRN---WKLFIPAEKMDIDTGRREVDLDLLKQEIAEEKAIMATKPRWYRIWN 599

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  286 bits (731), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 162/499 (32%), Positives = 267/499 (53%), Gaps = 13/499 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + N  + ++L  RH                     L+  GP   +I ++ + +  ++V  
Sbjct: 81  INNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVIN 140

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE++   PV   F V+S RF+ P+F  A    Y   W +   LEL      I++W  K
Sbjct: 141 SLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK 200

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+  I + N+  VK +GE EF ++ IK+L+IIGF I    + CG G  G  
Sbjct: 201 INSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGY 260

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW +PGA+         +  +F G  S  + AAF++ G E+  ++A E+ NPR+++
Sbjct: 261 IGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETI 315

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + I   Y+  L  IG LVP NDP+L   +S V  ++SP +IAIEN G K LP
Sbjct: 316 PKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLP 375

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL  ++S ANS +Y  SR +  ++     PKFL+R  K G P  A+ +T  FG 
Sbjct: 376 SLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGL 435

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S    +VF WL  ++G++  F W+ I++SHIRF QA+K +  S DELPF ++  
Sbjct: 436 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTG 495

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
              ++Y    + +++I   +T+  P      +  SF   Y+S  + +  ++  +   R  
Sbjct: 496 VKGSWYGFIVLFLVLIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNW 555

Query: 551 RFIWKIGDVDIDSDRRDIE 569
             + K+ D+D+D+ R+ ++
Sbjct: 556 TLMVKLEDMDLDTGRKQVD 574

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  285 bits (730), Expect = 9e-88,   Method: Compositional matrix adjust.
 Identities = 184/547 (33%), Positives = 280/547 (51%), Gaps = 19/547 (3%)

Query: 46  SKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQ-NAEVKRELKQRHXXXXXXXXXXXX 104
           +++L+   +   R N  DTF             V+ N++ K+ +K RH            
Sbjct: 44  NRKLHNFCNSFKRAN-SDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGT 102

Query: 105 XXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSP 163
                    L   GP G LI Y  +  +AY + Q+ GEMA   P +  +F V+S  F+S 
Sbjct: 103 GLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISK 162

Query: 164 AFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYY 223
           +FG A  ++Y   W     LEL      I++W   +   A+I+IF+ +I  ++ F    Y
Sbjct: 163 SFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSINPDAFIAIFYAVIVFIHFFGAAGY 222

Query: 224 GEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGR 282
           GE EF  ++ KV  I GF+I    + CG   TG      YWRNPGA+  G        G 
Sbjct: 223 GEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGG-----SPIGH 277

Query: 283 FLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLL 342
           F G    L+ A F++ G EL  +T  E ANPRK+VP A KK ++RIL  Y+ +++ IG L
Sbjct: 278 FKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFL 337

Query: 343 VPYNDPKLTQSTSYVST--SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRI 400
           VPYN  +L  S+   +T  SP++IA+ + G KV+PHI NAVIL +++S  NS +Y   R+
Sbjct: 338 VPYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRL 397

Query: 401 LFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAG 460
           L  L++   APK  S   + G P +A+   + FG L+++  S   ++VF WL  I G++ 
Sbjct: 398 LNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSE 457

Query: 461 FFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP 520
            F W  I +SH+RF  A+KY+G S  EL +K+K     + YA  F  I+ + Q + A AP
Sbjct: 458 LFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIVFVAQFWVALAP 517

Query: 521 KFN-GVSFAAAYISIFLFLAVWILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIV 572
             N G + A A+   +L   +WI     ++      + +  + ++D++S R   D   + 
Sbjct: 518 IGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDKHILQ 577

Query: 573 WEDHEPK 579
            ED E K
Sbjct: 578 QEDDEHK 584

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  284 bits (727), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 183/610 (30%), Positives = 311/610 (50%), Gaps = 46/610 (7%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN 60
           M ++K ++++E     ++  T LF       +  R   + + +  +K  Y ++     V 
Sbjct: 1   MVDTKLESEVETS--ISKSWTKLF------SSFKRMEEVEVVESLTKSNYDVQ-----VM 47

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
           G+    M            ++  + R+L  RH                     L   GP 
Sbjct: 48  GKKYEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPA 107

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAIT 180
             +I++  + +  +++  +LGE+A   PV   F V+  R + P+ G A    Y   WA+ 
Sbjct: 108 SLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVL 167

Query: 181 FALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240
             LEL      I++W   V   AW+++F+V I + +L  VK +GE EF ++ +K+LAI G
Sbjct: 168 LPLELVAASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGG 227

Query: 241 FLIYCFCMVCGAG-VTGPVGFRYWRNPGAW---GPGIISKDKNEGRFLGWVSSLINAAFT 296
           F I    ++CG G   G +G +YW +PG++    PG         +F G  S  + AAF+
Sbjct: 228 FTILGIVLICGGGPKNGYIGAKYWNDPGSFVGASPG--------SQFKGLCSVFVTAAFS 279

Query: 297 FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY 356
           + GTELVG++A E+ANPR ++P+A K+  + I   Y+  L  IG LV ++DPKL  ++S 
Sbjct: 280 YSGTELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSS 339

Query: 357 V--STSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
           V  + SP +IAIEN G + LP + NA+IL  IIS ANS++Y  SR +  +++    P+  
Sbjct: 340 VDVAASPLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIF 399

Query: 415 SRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
           +     G P +A+  T  FG L+++  S   +++F WL  ++G++  F WL I+ISHIRF
Sbjct: 400 TYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRF 459

Query: 475 MQALKYRGISRDELPFKAKLMPGL--AYYAATFMTIIIIIQGFTAFAPKFNG----VSFA 528
            +AL  +G S DELP+ +  M G+  ++Y    + +++I   +T+  P  +      SF 
Sbjct: 460 RRALNTQGYSLDELPYLS--MTGVIGSWYGCVVIILVLIASFWTSLFPAGSSGADWESFF 517

Query: 529 AAYISIFLFLAVWILFQCIFRCRFIWKI--GDVDIDSDRRDIEAIVW--------EDHEP 578
             Y+S+ +FL  ++  + +++  + W I    +D+++ RR I+            E    
Sbjct: 518 KGYLSLPIFLFCFVGHK-LYKRNWSWMIRSNKIDVNTGRRMIDKEELEKEKQEFNEYMAR 576

Query: 579 KTFWDKFWNV 588
           K+F  K WN+
Sbjct: 577 KSFIAKLWNL 586

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  284 bits (727), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 278/526 (52%), Gaps = 21/526 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V N  + + L  RH                     L + GP   +I ++ + +  ++V  
Sbjct: 65  VTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVIN 124

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           +LGEMA   PV   F V+  RF+ P+ G A    Y   W +   LEL      I++W   
Sbjct: 125 ALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDT 184

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+ +I   N+  VK +GE EF ++ +K+LAIIGF I    + CG G  G  
Sbjct: 185 INSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGY 244

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW NPG++         +  +F G  S  + AAF++ G E+  ++A E+ +PR+++
Sbjct: 245 LGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTI 299

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P+A K+  + I   YI  L  IG LVPY++P+L   +S V  ++SP +IAIEN G K LP
Sbjct: 300 PKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLP 359

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL +IIS ANS +Y  SR +  ++     P+ L    K G P  A+  T  FG 
Sbjct: 360 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGL 419

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L+++  S    +VF WL  ++G++  F W+ I+ISHIRF QA+K +  S DELP+ ++  
Sbjct: 420 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTG 479

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
              ++Y    + +++I+  +T+  P      +  SF   Y+S  + +A ++  + ++R +
Sbjct: 480 VWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKK 539

Query: 552 -FIWKIGDVDIDSDRRDIEAIVW-------EDHEPK-TFWDKFWNV 588
             +  + D+DID+ RR ++  +        ++H  K +F+ +F +V
Sbjct: 540 QIVVALEDMDIDTGRRQVDLTIRRQEMKEEQEHLAKSSFFARFLHV 585

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  285 bits (728), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 199/582 (34%), Positives = 301/582 (51%), Gaps = 31/582 (5%)

Query: 10  IEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKD--EKSKELYPLRSFPTRVNGEDTFSM 67
           I+ +++  EP+T +  +  A  T    GS   KD  +  K + P+   P     E     
Sbjct: 22  IDSEYLTQEPIT-IPSNGSAVSTEKGSGS-KWKDFRDSFKRVEPVEVDPNLTEAEKV--- 76

Query: 68  XXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
                           +K +LK RH                     L   GP   LI + 
Sbjct: 77  --------AFITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWG 128

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
            MG++ Y++  +LGE+A   P++  FT ++ RF+  +FG A  + Y   W +T  LE+  
Sbjct: 129 SMGTMIYAMVMALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVS 188

Query: 188 VGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCF 246
               + +W T       ++++FW++I  +N+F VK YGE EF  + IKV+ IIGF+I   
Sbjct: 189 ASITVNYWGTDPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGI 248

Query: 247 CMVCGAG-VTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + CG G   G +G +Y+ +PGA+     + D    +F G  S  + AAF+F G+ELVG+
Sbjct: 249 ILNCGGGPEKGYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGL 303

Query: 306 TAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFII 364
            A E+ +PRKSVP+A K+V +RI  FYI SLL IGLLVPYND +L  ++S   + SPF+I
Sbjct: 304 AASESVDPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVI 363

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424
           AI   G K LP + N VIL  ++S  NS I+  SR    L++    P+  +   + G P 
Sbjct: 364 AIVTHGIKGLPSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPL 423

Query: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + + +T+A G +A++  S   + VF WLL ++G++  F W  I I HIRF +AL  +G S
Sbjct: 424 VGIIITSAVGLIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRS 483

Query: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGV----SFAAAYISIFLFLAV 540
            DEL FK+      +Y+    + I+ I Q + A  P  NG      F  AY+S  L LA+
Sbjct: 484 VDELSFKSPTGVWGSYWGLFMIVIMFIAQFYVALFP-VNGSPSAEGFFEAYLSFPLVLAM 542

Query: 541 WILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           +I  +   R  + +   G++DIDS RR  D+E +  E  E K
Sbjct: 543 YIGHKIYKRNWKLLIPAGEMDIDSGRREVDLELLKQEIAEEK 584

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  286 bits (732), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 179/519 (34%), Positives = 277/519 (53%), Gaps = 33/519 (6%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ E+K+ +K RH                     L  AGP G +I +  MGS  Y + Q+
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           +GE+A  +  +   F  +    +  AF  A  ++Y   W     LEL      I++WT K
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 199 VPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           V    ++ IF+++I  +NL      Y E EF   S K++ +IGF I    ++CG AG  G
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW +PGA     +  D +  RF G +++L+NAAF F  +E +G+TA E +NPRK+
Sbjct: 334 YIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKA 388

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLP 375
           +P A KK+++RIL  ++ S+  +G LVPYN  +L  ST S V  SP+++AI   G +V+P
Sbjct: 389 IPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVP 448

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL +++S ANS  Y  SR+L  L++   APK  S   + G P + +   A FG 
Sbjct: 449 HFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGV 508

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           +A+  TS   D+VF WLL I+G++  F W+ I ISHIRF +A+  +G S  EL F++++ 
Sbjct: 509 IAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVG 568

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIF 548
              + YAA  M +I+I Q + A  P       K +  +F   Y+++ + LA +  ++   
Sbjct: 569 WYGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYK--- 625

Query: 549 RCRFIWK--------IGDVDIDSDRR--DIEAIVWEDHE 577
               IWK          ++D+ S R   D E I  E+ E
Sbjct: 626 ----IWKKDWKLFIRAKNIDLISHRNIFDEELIKQEEDE 660

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  284 bits (727), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 174/509 (34%), Positives = 265/509 (52%), Gaps = 16/509 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQA 146

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      IQ+W  K
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDK 206

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF++ +  +++F VK YGE EF     K+L I GF+I    + CG AG  G 
Sbjct: 207 LNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGY 266

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW NPGA+     + D +  RF      L+   F+F G EL  ++  E +NPRKS 
Sbjct: 267 IGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKST 321

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RI+  Y+ +++ IG  VPYND +L  +  S    SP+++A    G K++PH
Sbjct: 322 PVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPH 381

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL +++S ANS++Y G R++  LS+   APKFL    + G P  A+ V   FG +
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVI 441

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S DEL +KA    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFN-GVSFAAAYISIFLFLAVWILF---QCIFRCRF 552
             + Y   F  ++ I Q + A AP  N G     ++   +L   +W+ F     I+   F
Sbjct: 502 WGSVYGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDF 561

Query: 553 --IWKIGDVDIDSDRR--DIEAIVWEDHE 577
             +  +  +D+D  RR  D E I  ED E
Sbjct: 562 TLLNPLDKIDLDFHRRIYDPELIRQEDQE 590

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  283 bits (723), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 173/511 (33%), Positives = 266/511 (52%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++++K+ +K RH                     L   GP   +I Y+ +  + Y + Q+
Sbjct: 87  SDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQA 146

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P + ++F  +S  F+S  FG A  ++Y F W     LEL      IQFW  K
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDK 206

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF     K+L I GF++    + CG AG  G 
Sbjct: 207 INPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGY 266

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW  PGA+     + D +  RF      L+ A F+F G EL  ++  E  NPRKS 
Sbjct: 267 IGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKST 321

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RI+  Y+ +++ IG  VPYND +L  +  S    SP+++A    G +++PH
Sbjct: 322 PVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVRIVPH 381

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL +++S ANS++Y G R++  L++   APKFL    + G P  A+ V    G +
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVI 441

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S+  + VF WL  I G++  F W  I +SH+RF QA+K +G S +EL +KA    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGI 501

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILF---QCIFRCRF 552
             + Y + F  ++ I Q + A AP  NG    A A+   +L   +W++F     I+   F
Sbjct: 502 WGSIYGSFFNILVFIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNRDF 561

Query: 553 --IWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
             +  +  +D+D  RR  D E +  ED E K
Sbjct: 562 TLLNPLDKIDLDFHRRVYDPELMRQEDEENK 592

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  280 bits (717), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 185/541 (34%), Positives = 275/541 (50%), Gaps = 25/541 (4%)

Query: 10  IEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKS--KELYPLRSFPTRVNGEDTFSM 67
           I+ + +  EP+T   +   AS      GS   +D K   K + P+   P     E     
Sbjct: 22  IDSEFLTQEPITIPSNGSAASAEEAGSGS-KWQDFKDSFKRVEPIAVDPNLTEAEKV--- 77

Query: 68  XXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYL 127
                           +K  LK RH                     L   GP   LI + 
Sbjct: 78  --------AIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWG 129

Query: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187
             G++ Y++  +LGE+A   P++  FT ++ RF+  +FG AN + Y   W +   LE+  
Sbjct: 130 STGTMIYAMVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVS 189

Query: 188 VGQVIQFW-TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCF 246
               + FW T       ++++FWV+I I+N+F VK YGE EF  + IKV+ ++GF+I   
Sbjct: 190 ASITVNFWGTDPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGI 249

Query: 247 CMVCGAGVTGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGI 305
            + CG G  G     +YW +PGA+     + D    +F G  S  + +AF+F G+ELVG+
Sbjct: 250 ILNCGGGPEGGYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGL 304

Query: 306 TAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFII 364
            A E+  PRKSVP+A K+V +RI  FYI SLL IGLLVPYND  L  ++S   + SPF+I
Sbjct: 305 AASESVEPRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVI 364

Query: 365 AIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPY 424
           AI+  G K LP + N VIL  ++S  NS IY  SR +  L++ +  P+  +   + G P 
Sbjct: 365 AIKTHGIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPL 424

Query: 425 IAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGIS 484
           + + VT+AFG +A++  S     VF WLL ++G++  F W  I I HIRF +AL  +G  
Sbjct: 425 VGIGVTSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRD 484

Query: 485 RDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS---FAAAYISIFLFLAVW 541
            DEL FK+      +Y+    + I+ I Q + A  P     S   F  AY+S  L +A++
Sbjct: 485 LDELSFKSPTGVWGSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMY 544

Query: 542 I 542
           I
Sbjct: 545 I 545

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  281 bits (718), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 179/573 (31%), Positives = 283/573 (49%), Gaps = 29/573 (5%)

Query: 31  QTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQ 90
           Q     G   + D+++ ++Y L       + E   S+             +  +K+ LK 
Sbjct: 5   QDLKDAGETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQS------GDHNLKKGLKS 58

Query: 91  RHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-- 148
            H                     L   GP G  ISY  M ++ Y V  +L EM  F+P  
Sbjct: 59  AHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGL 118

Query: 149 -----VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
                   S +    R++  + G A G+ Y + + I  A E +    V+ +WT  VP AA
Sbjct: 119 PDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAA 178

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFRY 262
           WI+IF  II ++N   V++YG  E    S+K+  I+G +I    +  G G     +GFR+
Sbjct: 179 WITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRF 238

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKSVPRAI 321
           W++PGAW   +   D   GR    ++ +I A F F  G ELV +T+ EA + R+++ +A 
Sbjct: 239 WKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAA 296

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDP----KLTQSTSYVSTSPFIIAIENSGTKVLPHI 377
           ++ V+R++ FY  S L  G++V  NDP     L+Q      +SPF+I I+N+G KVLPHI
Sbjct: 297 RRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHI 356

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N  IL++  S+ NS +Y  +R L  LS+   APK  +R  + GVPY  V    AF  LA
Sbjct: 357 INVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLA 416

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           Y+  S+    VF W  NI+ ++GF  W+   ++++RF +A+ +  +  D LPFK    P 
Sbjct: 417 YLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPY 475

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI- 556
             ++    + II +I G+ +F   +N   F AAYI++ LFL +W+  +   R    W I 
Sbjct: 476 FTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQWMIS 534

Query: 557 -GDVDIDSDRRDIEAIVWEDHE----PKTFWDK 584
             ++D+ +  R+IE    E +     P+  W+K
Sbjct: 535 VSEIDVTTGLREIEEETKELNARRIPPRNLWEK 567

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  281 bits (719), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 177/511 (34%), Positives = 272/511 (53%), Gaps = 21/511 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ ++K+ ++ RH                     L N GP G  + +  MG+  Y V Q+
Sbjct: 85  KHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQA 144

Query: 140 LGEMATFIPVTSS-FTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P  S  F  +    + P FG A  ++Y   W   F LEL      I++WT  
Sbjct: 145 AGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTA 204

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGP 257
           +    ++++F+++I ++N F  + Y E EF+  + KVL IIGF I    +  GA G  G 
Sbjct: 205 INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGY 264

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR PG++G G  + D     F G VS+L+NAAF+   +E V +TA E ANPRKSV
Sbjct: 265 IGAKYWREPGSFG-GHTAID----HFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSV 319

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A KK+++++   ++GS+  IG LVP N  +L  ST S V  SP++IA+ + G +V+PH
Sbjct: 320 PSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPH 379

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  NS  Y  SR+L  L++   AP       + G P +A+ V+   G L
Sbjct: 380 FINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCL 439

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S   + VF WLL I+G++  F W  I ISHIRF +AL  +G   D L FKA+   
Sbjct: 440 CFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGV 499

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             +YY+A  M +  I Q +T   P    K N  SF   Y++  +F+A++  ++   +   
Sbjct: 500 WGSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKN-- 557

Query: 553 IWKI----GDVDIDSDRR--DIEAIVWEDHE 577
            W++      +D+D  R+  D + +  ED E
Sbjct: 558 -WQLFIPAEKIDLDLHRKIFDADVLKQEDAE 587

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  281 bits (718), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 186/582 (31%), Positives = 278/582 (47%), Gaps = 70/582 (12%)

Query: 3   NSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGE 62
            SK+D DI E H   +P   +F                           + SF   ++G 
Sbjct: 44  QSKDDDDIAEGHSSYQPPRNIFQRC------------------------IDSFKPPLDGS 79

Query: 63  DTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGA 122
                                +KR LK RH                     L + GP+  
Sbjct: 80  ----------------FHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLAL 123

Query: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182
           +I +   G+        LGE+    PV  +F  +S RFL P+       +Y   W     
Sbjct: 124 IIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLP 183

Query: 183 LELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFL 242
           LE+      IQ+W   +    W++IF+ +I  +NLF  + +GE EF  +SIKV+ IIGF+
Sbjct: 184 LEIIASAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFI 243

Query: 243 IYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTE 301
           I C  ++CG G     VG RYW +PG    G          F G +S L+ A+++  GTE
Sbjct: 244 ILCIVLICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTE 293

Query: 302 LVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSP 361
           +V + +GE  NPR+ +P AIK+  +RIL F++ SL  IG LVPY +P L   +S V+ SP
Sbjct: 294 MVCLASGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSS-VNNSP 350

Query: 362 FIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGG 421
           F+IAI+    K LP I NAVIL +I+S  NS I+  SR L  ++   L PKF     + G
Sbjct: 351 FVIAIKLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAG 410

Query: 422 VPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYR 481
            P   +   + FG LA++  S+   +VF+WL+ I G+A    WL I+ISHIRF  A+K +
Sbjct: 411 RPLTGILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQ 470

Query: 482 GISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-----------KFNGVSFAAA 530
           G S DEL F + +    + Y+A   ++I+I Q + A  P           K    S+  A
Sbjct: 471 GKSLDELEFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCA 530

Query: 531 YISIFLFLAVWILFQCIFRCRFIWKIGD---VDIDSDRRDIE 569
            I  FLF+   + ++  ++    W I D   +D+++DR++I+
Sbjct: 531 LIMAFLFVCHKVFYR--YKTGKWWAIMDLDKIDLETDRKNID 570

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  281 bits (718), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 161/499 (32%), Positives = 268/499 (53%), Gaps = 13/499 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +  + + ++L  RH                     L   GP   +I ++ + +  ++V  
Sbjct: 84  IDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVIN 143

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE+A   PV   F+V+  RF+ P+   +    Y   W +   LEL      I++W  K
Sbjct: 144 SLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDK 203

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW+SIF+ +I ++N+  VK +GE EF ++ IK+LAIIGF I    + CG G  G  
Sbjct: 204 INSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGY 263

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW +PGA+            +F G  S  + AAF++ G E++ ++A E+ +PRK++
Sbjct: 264 IGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTI 318

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLP 375
           P A K+  + I   Y+  L  IG LVPY+DP+L   +S V  ++SP +IAIEN G K LP
Sbjct: 319 PVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLP 378

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            + NA+IL  ++S ANS +Y  SR +  ++     PK L R  K G P  A  VT  FG 
Sbjct: 379 SLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGL 438

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           ++++  S    +VF WL  ++G++  F W+ I+ISHIRF +A+  +G S +E+P+ +++ 
Sbjct: 439 ISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVG 498

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
              ++Y    + +++I   +T+  P    + N  +F   Y+S+ + LA ++  +  F+  
Sbjct: 499 VYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNW 558

Query: 551 RFIWKIGDVDIDSDRRDIE 569
           R      ++D+DS +RDI+
Sbjct: 559 RLFTPYNEIDLDSGKRDID 577

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  280 bits (716), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 169/509 (33%), Positives = 266/509 (52%), Gaps = 16/509 (3%)

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
           + +K+ +K RH                     L+  GP   +I Y+ +  + Y + Q+ G
Sbjct: 73  SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAG 132

Query: 142 EMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           EMA   P +  +F  ++  F+S  FG A  ++++  W   F LEL      I++W  K+ 
Sbjct: 133 EMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKIN 192

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVG 259
              +I IF+V +  ++ F VK YGE EF   S KVL I GF+I    + CG AG  G +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
            +YWR+PG++  G    D  E +F G    L+ A F++ G EL  ++  E  NPRKS P+
Sbjct: 253 AKYWRDPGSFAEG----DSVE-KFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHIF 378
           A K+ ++RIL  Y+ +++ IG  VP+N+ +L  S  S    SP+++A    G KV+PH  
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFI 367

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL ++IS ANS +Y   R++  L++   APKFL    + G P  A+ + A FG + +
Sbjct: 368 NAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGF 427

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S+  ++VF WL  I G++  F W  I +SH+RF Q +K  G S +E+ F+A      
Sbjct: 428 VSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWG 487

Query: 499 AYYAATFMTIIIIIQGFTAFA-PKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RF 552
           + Y  +F  ++ I Q + A A P  +G   A ++   +L   +W+ F   +        F
Sbjct: 488 SMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRDFTF 547

Query: 553 IWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           +  +  +D++  RR  D E I  ED E K
Sbjct: 548 LVPLDKIDLNFHRRIYDPELIRQEDEENK 576

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  280 bits (716), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 171/511 (33%), Positives = 268/511 (52%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ +K RH                     L  AGP   +I Y+ +  + Y + Q+
Sbjct: 82  SNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQA 141

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEM    P +  +F  ++  F+S +FG A  +++   W     LEL      I++W  K
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDK 201

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF  +S K+L I GF+I    + CG AGV G 
Sbjct: 202 INSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGY 261

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PG++  G         RF G    L+ A F+F G EL  ++  E +NPRKS 
Sbjct: 262 IGGKYWRDPGSFAEG-----NGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKST 316

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376
           P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  S S  +  SP+++A      +V+PH
Sbjct: 317 PVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPH 376

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS ANS +Y   R++  L++   APKFL    + G P  A+FV    G +
Sbjct: 377 IINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVI 436

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S   ++ F WL  I G++  F W  I +SHIRF +A+K +G S DE+ +KA    
Sbjct: 437 GFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGI 496

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
             +YY   F  ++ + Q + A +P     K N  +F  +Y++  L+L +++ +    R  
Sbjct: 497 WGSYYGVFFNILVFMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYMLYERDF 556

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            F+  +  +D+D  RR  D E I  E+ E K
Sbjct: 557 TFLNPLDKIDLDYHRRVYDPEIIRQENEENK 587

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  281 bits (718), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 183/594 (30%), Positives = 296/594 (49%), Gaps = 23/594 (3%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKD-----EKSKELYPLRSF 55
           + NS +++ +  +          F D   S     R S PL D       S     + + 
Sbjct: 35  INNSYDESSVRNRKTKEGTFVRSFID---SFKRADRNSNPLHDLDNDITTSISRTSMDAA 91

Query: 56  PTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
             +   +D  S             ++ ++K+ +K RH                     L+
Sbjct: 92  LNKTKFDDAISSSISETNKGHQNEKSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLS 151

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYW 174
            AGP   +I Y  MG+  Y + Q+ GE+A  +  +   F  +    + PA G +  ++Y 
Sbjct: 152 KAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYC 211

Query: 175 FSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIK 234
             W     LEL      I++WT KV    ++ IF+V+I  +N F  + Y E EF+    K
Sbjct: 212 LQWLCVCPLELVTASMTIKYWTTKVDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCK 271

Query: 235 VLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINA 293
           VL + GF I    +  G AG  G +G +YW +PGA+     + DK+  RF G + + + A
Sbjct: 272 VLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTA 326

Query: 294 AFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS 353
           AF F  TE + +TA E +NPRK++P A KKV++RI+  ++ S+  IG LVPYN  +L  S
Sbjct: 327 AFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGS 386

Query: 354 T-SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPK 412
             S +  SP++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  L++   APK
Sbjct: 387 GGSGIKASPYVIAVSSHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPK 446

Query: 413 FLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHI 472
           +     + G P+ A+ ++A FG +A+  TS    +VF WLL I+G++  F W+ I +SHI
Sbjct: 447 WFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEVFSWLLAISGLSQLFTWITICVSHI 506

Query: 473 RFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYI 532
           RF +A++ +G S  E+ + ++     + YAA  + + +I Q + A AP   G   A  + 
Sbjct: 507 RFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLFLALIAQFWVAIAPIGEGKLDAENFF 566

Query: 533 SIFLFLAVWILFQCIFRC-RFIWKI----GDVDIDSDRR--DIEAIVWEDHEPK 579
             +L + + I F   +R  +  WK+     D+D+D+ R+  D   +  ED E K
Sbjct: 567 QNYLAMPILIAFYFGYRVWKRDWKLFIRAKDIDLDTHRQIFDENILRQEDEEYK 620

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  280 bits (716), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 179/570 (31%), Positives = 295/570 (51%), Gaps = 26/570 (4%)

Query: 28  EASQTHHRRGSIPLKDEK---------SKELYPLRSFPTRVNGE-DTFSMXXXXXXXXXX 77
           EA  T    G   L DEK         S E+Y   +  T   G+ D+ S+          
Sbjct: 27  EAPVTTGSTGGDSLGDEKNGFMGAGTTSYEMYNYSNSSTGAGGKGDSHSLTRDEAGSGVM 86

Query: 78  XVQ---NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAY 134
                 + ++ ++L  RH                     L++ GP   +I ++ + +  +
Sbjct: 87  KEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLF 146

Query: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194
           +V  SLGE+A   PV   F V+  RF+ P+FG A    Y   W +   LEL      I++
Sbjct: 147 TVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRY 206

Query: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV 254
           W  K+   AW++IF+  I   N+  VK +GE EF ++ IK+LAI+GF I    + CG G 
Sbjct: 207 WNDKINSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGP 266

Query: 255 TGPVGF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANP 313
            G     +YW +PGA+       + +  +F G  S  + AAF++ G EL  ++A E+ NP
Sbjct: 267 KGGYIGGKYWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNP 321

Query: 314 RKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGT 371
           R+++P+A K+  + I   Y+  L  IG LVPYN+PKL   +S V  ++SP +IAIEN G 
Sbjct: 322 RETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGI 381

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           + LP + NA+IL  I+S ANS +Y  SR +  +++ +  P+FL R  + G P  A  +T 
Sbjct: 382 RGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTL 441

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            FG L+++  S   ++VF WL  ++G++  FAW+ I++SHIRF QA+ ++GIS DELP+ 
Sbjct: 442 FFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPYI 501

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQC- 546
           +      ++Y    + ++++   +T+  P      +  SF   Y+S  + +  ++  +  
Sbjct: 502 SMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGYLSFPILIVCYVGHKLY 561

Query: 547 IFRCRFIWKIGDVDIDSDRRDIEAIVWEDH 576
           I + R +  + D+D+ SDR+ ++  V  + 
Sbjct: 562 IRKKRLLIDVADMDLVSDRKVVDVEVCREE 591

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  280 bits (715), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 180/509 (35%), Positives = 271/509 (53%), Gaps = 16/509 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            A ++  LK R                      L   GP G +I +    ++ YS+  +L
Sbjct: 100 KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMAL 159

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKV 199
           GE+A   PV   FT ++ RF+  +FG AN + Y   W +   LE+      + +W T   
Sbjct: 160 GELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTR 219

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++FW++I I+N+F VK +GE EF  + IKV  +IGF+I    +VCG G  G   
Sbjct: 220 YRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFV 279

Query: 260 F-RYWRNPGAW-GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
             +YW +PGA+ G G      +  +F G  S  + AAF+F G+EL+GITA EAANPRKS+
Sbjct: 280 GAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSI 333

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376
           P A K+VV+RI+ FY+G+L  IGLLVPYND +L  ++S   + SPF+IAI   G K LP 
Sbjct: 334 PGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPS 393

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           + N VIL  ++S  NS I+  SR +  LS     PK      + G P + + +T+ FG L
Sbjct: 394 VINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLL 453

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S    +VF WLL ++G++  F W  I + HIRF  ALK +G   +EL F +    
Sbjct: 454 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGV 513

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RF 552
             +Y+    + ++ I Q + A  P   K +   F  +Y+S  + +A +   +   R  + 
Sbjct: 514 AGSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKL 573

Query: 553 IWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
              + D+DID+ RR  D+E +  E  E K
Sbjct: 574 FIPLEDMDIDTGRRETDMELLKQEIMEEK 602

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  280 bits (717), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 173/526 (32%), Positives = 274/526 (52%), Gaps = 24/526 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ ++ RH                     L NAGP G +I Y  MGS+ Y + Q+
Sbjct: 126 DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQA 185

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA  +  +   + V+    +   FG A  ++Y   W     LEL      I++WT  
Sbjct: 186 TGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS 245

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    +++IF+ +I I+N+F  K Y E EF+    KVL +IGF I    +  G AG  G 
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW  PGA+       D +   F G   +L+ AAF + GTE + +TA E +NPR ++
Sbjct: 306 LGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A KKV++RI+  Y+ S+L IG LVP++  +L  S  S  S SP+++A    G +V+PH
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPH 420

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  NS  Y  SR+L  L++   APK+     + G P  A+ ++A FG +
Sbjct: 421 FINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVI 480

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S    +VF WLL I+G++  F W  I +SHIRF  A+K +G S  E+ + A+   
Sbjct: 481 AFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGV 540

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
             ++YA   M +I I Q + A AP    + +  +F   Y+++ + + +++ ++  ++   
Sbjct: 541 WGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWT 600

Query: 552 FIWKIGDVDIDSDRR--DIEAIVWEDHEPKT------FWDK---FW 586
            + K  D+D+ S R+  D + +  ED E +       FW +   FW
Sbjct: 601 LLIKAEDIDLQSHRQIFDEDLLKEEDFEYRQRLKNGPFWRRVVDFW 646

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  278 bits (711), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 171/514 (33%), Positives = 268/514 (52%), Gaps = 20/514 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V    +K+ +K RH                     L  +GP   +I Y+ +  + Y + Q
Sbjct: 48  VTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQ 107

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GEMA   P +  SF  ++  F+S  FG A  ++++  W   F LEL      +++W  
Sbjct: 108 AAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWND 167

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           K+    +I IF+  +  ++ F VK YGE EF   S KVL + GF+I    + CG AG  G
Sbjct: 168 KINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDG 227

Query: 257 PVGFRYWRNPGAW--GPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
            +G +YW +PG++  GP I        RF G    L++A F++ G EL  ++  E  NPR
Sbjct: 228 YIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGAELFSLSVNEQENPR 280

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKV 373
           KS P A K+ ++RIL  Y+ +++ IG  VP+N  +L  + S  +  SP+++A      KV
Sbjct: 281 KSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKV 340

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           +PH  NAVIL ++IS ANS +Y   R++  L++   APKFL+   + G P   + + A F
Sbjct: 341 VPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALF 400

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
           G + ++  S+  ++VF WL  I G++  F W  I +SHIRF QA+K+ G S DE+ FKA 
Sbjct: 401 GVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAV 460

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILF---QCIFR 549
                +YY   F  ++ I Q + A +P  +G    A A+   +L   +W++F     I++
Sbjct: 461 TGIWGSYYGCAFNILVFIAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGYMIYK 520

Query: 550 CRF--IWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
             F  +  +  +D+D  RR  D + I  ED E K
Sbjct: 521 RDFTILNPLEKIDLDFHRRIYDPDFIKQEDEENK 554

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  281 bits (718), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 262/508 (51%), Gaps = 19/508 (3%)

Query: 85  KRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA 144
           K  +K RH                     L  +GP G ++ Y  +  + Y V Q+ GEMA
Sbjct: 155 KGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQAAGEMA 214

Query: 145 TFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
              P +   F  +   F+S  FG A  +++  +W     LEL      +++WT  +    
Sbjct: 215 IAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTSINPDI 274

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRY 262
           ++ IF++ +  ++   ++ Y E EF+  S K+L I GF+I+   + CG AG  G +G +Y
Sbjct: 275 FVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGYIGGKY 334

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           W +PG +     + D    RF      LINA F++ GTEL  ++  E  NPRK+VP A K
Sbjct: 335 WHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAVPVAAK 389

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
             V+R+   Y+ +++ IG  VPYN P L  + +    SP+++A +  G K++PH  NAVI
Sbjct: 390 TSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHFINAVI 449

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442
           L ++IS ANS ++ G R+L  L++   APKFL+   + G P +A+ V + FG +A+  TS
Sbjct: 450 LLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIAFAATS 509

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
              D+VF WL  I G++  FAW  I +SHIRF  A+KY G S DE+ +KA      +YY 
Sbjct: 510 KKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIWGSYYG 569

Query: 503 ATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK------ 555
             F  +++I Q + A  AP   G   A ++   +L   +W+ F   + C  I+       
Sbjct: 570 LFFNLLVLIAQFWVALSAPGSGGQVTAISFFESYLAFVIWVFF---YLCYMIYNKDWTIL 626

Query: 556 --IGDVDIDSDRRDIEAIVWEDHEPKTF 581
             + D+D+D  RR  +A      + +++
Sbjct: 627 IPLKDIDVDYQRRIYDADFLRQEKEESY 654

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 183/508 (36%), Positives = 275/508 (54%), Gaps = 14/508 (2%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N+ +KR LK RH                     L  AGP G LI +   G++ Y +  ++
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKV 199
           GE+A   PV+  FT ++ RF+  +FG AN + Y   W +   LE+      + +W T   
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++F+V+I  +N+F VK YGE EF  + IKV+ +IGF+I    +VCG G  G   
Sbjct: 194 YRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 260 FR-YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
               W NPGA+      K     RF G  S  + AAF+F G+ELVG+ + E ANPRKS+P
Sbjct: 254 GGANWHNPGAFVGNTAGK-----RFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLP 308

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHI 377
           RA K+V +RI  FYI SL  IGLLVPYND +L  ++S   + SPF++AI+N G K LP +
Sbjct: 309 RAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSV 368

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VIL  ++S  NS ++  SR L  L++    PK      + G P + +  T+ FG L+
Sbjct: 369 VNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLS 428

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF+WLL ++G++  F W+ I I H+RF +AL  +G S DEL F +     
Sbjct: 429 FIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVW 488

Query: 498 LAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFI 553
            + Y    + +I+  Q + A  P     +   F  +Y+S+ + L ++I  +C  R  +  
Sbjct: 489 GSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLF 548

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            +  ++DID+ RR  DIEA+  E  E K
Sbjct: 549 IRAENIDIDTGRREVDIEALKVELAEEK 576

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/495 (32%), Positives = 261/495 (52%), Gaps = 20/495 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +KR LK RH                     L   GP   +++++  GS+ YSV Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA- 202
              +PV+ S+  +  RF+ P+FG A  Y Y     +T  LE+      + +W      A 
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV--TGPVGF 260
            ++++F+V + ++N   VK YGE EF  + IKVLAI+GF+I    +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320
           +YW NPG +  G          F G+ +  + +AF+F G+E+  + A E+ NPR+ +P+A
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
            K+V +RI  FY+ SL  IG LVPY +  L   S+   S SPF+IAI+ +G   LP + N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
            VIL  ++S  N+ ++  SR    L+     PK  +   + G P   + ++  FG L+++
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
            +S     VFEW+L ++G+  FF W  I + H+RF Q L+ +G S DEL FKA+     +
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RFIW 554
            Y  T +++++  Q + A  P     S A  +   +L L V I+F    +      R + 
Sbjct: 494 IYGITLISVVLCFQFWVALFPLSKSPS-AYHFFEQYLSLPVVIVFYMGHKVYSRNWRLVI 552

Query: 555 KIGDVDIDSDRRDIE 569
              ++D+D+ RR+++
Sbjct: 553 PAKELDLDTGRREVD 567

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  278 bits (712), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 166/518 (32%), Positives = 267/518 (51%), Gaps = 29/518 (5%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V + ++K+ +K RH                     L  AGP   +I+Y  +  + Y + Q
Sbjct: 70  VTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQ 129

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GEMA   P +  +F  +   F+S  FG A  ++++  W     LEL      +Q+W  
Sbjct: 130 AAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWND 189

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTG 256
            +    ++ IF+V +  ++ F VK YGE EF     K+L + GF+I+   + V GAG +G
Sbjct: 190 SINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSG 249

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW +PGA+     + D N GRF G    L+ A F++ G EL  ++  E  NPR+S
Sbjct: 250 YIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRS 304

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLP 375
            P A K+ ++RI+  Y+ +++ +G  VP N  +L  S   V+  SP+++A    G KV+P
Sbjct: 305 TPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVP 364

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           HI NAVIL ++IS  NS +Y   R++  L++   APKF+    + G P  A+ V + FG 
Sbjct: 365 HIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGV 424

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           + ++  S+  ++VF WL  I G+A  F W  I ISHIRF QA+K +  S DE+ +K+   
Sbjct: 425 IGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFG 484

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
              +Y+   F  ++ + Q + A AP    + +  +F  +Y++  +F A +  +       
Sbjct: 485 VYGSYFGVFFNLLVFVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYM------ 538

Query: 552 FIWK--------IGDVDIDSDRR--DIEAIVWEDHEPK 579
            IWK        +  VD+D  RR  D E +  ED E K
Sbjct: 539 -IWKRDFTLFSDLESVDLDYHRRIYDPELVKQEDEEKK 575

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  279 bits (714), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 270/511 (52%), Gaps = 20/511 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           ++  E+KR++ QRH                     L +AGP G LI Y  MG+  Y V Q
Sbjct: 112 IKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQ 171

Query: 139 SLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GE+  T+  +   F  +    ++P+F  + G++Y   W     LEL      I++WT 
Sbjct: 172 AAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTT 231

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           KV    ++ IF+++I ++N F  K Y E +F+   +K+  I GF I    + CG AG  G
Sbjct: 232 KVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDG 291

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW NPGA+       +K    F G  S  + +AF F G+E V ++A E ANPRKS
Sbjct: 292 YLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKS 346

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPH 376
           +P A K +++RI+  Y+ S+  +G LVP++ P+L  S+    TSP+++AI   G KV+PH
Sbjct: 347 IPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPH 406

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           + NAVIL  ++S +NS  +  SR+L  LS+   APK+     + G P  A+ ++A FG +
Sbjct: 407 LINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVI 466

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            +  TS     VF WLL I+G++  F +  I +SHIR   A+K +G S  EL F++++  
Sbjct: 467 CFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGT 526

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI 556
             ++YA   + + ++ + + A AP   G   A ++   +L   + I+F   +    IWK 
Sbjct: 527 YGSFYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVF---YFGYMIWKK 583

Query: 557 G--------DVDIDSDRR--DIEAIVWEDHE 577
                    D+D+D  R+  D + I  ED E
Sbjct: 584 DFRIFIRSKDIDLDFKRQVFDEDLIKQEDEE 614

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  278 bits (712), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 182/524 (34%), Positives = 272/524 (51%), Gaps = 23/524 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           +A +K  LK RH                     L  AGP G LI +   G++ Y +  ++
Sbjct: 78  HAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAM 137

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKV 199
           GE++   P++  FT ++ RF+  +FG AN + Y   W     LE+      + +W T   
Sbjct: 138 GELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPK 197

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++FWV+I I+NLF VK YGE EF  + IKVL +IGF+I    + CG G  G   
Sbjct: 198 YRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYI 257

Query: 260 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             +Y+ +PGA+       D    RF G  S  + AAF+F G+EL+GI A E+A PRKSVP
Sbjct: 258 GGKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVP 312

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHI 377
           +A K+V +RI  FY+ SLL +GLLVPY D +L  ++S   + SPF+IAI + G + LP +
Sbjct: 313 KAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSV 372

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VIL  ++S  NS +Y  SR L  L++    PK      + G P   +  T+AFG +A
Sbjct: 373 VNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVA 432

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF WLL ++G++  F W  I   HIRF  AL  +G S DELPFKA     
Sbjct: 433 FVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGIY 492

Query: 498 LAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFI 553
            + +    + ++ + Q + A  P   K +   F  +Y+S  + LA +   +   R  + +
Sbjct: 493 GSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKLL 552

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHEPKTF---------WDKFW 586
             +  +DID+ RR  D++ +  E  E K           W  FW
Sbjct: 553 IPLSKLDIDTGRREMDLDVLRQEIAEEKQMMSTRPWWYRWYSFW 596

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 180/539 (33%), Positives = 276/539 (51%), Gaps = 16/539 (2%)

Query: 51  PLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
           P R F      EDT S                ++++ ++ RH                  
Sbjct: 31  PFRRFVDSFRREDT-SRSGDLEDGEINSTDTTKLQQRMRTRHVVMMSLGTGIGTGLLVAN 89

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAAN 169
              L   GP G LI YL +  ++Y +  + GEMA   P +  +F  +S  F+S  FG A 
Sbjct: 90  AASLHYGGPAGLLIGYLLVSIVSYIMMHAAGEMAVAYPTLPGNFNAYSSIFISKPFGFAT 149

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFW 229
            +++   W   F LEL     VI++W   V    ++ IF++ I  ++ F  + YGE EF 
Sbjct: 150 VWLFCLQWLTVFPLELITATIVIKYWKVSVNANVFVVIFYLFIICIHFFGARGYGETEFI 209

Query: 230 VASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVS 288
               KVL I+GF+I    +  GA G TG +G RYWRNPG++  G    DK +G       
Sbjct: 210 FNMCKVLMIVGFVIVGILINVGAIGDTGYIGDRYWRNPGSFVSGT-PLDKLKGT----AY 264

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP 348
            L+ A F+F G EL  ++  E  NP+ ++P A KK V+RIL  Y+ +++ IG LVP++  
Sbjct: 265 VLVTAYFSFGGMELYALSVNELPNPKTAIPSACKKGVYRILLVYLLTMIMIGFLVPHDSD 324

Query: 349 KLTQSTSY-VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           +L  S S  V  SP+++AIE  G KVLPHI NAVIL ++IS  NS +Y   R+L  L++ 
Sbjct: 325 RLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVNAVILISVISVGNSAMYSAPRLLCALAQQ 384

Query: 408 KLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             APK L    + G P I++ + A FG +A+   S   +K+F WL  I G++  F W  I
Sbjct: 385 GYAPKQLDYIDREGRPLISLILCAIFGLIAFSAASDNQEKIFIWLAAIAGLSELFTWTSI 444

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFN 523
            +SH RF QA+K +G S + L ++A      + YA  F  ++ I Q + A  P    K +
Sbjct: 445 CLSHFRFRQAMKLQGRSLETLGYRAITGQWGSLYAVFFNLLVFIAQFWVALVPIAKKKVD 504

Query: 524 GVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            +SF   Y++  L+L +++ +    R    +  +  +D+D+ RR  D+E +  E++E K
Sbjct: 505 VLSFFQNYMAFPLWLIMFLGYMVYSRNWTLLNPLDKMDLDTHRRVYDVEVLKQEEYEFK 563

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  278 bits (711), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 173/518 (33%), Positives = 270/518 (52%), Gaps = 30/518 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           + A +KR++K RH                     L   GP G  I Y  MGS  YS+ Q+
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A   P +T +F  +    + PA   A   +Y   W   F LE+      I++W   
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    W  IF+V+I  +N+     Y E +F+  + K+L   GF I    + CG AG +  
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+     + D    RF   VS+L+ AAF F  +E V +TA E ANPRK++
Sbjct: 278 IGGKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAI 332

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPH 376
           P A K+V++RI+  Y+ S++ +G LVPYN P+L    +S V +SP++IA+ + G KV+P 
Sbjct: 333 PSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS 392

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  N + Y  SRIL  LS+   APKF     + G P  A+ V A  G +
Sbjct: 393 FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCI 452

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S+  + VF WL+ ++G++  F W  I ISH+RF +A++ +  S  EL F++++  
Sbjct: 453 CFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGV 512

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
             +YY    M ++ I Q + A  P       +  +F A Y+++ +FLA++  F+      
Sbjct: 513 WGSYYGIFMMILVFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFK------ 566

Query: 552 FIWK--------IGDVDIDSDRR--DIEAIVWEDHEPK 579
            IWK          ++D+ S R+  D E +  ED E K
Sbjct: 567 -IWKKDWRLYIPASEIDLISHRKIFDEEILKQEDEEYK 603

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  276 bits (706), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 168/488 (34%), Positives = 268/488 (54%), Gaps = 19/488 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            + R L  RH                     L   GP    I+Y  MG + Y     LGE
Sbjct: 56  SLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGE 115

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW---TYKV 199
           M+TF+P++ SF  ++++F   +F  A    YWF+ A++ A +L+ +  V+ +W    +  
Sbjct: 116 MSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNF 175

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  A   +FWV +  +N+  V+ YGE E+W+A +KV+AI+ F I    +  G       +
Sbjct: 176 PYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYI 235

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF+YW    A  P +         F G+V+  +++AF++ GTE + +TAGEA NP ++ P
Sbjct: 236 GFKYWSYKEA--PFV-------NGFKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTP 286

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           R +K V +RIL FY+ ++ FI + +PY+ P L  ST  V TSPF I  + +GTK      
Sbjct: 287 RIVKTVFWRILIFYVATMFFISMNIPYDYPNL--STKSVMTSPFTIIFQMAGTKAAGSFM 344

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLA-PKFLSRTTKGGVPYIAVFVTAAFGALA 437
           NAVILT+I+SA N  ++ GSR+L+ +       PK +++T +   PY+AV +T A G L 
Sbjct: 345 NAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLC 404

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           +  +  G   ++ WL NI GV+   AWL I+++ IRF + L  +G ++ EL FK    P 
Sbjct: 405 FGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-ELQFKNWTYPY 463

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
             Y+   F+T+II++QG++AF P ++   F + Y+ +F+F   W+++    R RF+ K  
Sbjct: 464 GPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYLELFVFPTCWLIWWIFKRDRFV-KPE 521

Query: 558 DVDIDSDR 565
           D+D  +DR
Sbjct: 522 DMDFITDR 529

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  278 bits (711), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 158/444 (35%), Positives = 252/444 (56%), Gaps = 8/444 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N+++K+ +K+RH                     L +AGP G +I Y  MGS  Y + Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+A  +  + S+F ++    +  AFG A  ++Y   W     LEL      I++WT  
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++SIF+V+I ++N F  + Y E EF+  S KVL + GF I    + CG AG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+     + ++    F G +++   AAF F  +E + +TA E +NPRK++
Sbjct: 293 IGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376
           P+A K +++RIL  ++ S+  IG LVPYN P L  S S  +  SP+++A+ + G +V+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  NS  Y  SR+L  L++   APK  +   K G P +A+  +  F  +
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   ++VF WLL I+G++  F W+ I ISH+RF +ALK +G S  E+ FK+++  
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP 520
             + YAAT + + +I Q + A AP
Sbjct: 528 YGSLYAATMLILALIAQFWVALAP 551

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  275 bits (702), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 171/495 (34%), Positives = 258/495 (52%), Gaps = 21/495 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  VKR LK RH                     L   GP+  L+ ++ +G +A++V +S+
Sbjct: 29  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESI 88

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GEM T  P    FT  ++RF S A  A  GY Y   +    A E + +  ++QFW  +VP
Sbjct: 89  GEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVP 148

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-G 259
           L A+  IFW++  I  L  V  +GE E+W++ +K+L +I + I+    + G     P  G
Sbjct: 149 LYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFG 208

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           F YW++PG+   G          F G     +  +  + GTE V +TA E+ NP KSVP 
Sbjct: 209 FHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPY 258

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           A+++ ++RI+  YIG  +F G  VP+NDP L+ +T  V  SP  IAI  +G     H+ N
Sbjct: 259 AVRQTLWRIVVVYIGIAIFYGSTVPFNDPNLSVNTK-VLKSPIAIAISRAGWAGGSHLVN 317

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A IL + ISA N ++Y+GSR L  L+   LAPKFL+ T K GVP  A+ +  A G ++ M
Sbjct: 318 AFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLM 377

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S G    + +++N++GV  F  W  IS +H+R  +A   +G   +ELP+KA   P   
Sbjct: 378 NMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTP 437

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYI----SIFLFLAVWILFQCIFRCRFIWK 555
            ++      + +IQG+T+  P F    F  AYI    +I L++ V +     FR   I  
Sbjct: 438 IFSLISNIFLALIQGWTSLVP-FKAPEFVDAYILLPAAIILYVGVCVFKNHNFR---IVD 493

Query: 556 IGDVDIDSDRR-DIE 569
           +  V++D  RR D+E
Sbjct: 494 LTSVNLDEGRRKDME 508

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  277 bits (708), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 171/511 (33%), Positives = 272/511 (53%), Gaps = 21/511 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +  ++K+ +  RH                     L N GP G  I Y  MGS  Y + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA ++  ++ +F  +    + PA G +  ++Y   W     LEL      I++WT  
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++ IF+V+  ++NLF  + Y E EF+  + KVL I GF I    + CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA     +   K    F G +++++ AAF F  TE + +TA E ANPR+++
Sbjct: 255 LGGKYWHDPGA-----LYGTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAI 309

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A KK+V+R+L  ++  ++ +G LVPYN  +L  S  S    SP++IAI + G KV+PH
Sbjct: 310 PSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPH 369

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S  NS  Y  SR+L  LS+   AP +L+   + G P  A+ V+  FG +
Sbjct: 370 FINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLI 429

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S   + VF WLL I+G++  F W+ I +SHIRF +AL  +G S  EL +K++   
Sbjct: 430 AFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTGV 489

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
             +YYA   M  ++  Q + A AP    K +  +F   Y+++ + +A++  ++   R   
Sbjct: 490 VGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKR--- 546

Query: 553 IWK----IGDVDIDSDRR--DIEAIVWEDHE 577
            WK    +  +D+ S R+  D + +  ED E
Sbjct: 547 DWKLYIPLEQIDLVSHRKVFDEDLLKQEDAE 577

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  278 bits (711), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/495 (32%), Positives = 262/495 (52%), Gaps = 13/495 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ ++L  RH                     L   GP   +I ++ + +  ++V  SLGE
Sbjct: 140 DMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGE 199

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           +A   PV   F+V+  +F+ P+F  A    Y   W +   LEL      I++W   +   
Sbjct: 200 LAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
           AW+SIF+V I + N+  VK +GE EF ++ +K+LAIIGF I    + CG G +   +G +
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA+  G  S  K    F G  S  + AAF+F G E+  ++A E+ NPR+++P+A 
Sbjct: 320 YWHDPGAF-VGTTSGSK----FKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAA 374

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHIFN 379
           K+  + I   Y+  L  +G LVPYNDP+L   +S V  ++SP +IAIEN     LP + N
Sbjct: 375 KRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMN 434

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+IL  I+S ANS++Y  SR +  +SK +  PK  ++  + G P  A+     FG L+++
Sbjct: 435 AIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFV 494

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S    +VF WL  ++G++  F W+ I++ HIRF Q +  + IS DELPF ++     +
Sbjct: 495 AASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGS 554

Query: 500 YYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIW 554
            Y    + ++++   +T+  P    K N  SF   Y+S  + L  +I  +  F+  R+  
Sbjct: 555 IYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYI 614

Query: 555 KIGDVDIDSDRRDIE 569
               +D+ S R+ ++
Sbjct: 615 PASKMDLHSGRKQVD 629

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 185/511 (36%), Positives = 269/511 (52%), Gaps = 21/511 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           NA +KR LK RH                     L  AGP G LI +   G++ Y +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+A   PV   +T ++ RF+  +FG A   +Y   W IT  LE+      + +W     
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 201 LA-AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
              A++++F+V+I  +NLF VK YGE EF  + IKV+A+IGF+I    +VCG G  G   
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 260 F-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             R W NPGA+  G          F G  S  + AAF+F G+ELVG+ A E ANPRKS+P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIP 302

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLT-QSTSYVSTSPFIIAIENSGTKVLPHI 377
            A K+V +RI  FYI +LL +GLLVPY   +L  QS+   + SPF+I+I+N+G K LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            N VIL  ++S  N  ++  SR +  L+     PK      + G P + + VT  FG L+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF+WLL ++G++  F W  I + HIR  +AL  +  +  EL F A     
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RF 552
            + Y+   + +I+I Q + A  P   G   AAA+   +L   ++I+F    +      + 
Sbjct: 483 GSVYSLILIILILIAQFWIALFP-IGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKL 541

Query: 553 IWKIGDVDIDSDRR--DIEAIVWEDHEPKTF 581
             K  D+DIDS RR  DIEA+  E  E K F
Sbjct: 542 FIKASDIDIDSGRRETDIEALKQEIAEEKAF 572

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  276 bits (706), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 165/511 (32%), Positives = 271/511 (53%), Gaps = 17/511 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           + E K+ +K RH                     L+ AGP   +I+Y  +  + Y + Q+ 
Sbjct: 90  HQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAA 149

Query: 141 GEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GEMA   P +  SF  ++  F+S  FG A  +++   W     LEL      I++W   +
Sbjct: 150 GEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITAAMTIKYWNTSI 209

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPV 258
               ++ IF+V +  ++ F V+ YGE EF   + K+L I GF+I+   + CG AG  G +
Sbjct: 210 DPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYI 269

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PGA+     +      RF G   +L+NA F++ G EL  ++  +  NPRKS P
Sbjct: 270 GGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTP 324

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST--SYVSTSPFIIAIENSGTKVLPH 376
            A K  V+RI+  Y+ +++ IG +VP+N  +L  ++  + +  SP+++A    G KV+PH
Sbjct: 325 AAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLAASIHGIKVVPH 384

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL  +IS ANS++Y G R+L  L++   AP+FLS   + G P  A+ ++A  G +
Sbjct: 385 IINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVI 444

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            +  TS   ++VF WL  I+G++  F W  I  SHIRF +A+K +  S D L +KA    
Sbjct: 445 GFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGL 504

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
             +Y+   F  ++   Q + A +P     K +  SF A+Y+++ ++L  +  + C ++  
Sbjct: 505 WGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDF 564

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
             +  +  VD+D+ R+  D E +  ED E K
Sbjct: 565 TVLTDLNQVDLDNHRKVYDPEFLRQEDLENK 595

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  276 bits (705), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 163/524 (31%), Positives = 277/524 (52%), Gaps = 21/524 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  + ++L  RH                     L + GP   +I ++ + +  ++V  +L
Sbjct: 89  NENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 148

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+A   PV   F V+  RF+ P+   A    Y   W +   LEL      I++W   + 
Sbjct: 149 GELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTIN 208

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF 260
             AW++IF+ +I + N+  VK +GE EF ++ +K+LAIIGF I    + CG G  G    
Sbjct: 209 SDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLG 268

Query: 261 -RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
             YW +PG++       DK   +F G  S  + AAF++ G EL  ++A E+ +PRK++P+
Sbjct: 269 GHYWHDPGSF-----VGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPK 323

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHI 377
           A K+  + +   Y+  L  IG LVP++DP+L   +S V  + SP +I+I+N+G K L  +
Sbjct: 324 ATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSL 383

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NA+IL +I+S ANS +Y  SR +  ++     PK LSR  K G P  A+  T  FG L+
Sbjct: 384 MNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLS 443

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S    +VF WL  ++G++  F W+ I+ SHIRF  A+K +  + DELP+ ++    
Sbjct: 444 FIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPYLSQCGVI 503

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNG----VSFAAAYISIFLFLAVWILFQCIFR-CRF 552
            ++Y    + ++++   +T+  P  +G     SF   Y+S+ + +A ++  +   R  + 
Sbjct: 504 GSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPILIACYVGHKLYVRNLQV 563

Query: 553 IWKIGDVDIDSDRRDIEA------IVWEDH--EPKTFWDKFWNV 588
           + K+ D+D+++ R+ I+A      I+ E      K+F  +FW+V
Sbjct: 564 LVKLEDMDLETGRKHIDAHEHRAEILAEKAALSQKSFIKRFWHV 607

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  276 bits (705), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 271/514 (52%), Gaps = 22/514 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ +K RH                     L  AGP   +I Y+ +  + Y + Q+
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQA 141

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEM    P +  +F  ++  F+S +FG A  +++   W     LEL      I++W   
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDT 201

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I+IF+V +  ++ F VK YGE EF   S K+L I GF+I    + CG AGV G 
Sbjct: 202 INADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGY 261

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YWRNPG++  G      +  RF G    L+ A F+F G EL  ++  E ANPRKS 
Sbjct: 262 IGGEYWRNPGSFADG-----SSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKST 316

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RIL  Y+ +++ IG  VP+++ +L  S +S    SP+++A    G KV+PH
Sbjct: 317 PVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPH 376

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS ANS +Y   R++  L++   APKFL+   + G P  A+ V +  G +
Sbjct: 377 IINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLV 436

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S+  ++ F WL  I G++  F W  I +SHIRF +A+K +G S DE+ +K+    
Sbjct: 437 GFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGI 496

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYIS----IFLFLAVWILFQCI 547
             +YY   F  ++ + Q + A +P     K +  SF  +Y++    IF++L  ++++   
Sbjct: 497 WGSYYGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLG-YMIYNKD 555

Query: 548 FRCRFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           F    +  +  +D+D  RR  D E +  ED E K
Sbjct: 556 F--TLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  274 bits (700), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 257/496 (51%), Gaps = 21/496 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  VKR LK RH                     L   GP+  L+ +  +G +A++V +S+
Sbjct: 46  NTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESI 105

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+ T  P    FT  ++RF   A  A  GY Y   +    A E + +  ++QFW  +VP
Sbjct: 106 GEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 165

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-G 259
           L  +I IFW    I  L  V  +GE E+W++  K++ ++ + I+    + G     P  G
Sbjct: 166 LYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFG 225

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           F YW +PG+   G          F G     +  +  + GTE V + A E+ NP K+VP 
Sbjct: 226 FHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAATESKNPGKAVPL 275

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           A+++ ++R+L  YIG  +F G  VP++DP L+ +T  V  SP  IAI  +G     H+ N
Sbjct: 276 AVRQTLWRVLIVYIGIAVFYGATVPFDDPNLSATTK-VLKSPISIAISRAGWAGGAHLVN 334

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A IL T ISA N ++Y+GSR L  L+   LAPK L+ T + GVP  A+ V  A G ++ M
Sbjct: 335 AFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLM 394

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S G    + +++N++GV  F  W  IS +H+R  +A   +G S +ELP+KA L P   
Sbjct: 395 NVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPWTP 454

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYI----SIFLFLAVWILFQCIFRCRFIWK 555
            ++      + +IQG+T+F P F+  +F  AYI    +I L++A+ +     FR   I  
Sbjct: 455 IFSLIANVFLALIQGWTSFVP-FDAGNFVDAYILLPVAIVLYVAICVFKNHHFR---IVD 510

Query: 556 IGDVDIDSDRR-DIEA 570
           +  VD+D  RR DI+A
Sbjct: 511 LKSVDLDEGRRKDIDA 526

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  274 bits (700), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 168/512 (32%), Positives = 265/512 (51%), Gaps = 27/512 (5%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           ++++K+ +K RH                     L  AGP G +I Y    ++ Y + Q+ 
Sbjct: 61  SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAA 120

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GE+   +  +T ++T +S   + PA G +  ++Y   W   F L+L      I++WT   
Sbjct: 121 GELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTDTN 180

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPV 258
           P   +++I + +I  +NLF  K Y E EF   + KVL ++GF+I    + CG AG  G +
Sbjct: 181 P-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G RYW  PGA+  G          F G       AAF + G E++ +TA E  NPRKS+P
Sbjct: 240 GARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            A KKV++RIL  Y+ + L +  LVPY+ P+LT + S    SPF+IAI + G  V+PHI 
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIAIASHGISVVPHII 349

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL  ++S  NS++Y   R+L  LS+   APK  +   + G P +   V    G LA+
Sbjct: 350 NAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAF 409

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S   + VF WLL I+G++  F W+ I +SH+RF  A+K +G S  E+ +K++     
Sbjct: 410 IAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWG 469

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNG---------VSFAAAYISIFLFLAVWILFQCIFR 549
           +++A      +++ Q + A AP  NG          S+ AA + IF++    I ++    
Sbjct: 470 SWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYK---D 526

Query: 550 CRFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            R      +VD++S R+  D + +  ED + K
Sbjct: 527 WRLCIPATEVDLNSHRKIFDEDELKQEDLDWK 558

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  275 bits (702), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 186/511 (36%), Positives = 281/511 (54%), Gaps = 20/511 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            + ++ +LK RH                     L  AGP G LI +   G++ +++  +L
Sbjct: 85  RSPLQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMAL 144

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+A   PV+  F  ++ RF+  +FG AN + Y F W +   LE+      + +W   V 
Sbjct: 145 GELAVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVR 204

Query: 201 LA-AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVG 259
               ++++FW+++ I+N+F V+ YGE EF  + IKV+A+IGF+I    +VCG G  G   
Sbjct: 205 YTDGFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYV 264

Query: 260 F-RYWRNPGAWG---PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
             RYW +PGA+    PG         RF G+ S  + AAF+F G+ELVGI + E+ NPRK
Sbjct: 265 GGRYWHDPGAFAGHSPG--------RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRK 316

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVL 374
           SVP+A K+V +RIL FYI  LL +GLLVPY DP+L  S+    S SPF+IAI   G   L
Sbjct: 317 SVPQAAKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGL 376

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           P + N VIL +++S  NS+IY  SR L  LS+    PK ++   + G P + + + + FG
Sbjct: 377 PSVVNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFG 436

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            +A++  S   +++F WLL I+G++ F  W  I   HIRF  ALK  G S DELPFK+ +
Sbjct: 437 LIAFVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPV 496

Query: 495 MPGLAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
               +Y+      ++++ Q + A  P     N   F +AY++  + LA +I  +   R  
Sbjct: 497 GIIGSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNW 556

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           + +  + D+DID+ RR  DI  +  E  E K
Sbjct: 557 KLLIPLKDIDIDTGRRETDINLLKQEIAEEK 587

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  273 bits (699), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 257/503 (51%), Gaps = 34/503 (6%)

Query: 43  DEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXX 102
           D K+ E    +S    +N EDTF               ++ VKR+LK RH          
Sbjct: 32  DPKNNEYAEEQS----LNREDTFD-------------PDSGVKRQLKDRHISLLALGGII 74

Query: 103 XXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLS 162
                      L   GP+  L+ +  +G LA+ + +S+GEM T  P    FT  ++RF S
Sbjct: 75  GPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHS 134

Query: 163 PAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKY 222
            A  A  GY Y   +    A E + +  ++QFW  +VPL  +I IFW    +  L  V  
Sbjct: 135 DALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVPLYGYILIFWAAFQVFQLLGVGA 194

Query: 223 YGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKDKNEG 281
           +GE E+W+A  K+L ++ + I+    + G     P  GF+YW +PGA   G         
Sbjct: 195 FGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGALSNG--------- 245

Query: 282 RFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGL 341
            F G  +  +  +  + GTE V + A E+ NPR++VP AI++  +RIL  Y+G  +F G+
Sbjct: 246 -FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFYGV 304

Query: 342 LVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRIL 401
            VPYND  L  +T  V  SP  IAI  +G     H+ NA IL T ISA N ++Y+GSR L
Sbjct: 305 TVPYNDENLNFATK-VLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYIGSRTL 363

Query: 402 FGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGF 461
             L+   LAPK L+ T + GVP  A+ V  A G ++ M  S      + +++N++GV  F
Sbjct: 364 THLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLSGVGVF 423

Query: 462 FAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPK 521
             W  IS++H+RF +A K +G +RDELP+KAKL P     +      + ++QG++ F P 
Sbjct: 424 IVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWSYFKP- 482

Query: 522 FNGVSFAAAYI----SIFLFLAV 540
           F+  +F  AYI     I L+L V
Sbjct: 483 FDAKNFVDAYILIPAGIILYLGV 505

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  275 bits (702), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 192/602 (31%), Positives = 300/602 (49%), Gaps = 33/602 (5%)

Query: 3   NSKEDADIEE---KHMYNEPVTTLFHDVE--ASQTHHRRGSIPLKDEKSKELYPLRSF-- 55
           +S E +D+++   K+ Y   + T  ++VE  ++  + + GS  + +  +K+   LR F  
Sbjct: 17  DSYELSDVKKPDGKNSYISDLETNDNEVEYISTDLNDKYGSSSINESPAKKKSNLRRFVD 76

Query: 56  -----PTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXX 110
                   +  +D  +                 +K+ +K RH                  
Sbjct: 77  SFKRAEHMIPADDKINEMTTAEPEAEMASVEDNLKQTIKPRHVIMISLGTGIGTGLLVGN 136

Query: 111 XXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAAN 169
              L  AGP G +  Y  MG+  Y + QS GEMA  +  +   F  +    + P F    
Sbjct: 137 GSALVKAGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCC 196

Query: 170 GYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFW 229
                F+     +  +       ++WT +V    ++ IF+V+I ++N+F  + Y E EF+
Sbjct: 197 RLGVLFTMVDCLSFGIGYCFDDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFF 256

Query: 230 VASIKVLAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVS 288
               KVL + GF I    + V GAG  G +G  YWRNPGA+       DK    F G V+
Sbjct: 257 FNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVA 311

Query: 289 SLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDP 348
           +L+ AAF F GTE + +TA E +NPRK++P A KKV++RI+  Y+ S++ IG LVP+  P
Sbjct: 312 TLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSP 371

Query: 349 KLTQSTSYVST-SPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKN 407
           +L  S S  +  SP++IA+ + G +V+PH  NAVIL +++S  NS  Y  SR+L  LSK 
Sbjct: 372 ELLGSGSAATAASPYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQ 431

Query: 408 KLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFI 467
             APK+     + G P  A+ V+A FG +A+  TS    +VF WLL I+G++  F W+ I
Sbjct: 432 GYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISI 491

Query: 468 SISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSF 527
            +SHIRF  A+K +G S  E+ FKA+     +YY+   M + +I Q + A AP       
Sbjct: 492 CLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAPIGTAELS 551

Query: 528 AAAYISIFLFLAVWILFQCIFRCRFIWKIG--------DVDIDSDRR--DIEAIVWEDHE 577
           A  +   +L + + I F   ++   IWK          D+D+ S R+  D E +  ED+E
Sbjct: 552 ARNFFENYLAMPILIGFYFGYK---IWKKDWTLYIKAEDIDLISHRQIFDEELLKQEDYE 608

Query: 578 PK 579
            K
Sbjct: 609 LK 610

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 171/516 (33%), Positives = 266/516 (51%), Gaps = 21/516 (4%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           + +  ++R ++ RH                     L   GP G +I Y  +  +AY + Q
Sbjct: 74  LTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYIMMQ 133

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GEMA   P +  +F  +S  F+S  FG A+ ++Y   W   F LEL      I++WT 
Sbjct: 134 AAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKYWTD 193

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
            V    +I+IF+V I  ++ F  + YGE EF     KVL I GF+I    + CG AG +G
Sbjct: 194 SVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAGNSG 253

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G RYW +PGA+  G         +F G+   L+   F++ GTEL  +T  E ++PR++
Sbjct: 254 YIGARYWHDPGAFAVG-----DPASKFKGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRA 308

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS--TSYVSTSPFIIAIENSGTKVL 374
           +  A K+ ++RIL  Y+ +++ IG LVP+   +L  S   S    SP+++A+   G KV+
Sbjct: 309 IHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGVKVV 368

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           PHI NAVIL  ++S  NS +Y G R+L  L++   APKFL+   + G P +A+   +  G
Sbjct: 369 PHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACSVIG 428

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            LA++  S   + VF WL  I G++  F W  I +SHIRF QA+KY G S  +L +K+  
Sbjct: 429 LLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYKS-- 486

Query: 495 MPGL--AYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
           + GL  + Y   F  ++ + Q + A AP   NG +   ++   +L   +W +F   +   
Sbjct: 487 ITGLWGSIYGVCFNILVFVAQFWVALAPIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMVY 546

Query: 551 ----RFIWKIGDVDIDSDR--RDIEAIVWEDHEPKT 580
                 +  + D+DI+  R   D E I  E  E KT
Sbjct: 547 SGEWMILRPLKDIDINHFRCVYDEERIEQEKLEHKT 582

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  274 bits (700), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 167/511 (32%), Positives = 263/511 (51%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ +K RH                     L+ AGP   +I Y+ +  + Y + Q+
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQA 141

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEM    P +  +F  ++  F+S +FG A  +++   W     LEL      +++W   
Sbjct: 142 AGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDT 201

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF   S K+L + GF+I    + CG AGV G 
Sbjct: 202 INADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PG++  G         RF G    L++A F+F G EL  ++  E +NPRKS 
Sbjct: 262 IGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKST 316

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  S  S    SP+++A      +V+PH
Sbjct: 317 PVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPH 376

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS ANS +Y   R++  L++   APKFL+   + G P  A+ V +  G +
Sbjct: 377 IINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVV 436

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S   ++ F WL  I G++  F W  I +SHIRF +A+K +G S DE+ +KA    
Sbjct: 437 GFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGI 496

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILFQCIFRC----- 550
             +YY   F  ++ + Q + A +P  NG    A A+   +L   +WI     +       
Sbjct: 497 WGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGYMVYKRDF 556

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            F+  +  +D+D  RR  D E +  ED E K
Sbjct: 557 TFLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  273 bits (699), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 166/511 (32%), Positives = 269/511 (52%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            + ++K+ +K RH                     L   GP G LI Y F+  ++Y + Q+
Sbjct: 67  HSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQA 126

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P +  +F  +S  F+S  FG A  +++   W     LEL     V+++WT K
Sbjct: 127 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTK 186

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGP 257
           +    ++ IF++ I  ++    + YGE EF   S KVL + GF+I    + CGA G  G 
Sbjct: 187 INADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGY 246

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW  PGA+  G         RF G    L+ A F++ G EL  ++  E  NPRK++
Sbjct: 247 IGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAI 301

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS-TSYVSTSPFIIAIENSGTKVLPH 376
           P A  K V+RIL  Y+ +++ IG LVP++  KL  S +S V  SP+++A+   G K++PH
Sbjct: 302 PSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPH 361

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS  NS +Y G R+L  L++   APK L    + G P +A+ + + FG +
Sbjct: 362 IINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLI 421

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A++  S   + +F WL  I+G++  F W  I +SH RF +A+K +G S + L +++    
Sbjct: 422 AFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGE 481

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAA-----AYISIFLFLAVWILFQCIFRCR 551
             + YA  F   ++I Q + A  P  NG  F+      + +++ L+L++ + +  + +  
Sbjct: 482 WGSLYAVVFNVFVLIAQLWVAMIPMDNGGKFSVKSLFKSCLALPLWLSMAVGYMIVTKNW 541

Query: 552 FIWK-IGDVDIDSDRR--DIEAIVWEDHEPK 579
            I   +  + +DS RR  D+E +  ED E K
Sbjct: 542 TILNPLSSISVDSHRRSYDVEVMKQEDLEYK 572

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  271 bits (694), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 173/503 (34%), Positives = 260/503 (51%), Gaps = 16/503 (3%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  VKR LK RH                     L+  GP+  L+ +  +G +A++V +S+
Sbjct: 41  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESI 100

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GEM T  P  S F+  S+RF S A  A +GY Y   +    A E + +  ++QFW  +VP
Sbjct: 101 GEMITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVP 160

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-G 259
           L  +I IF V   +  +  V  +GEFE+W+A  K++ +I + I+    + G     P  G
Sbjct: 161 LYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFG 220

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
           F YW NPGA   G          F G     +  +  + GTE V + A E+ NP K+VP 
Sbjct: 221 FHYWNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPI 270

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           AIK+  +RI+  Y+G  +F G  VPYND  L   T  +  SP  IAI  +G +   H+ N
Sbjct: 271 AIKQTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALK-SPIAIAITRAGWEGGVHLVN 329

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A IL T +SA N ++Y+GSR L  L+   LAPKFL  T K GVP  A+ +  A G ++ M
Sbjct: 330 AFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLM 389

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S G    + +++N++GV  F  W  IS++H+RF +A   +G S  ELP+K+ L P   
Sbjct: 390 NVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGP 449

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF-IWKIGD 558
            ++      + +IQG+T F P F+   F  AYI +   + ++I+   +    F +  +  
Sbjct: 450 IFSLAANIFLGLIQGWTTFVP-FSAKDFVDAYILLPAAVILYIVISLVKIGGFKLVDLRT 508

Query: 559 VDIDSDRR-DIEAI-VWEDHEPK 579
           VD++  RR D+++    ED E K
Sbjct: 509 VDLEEGRREDLDSDGTDEDSEGK 531

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  273 bits (697), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 163/507 (32%), Positives = 268/507 (52%), Gaps = 15/507 (2%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +  + + ++L  RH                     L   GP   +I +  + +  ++V  
Sbjct: 81  IHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVIN 140

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           SLGE+A   PV   F V+  RF+ P+F  +    Y   W +   LEL      I++W   
Sbjct: 141 SLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDT 200

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV 258
           +   AW++IF+ +I I NL  VK +GE EF ++ +K+LAIIGF I    + CG G  G  
Sbjct: 201 INSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGY 260

Query: 259 GF-RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
              +YW +PGA+       D    +F G  S  + AAF++ G E++ ++A E+ NPRK++
Sbjct: 261 IGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTI 315

Query: 318 PRAIKKVVFRILTF-YIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVL 374
           P A K+  F I+TF YI  L  +G LV YND +L   +S V  + SP +IAIEN G K L
Sbjct: 316 PTAAKRT-FWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGL 374

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           P + NA+IL  I+S ANS +Y  SR +  ++     PK LS   K G P  A+F T  FG
Sbjct: 375 PSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFG 434

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            L+++  S   ++VF WL  ++G++  F W+ I+I+HIRF QA+  +  S DE+P+ ++ 
Sbjct: 435 LLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQT 494

Query: 495 MPGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
               +YY    + +++I   +T+  P      +  +F   Y+S  + +A +I  +  F+ 
Sbjct: 495 GIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKN 554

Query: 551 -RFIWKIGDVDIDSDRRDIEAIVWEDH 576
            R +  + ++D+ + R++++  + ++ 
Sbjct: 555 WRIMTPLEEIDLLTGRKEVDIDILKEE 581

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  272 bits (696), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 168/510 (32%), Positives = 273/510 (53%), Gaps = 23/510 (4%)

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
           A + R LK RH                     L  AGP G LI +    ++   +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 142 EMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT----Y 197
           E+A   PV+  +  ++ RF+  ++G AN + Y     +   LE+      + +W     Y
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
           K+   A++++FWV+I  +NLF V+ +GE E   + IKV+ IIGF+I    ++ G G    
Sbjct: 201 KL---AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHE 257

Query: 258 V-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
           V G +YW +PG +  G    DK    F G  S  + AAF+F G+EL+G+ A E   PRKS
Sbjct: 258 VIGGKYWNDPGPF-VGNAPSDK----FKGVCSVFVTAAFSFAGSELIGLAAAETREPRKS 312

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLP 375
           +P+A K+V +RI  FYI SLL +GLLVP N+  L        + SPF+IA++    +VLP
Sbjct: 313 IPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLP 372

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
            I N VILT +IS  NS++Y  SR +  L+++   PK      + G P  A+  T+ FG 
Sbjct: 373 SIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGL 432

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           L ++  +    ++F+WLL I+G++ FF WL I+++H+RF  ALK +G + +EL F +   
Sbjct: 433 LCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTG 492

Query: 496 PGLAYYAATFMTIIIIIQGFTA-FAPKFNGVS-------FAAAYISIFLFLAVWILFQCI 547
              + YA   + ++++ Q + A + P  +G S       F   Y+S  + + +++  +  
Sbjct: 493 FIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIW 552

Query: 548 FRC-RFIWKIGDVDIDSDRRDIEAIVWEDH 576
            R  +F  K  ++DID+ RR+++  ++++ 
Sbjct: 553 SRNWKFFIKAKEMDIDTGRRELDLELFKEE 582

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  271 bits (694), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 157/493 (31%), Positives = 265/493 (53%), Gaps = 13/493 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            + ++L  RH                     L   GP   +I ++ + S  ++V  +LGE
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           +A   P+   F V+  RF+ P+F  A    Y   W ++  LEL      I++W  ++   
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGPVGFR 261
           AW++IF+V I ++N+  VK++ E EF ++ IK+LAI+GF I    + V G    G +G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA+       D    RF G  S  + AAF++ G E+  ++A E+ NPRK++P+A 
Sbjct: 257 YWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKAT 311

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHIFN 379
           K+  + I   YI  L  IG+LVPYND +L   +S V  S SP +IAIEN+G K LP + N
Sbjct: 312 KRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMN 371

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+IL  ++S ANS +YV SR++  ++     PK  S+  K G P  ++F T   G L+++
Sbjct: 372 AIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFI 431

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S   ++VF WL  I G++  F W+ I+++HIRF  ALK++  S DEL + ++     +
Sbjct: 432 AASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGS 491

Query: 500 YYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIW 554
           +Y    + +++I   + +  P      +  +F   Y+S  + +A +I  +   +  +++ 
Sbjct: 492 WYGVIILVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVI 551

Query: 555 KIGDVDIDSDRRD 567
            + ++DID  +++
Sbjct: 552 PLEEIDIDLGKKN 564

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  272 bits (695), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 167/524 (31%), Positives = 274/524 (52%), Gaps = 21/524 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           N  + ++L  RH                     L + GP   +I ++ + +  ++V  SL
Sbjct: 75  NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSL 134

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+A   PV   F V+  RF+ P+F  A    Y   W +   LEL      I++W   + 
Sbjct: 135 GELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTIN 194

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF 260
             AW++IF+ +IT+ N+  VK +GE EF ++ +K+LAIIGF I    + CG G  G    
Sbjct: 195 SDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLG 254

Query: 261 -RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
            +YW NPGA+         +  +F G  S  + AAF++ G E+  ++A E+ +PRK++P+
Sbjct: 255 GKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPK 309

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYV--STSPFIIAIENSGTKVLPHI 377
           A K+  + I   Y+  L  +G LVPY+DP+L   TS V  + SP +IAIEN G K L  +
Sbjct: 310 AAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSL 369

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NA+IL +IIS ANS +Y  SR +  ++     PK L +  K G P  A  VT  FG L+
Sbjct: 370 MNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLS 429

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S   ++VF WL  ++G++  F W+ I+ISHIRF QA+  +  S DE+P+ ++    
Sbjct: 430 FIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVW 489

Query: 498 LAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RF 552
            + Y    + ++++   +T+  P      +  SF   Y+S+ + +  +I  +  F+   +
Sbjct: 490 GSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSW 549

Query: 553 IWKIGDVDIDSDRRDI-------EAIVWEDHEPK-TFWDKFWNV 588
           +  + ++D+D+ R+ +       E I  E    K +F  +FW+V
Sbjct: 550 VVTLEEMDLDTGRKALDPHLHRAEVIAEEAAVAKMSFIKRFWHV 593

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  273 bits (698), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 176/568 (30%), Positives = 286/568 (50%), Gaps = 45/568 (7%)

Query: 26  DVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVK 85
           D E ++         L   KSK+L+  +      NG+D                 +A ++
Sbjct: 84  DEETAEDLENELVSTLSPSKSKQLHGQK------NGDD-----------------DAHLQ 120

Query: 86  RELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMA- 144
           + ++ RH                     L+ AGP   +I Y  MGS  Y + Q+ GEMA 
Sbjct: 121 KSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAV 180

Query: 145 TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAW 204
            +  +  +F  +    +         ++Y   W     LEL      I +WT KV    +
Sbjct: 181 CYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTTKVNSDVF 240

Query: 205 ISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGPVGFRYW 263
           + IF+V+IT++N F  K Y E EF+  S KVL + GF I    +   GAG  G +G +YW
Sbjct: 241 VVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYW 300

Query: 264 RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKK 323
            NPGA+       DK+  RF   +S+   AAF F  +E + I A E +NPR+++P A K 
Sbjct: 301 HNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKT 355

Query: 324 VVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIENSGTKVLPHIFNAV 381
           +++RIL  ++ S+  +G LVPY+  +L  +  ++    SP++IA+ + G +V+PH  NAV
Sbjct: 356 MIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVVPHFINAV 415

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441
           IL +++S ANS  Y   RIL+ L++   APK+     + G P  A+ VT  FG +A+   
Sbjct: 416 ILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSC 475

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S   + VF WLL+I G++  F W  I +SHIRF +A+K +G S DE+ FK+++    + Y
Sbjct: 476 SDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGY 535

Query: 502 AATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI- 556
           AA  M + +I + + + AP      +  +F   Y+++ + + ++  ++ I++    WK+ 
Sbjct: 536 AAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYK-IYKKD--WKLF 592

Query: 557 ---GDVDIDSDRR--DIEAIVWEDHEPK 579
               D+D+ S R   D E +  E+ E K
Sbjct: 593 IRAKDIDLISHRTIFDGELVRQEEEEYK 620

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  271 bits (694), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 184/567 (32%), Positives = 282/567 (49%), Gaps = 21/567 (3%)

Query: 26  DVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXV--QNAE 83
            +E+ + H +   +   D    E      F       DT  +           +   NA 
Sbjct: 16  QLESGEFHEQNSYVSQSDASPVEGTRWERFRDSFKRADTQDLDPNLTDAEKMAILTANAP 75

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +KR LK RH                     L  AGP G LI +   G++ Y +  ++GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKVPLA 202
           A   P+   FT ++ RF+  +FG A   +Y   W +   LE+      + +W T      
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF-R 261
            ++++F+V+I  +N F VK YGE EF  + IKV+ +IG++I    +VCG G  G     R
Sbjct: 196 GFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGR 255

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
            W NPGA+  G          F G  S  + AAF+F G+ELVG+ A E ANPRKS+P A 
Sbjct: 256 LWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLT-QSTSYVSTSPFIIAIENSGTKVLPHIFNA 380
           K+V +RI  FYI +LL +GLLVPY   +L  QS+   + SPF+I+I+N+G K LP + N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL  ++S  NS ++  SR +  L+     PK      + G P + + VT  FG L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S    +VF+WLL ++G++  F W  I + HIR  +AL  +  +  EL F A      + 
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSV 485

Query: 501 YAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFIWKI 556
           Y    + +I++ Q + A  P   K +  +F  AY+S  + +A +I  +   +  +   + 
Sbjct: 486 YGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRA 545

Query: 557 GDVDIDSDRR--DIEAIVWEDHEPKTF 581
            ++DID+ RR  DIEA+  E  E K F
Sbjct: 546 KNIDIDTGRRETDIEALKQEIAEEKAF 572

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  271 bits (693), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 186/611 (30%), Positives = 289/611 (47%), Gaps = 55/611 (9%)

Query: 1   MTNSKED---ADIEEKHMYNEPVTTLFHDVEASQTHHR---RGSIPLKDEKSKELYPLRS 54
           M N K+     DI      N     L  +  AS   HR       P++DEKS        
Sbjct: 1   MVNDKDSIRTKDINFNETSNSTAVDLGGEGRASGVFHRFIDSFKPPVEDEKSD------- 53

Query: 55  FPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPL 114
               ++ E T                +  +K+ +K RH                     L
Sbjct: 54  -LEEMSMEST----------------DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGL 96

Query: 115 TNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMY 173
           +  GP   +I Y+ +  + Y + Q+ GEMA   P +  SF  ++  F+S   G A  +++
Sbjct: 97  SYGGPGALVIGYILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLF 156

Query: 174 WFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASI 233
              W     LEL      IQ+W   +    WI IF+V +  +++F VK YGE EF   + 
Sbjct: 157 LIQWLTVLPLELITGTMTIQYWNDSINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTC 216

Query: 234 KVLAIIGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 292
           K+L I GF+I+   +   GAG  G +G +YW+NPG++     +   + GRF      L+ 
Sbjct: 217 KILFIGGFIIFSIVVNAGGAGTDGYIGAKYWKNPGSF-----ASSTSAGRFKDVCYVLVT 271

Query: 293 AAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPY-NDPKLT 351
           A F++ GTEL  ++  E ANPR+S P+A K+ ++RIL  Y+ +++ IG  VP+ ND  + 
Sbjct: 272 AYFSYGGTELYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMG 331

Query: 352 QSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP 411
              S    SP+++A    G KV+PHI NAVIL  + S  NS++Y   R+   L++   AP
Sbjct: 332 AGGSSTHASPYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAP 391

Query: 412 KFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISH 471
           K L+   + G P IA+   A  G +A+   S+  ++VF WL  I  ++  F W  I +SH
Sbjct: 392 KCLAYIDREGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSH 451

Query: 472 IRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAY 531
           IRF  A+K +G   +EL +KA      + +   F  ++ I Q + A +P    +S A  +
Sbjct: 452 IRFRMAMKVQGKDLNELGYKALTGVWGSMWGFGFCVLVFIAQFWVALSPPGGTIS-AEGF 510

Query: 532 ISIFLFLAVWILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK----- 579
              +L   +W+ F   +        F+ K+ D+D+D+ RR  D E +  ED E K     
Sbjct: 511 FESYLAFPLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYDPEFLRQEDEERKEKIRN 570

Query: 580 -TFWDK---FW 586
            +FW K   FW
Sbjct: 571 SSFWIKMKYFW 581

>ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {ON}
           conserved hypothetical protein
          Length = 567

 Score =  270 bits (690), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 170/493 (34%), Positives = 271/493 (54%), Gaps = 20/493 (4%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V    + R L  RH                     L   GP   LI+Y+ MG + Y    
Sbjct: 57  VIRERLNRSLSPRHVNMIAIAGVIGTGLFLSTAKSLNAGGPGSLLINYVIMGGVIYLTML 116

Query: 139 SLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW--- 195
           SLGEM+TF+P++ S+  +S++F+S ++  A     W+S A++ A +L+ +  V+ +W   
Sbjct: 117 SLGEMSTFMPISGSYCAYSRKFVSESYCFALMCNMWYSDAVSVASDLTALQLVLDYWKTN 176

Query: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255
           T+  P  A   +FW +I  +N+  VK YGE E+W+A +KV+A+I F I      CG    
Sbjct: 177 THHFPYWAASLLFWFLILGLNVVHVKLYGEAEYWLAMLKVVAVIIFFIMAIIANCGHNQQ 236

Query: 256 GP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314
              +GF+ W +  A  P +      +G F G+V+  + ++F++ GTE V +T GEA NP 
Sbjct: 237 HEYIGFKNWSHGDA--PFV------QG-FKGFVTIFVTSSFSYGGTETVTLTGGEAKNPV 287

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVL 374
           ++ P+ IK V +RIL FY+ ++ F+G+ +PY+ P L   T  V TSPF I  + +GTK  
Sbjct: 288 RNTPKVIKTVFWRILVFYVFTMFFVGMDIPYDYPNL--KTKSVLTSPFTIVFQMAGTKAA 345

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAP--KFLSRTTKGGVPYIAVFVTAA 432
               NAVI+T+ ISA N  ++ GSRIL+ +      P  +F ++T +   PY+AV  T A
Sbjct: 346 GSFMNAVIMTSAISACNHALFGGSRILYNMGLEGFLPYSRFFTKTNRNKAPYVAVITTWA 405

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
            G L +  +  G  ++F WL NI GV+   +WL I++  IRF + L+ +G    EL F+ 
Sbjct: 406 VGGLCFGASFIGAGELFSWLQNIVGVSNQISWLSIAVISIRFRKGLEAQG-KVHELKFRN 464

Query: 493 KLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF 552
              P   ++   F+++II++QG++AF P ++  SF + Y+ + +F A WI +  I R RF
Sbjct: 465 WTYPYGPWFCIIFISLIILVQGWSAFDP-WSTSSFFSFYLELIVFPACWIFWWVIKRDRF 523

Query: 553 IWKIGDVDIDSDR 565
             K  D+D  +D+
Sbjct: 524 K-KAKDMDFITDK 535

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  271 bits (692), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/512 (32%), Positives = 264/512 (51%), Gaps = 17/512 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            ++ +KR +K RH                     L   GP G +I Y  +  +AY + Q+
Sbjct: 79  SSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVSVVAYIMMQA 138

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P +  +F  +S + +S  FG A  ++Y   W     LEL      I++W   
Sbjct: 139 AGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITASLTIKYWNDS 198

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I+IF+V I  ++ F  + YGE EF     KVL IIGF+I    + CG AG    
Sbjct: 199 INADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVINCGGAGDRKY 258

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+  G         +F G    L+   F++ GTEL  +T  E +NPR+++
Sbjct: 259 IGAKYWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMTVNEQSNPRRAI 313

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVST--SPFIIAIENSGTKVLP 375
               K+ ++RIL  Y+ +++ IG LVP+   +L  S+   +T  SP+++A+   G K++P
Sbjct: 314 QSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAVSLHGVKIVP 373

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           HI NAVIL  +IS  NS +Y G RIL  L++   AP+FL+   + G P +A+   + FG 
Sbjct: 374 HIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVALIACSVFGL 433

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LA++  S   + VF WL  I G++  F W  I +SH+RF QA++Y      EL +KA   
Sbjct: 434 LAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLSELGYKANTG 493

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
              +    +F  ++ I Q + + AP     K + +SF  +Y++  L++ ++  +  +FR 
Sbjct: 494 VLGSVLGLSFNILVFIAQFWVSIAPFGKDGKLDVLSFFQSYLAFPLWVVLFFGYMIVFRN 553

Query: 551 -RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
              I  + D+D+D  R   D + +  ED E K
Sbjct: 554 WEIIKPLKDIDLDHYRSIYDQDRLYQEDLEHK 585

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  269 bits (688), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 165/488 (33%), Positives = 274/488 (56%), Gaps = 19/488 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           +++R LK RH                     L   GP    ++Y  MG + Y     LGE
Sbjct: 53  DLQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGE 112

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV--- 199
           M+T++P++ SF  ++++F S +F  A  + YWF+ A++ A +++ +  V+ +W  +    
Sbjct: 113 MSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGF 172

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  A   +FW ++ ++N+  V++YGE E+W+A +KV+AII F I    +  G       +
Sbjct: 173 PYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYI 232

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF+ W +  A  P +         F G+ S  ++A+F + GTE + +T GEAANP ++ P
Sbjct: 233 GFKNWNHGEA--PFV-------DGFKGFASLFVSASFAYGGTESITLTNGEAANPLRNTP 283

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           + +K V +RIL FY+GS  FI + +PY+ P L   T  V TSPF +  + +GTK      
Sbjct: 284 KIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL--DTKSVVTSPFTLVFQMAGTKAAGSFM 341

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAP-KFLSRTTKGGVPYIAVFVTAAFGALA 437
           NAVI+T++ISA N  ++ GSR+++ +      P K +SRT +  VPY++V +T++ G L 
Sbjct: 342 NAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIGLLC 401

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           +  +  G   V+ WL NI GV+   AWL I I+ IRF + L+ +G +  EL +K    P 
Sbjct: 402 FGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELRYKNWTYPY 460

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
             Y+   F+T II++QG++AF P ++  +F + Y+ +F+F   +I++    R RF+ K+ 
Sbjct: 461 GPYFLVIFVTFIILVQGWSAFDP-WDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV-KLE 518

Query: 558 DVDIDSDR 565
           D+D  +DR
Sbjct: 519 DMDFVTDR 526

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  271 bits (692), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 171/550 (31%), Positives = 272/550 (49%), Gaps = 31/550 (5%)

Query: 40  PLKDEKSKELYPLRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXX 99
           P +D K  E+          NG+  +S+             +  +K+ +K RH       
Sbjct: 62  PAEDNKHSEV----DSDVERNGDAAYSVNT-----------DTHLKKAMKTRHVIMMTLG 106

Query: 100 XXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQ 158
                         L   GP   +I Y  +  + Y + Q+ GEMA   P +  +F  ++ 
Sbjct: 107 TGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYAS 166

Query: 159 RFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLF 218
            F+S  FG A  +++   W     LEL     +I++WT KV    ++ IF+V +  ++  
Sbjct: 167 IFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWTEKVNADVFVVIFYVFLLFIHFI 226

Query: 219 PVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKD 277
            VK YGE EF     K+L I GF+I+   + CG AG  G +G +YW +PGA+     +  
Sbjct: 227 GVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGT 281

Query: 278 KNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLL 337
               RF G    L++  F++ GTEL  ++  E  NPRKS P A K+ ++RIL  Y+ +++
Sbjct: 282 NAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMI 341

Query: 338 FIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYV 396
            IG  VP+ND +L  +  S    SP+++A    G +V+PHI NAVIL  +IS ANS++Y 
Sbjct: 342 LIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVVPHIINAVILIAVISVANSSLYA 401

Query: 397 GSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNIT 456
             R+L  L++   APKF++   + G P  A+   A FG +A+   S   ++VF WL  I 
Sbjct: 402 APRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIA 461

Query: 457 GVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFT 516
           G++  F W  I +SH+RF QA+K +G   +E+ + A      + Y   F  ++ I Q + 
Sbjct: 462 GLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILVFIAQFWV 521

Query: 517 AFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RFIWKIGDVDIDSDRR--DIE 569
           A AP  + ++ A ++   +L   +WI F   +        F+  +  +D+D  RR  D E
Sbjct: 522 ALAPPKSPIT-AQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPE 580

Query: 570 AIVWEDHEPK 579
            +  ED E K
Sbjct: 581 VLKQEDMENK 590

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  269 bits (687), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 167/489 (34%), Positives = 273/489 (55%), Gaps = 21/489 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ R LK R                      L   GP    ++Y  MG + Y    +LGE
Sbjct: 49  DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIMGGVVYLTLLALGE 108

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWT---YKV 199
           M+T++P++ SF V++++F S +F  A  + YWF+ A++ A +L+ +  V+ +W    +  
Sbjct: 109 MSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVMDYWKTSEHGF 168

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  A   IFW ++  +N+  V++YGE E+W+A +K++AII F I    +  G       +
Sbjct: 169 PYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSIVVNVGKNPQHEYI 228

Query: 259 GFRYW-RNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           GF+ W R    +  GI           G+ S  ++A+F + GTE + +T GEA NP ++ 
Sbjct: 229 GFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESITLTNGEAENPIRNT 278

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHI 377
           P+ +K V +RIL FY+GS  FI + +PY+ P L   +  + TSPF +  + +GTK     
Sbjct: 279 PKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKS--IVTSPFTLVFQMAGTKGAGSF 336

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAP-KFLSRTTKGGVPYIAVFVTAAFGAL 436
            NAVI+T++ISA N  ++ GSRI++ +      P + +SRT +  VPY++V +TAA GAL
Sbjct: 337 MNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVPYVSVLITAAVGAL 396

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            +  +  G   ++ WL NI GV+   AWL I I+ IRF + L+ +G +  EL +K    P
Sbjct: 397 CFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGKTH-ELIYKNWTYP 455

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKI 556
              Y+   F++ II+IQG++AFAP +N  +F + Y+ +F+F   +I++  + R RF+ K 
Sbjct: 456 YGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYLELFVFPVCFIIWWLVKRDRFV-KY 513

Query: 557 GDVDIDSDR 565
            D+D  +DR
Sbjct: 514 EDMDFTTDR 522

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  269 bits (688), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 158/507 (31%), Positives = 263/507 (51%), Gaps = 23/507 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ +K RH                     L  AGP G +I Y     + Y + Q+ GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 143 MA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           +   +  +  ++T +S   + PA G +  ++Y   W     L+L      +++WT   P 
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANP- 187

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGF 260
             ++++F+V+I ++N+F  K Y E EF     KVL I GF+I    + CG AG +G +G 
Sbjct: 188 DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGA 247

Query: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320
           +YW +PG++  G          F G       AAF++ G E++ +TA E  NPRKS+P A
Sbjct: 248 KYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNA 297

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST--SYVSTSPFIIAIENSGTKVLPHIF 378
            KKV++RIL  Y+ + + +  LVPYN  +L  S+  S    SP +IA+ + G K++PHI 
Sbjct: 298 CKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHII 357

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL ++IS  NS++Y   R+L  LS+   APKFL+   + G P I   +T     +A+
Sbjct: 358 NAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAF 417

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S   + +F WLL I+G++  F W  I +SH+RF  A+  +G+S  ++ +K++     
Sbjct: 418 VAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWG 477

Query: 499 AYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RF 552
           +++A     +++I Q + A AP     + N  +F   Y++  + L  +  ++   +  R 
Sbjct: 478 SWFAIVISVLVLIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRL 537

Query: 553 IWKIGDVDIDSDRR--DIEAIVWEDHE 577
                +VD+ S R   D E +  ED+E
Sbjct: 538 CIPASEVDLSSHRNISDEEILRQEDYE 564

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  269 bits (688), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 161/500 (32%), Positives = 254/500 (50%), Gaps = 26/500 (5%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +KR LK RH                     +   GP+  +I +   GS        LGE
Sbjct: 84  NLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGE 143

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           +    PV  +F  +S RFL P+       +Y   W     LE+      +Q+W   +   
Sbjct: 144 ITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSIDPV 203

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            W++IF+  I  +NLF  + +GE EF  +S+KVL I GF+I C  ++CG G     VG +
Sbjct: 204 VWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGAK 263

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PG    G          F G +S L+ A+++  GTE+V + +GE  +P K +P AI
Sbjct: 264 YWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLASGET-DP-KELPSAI 311

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAV 381
           K+  +RIL F++ SL  IG LVPY +  L   +S V+ SPF+IAI+    KVLP I NAV
Sbjct: 312 KQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSS-VNNSPFVIAIKLHQIKVLPSIVNAV 370

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441
           IL +I+S  NS I+  SR L  ++   L P+F     + G P   +   + FG LA++  
Sbjct: 371 ILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVK 430

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S+   +VF+WL+ I G+A    WL I+ISHIRF  A+K +G S DEL F + +    + Y
Sbjct: 431 SSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAY 490

Query: 502 AATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF-- 552
           +A   ++I++ Q + A  P             F  +Y+   + + +++  +  +R +   
Sbjct: 491 SAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIVLFVGHKIFYRYKTGK 550

Query: 553 ---IWKIGDVDIDSDRRDIE 569
              +  +  +D+++DR++I+
Sbjct: 551 WWSMLPLNKIDLETDRKNID 570

>SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance"
          Length = 551

 Score =  266 bits (681), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 170/488 (34%), Positives = 266/488 (54%), Gaps = 19/488 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            + R L  RH                     L   GP   LI+Y  +G + Y+   SLGE
Sbjct: 46  HLNRSLSPRHVNMIAIAGVIGTGLYLGTGRALHLGGPASLLINYSIIGLIVYATLLSLGE 105

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW-TYKVPL 201
           M+T++P++ SF  F+++F S +F  A    YWF+ A++ A +L+ +  V+ +W T +   
Sbjct: 106 MSTYMPISGSFCSFAKKFGSESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKTSESGF 165

Query: 202 AAWIS--IFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
             WI+  IFWV +  +N+  VK YGE E+W+A +KV+AII F I       G       +
Sbjct: 166 PYWIASLIFWVFLLFLNVIHVKIYGEAEYWLAMLKVIAIIIFFILSIVANVGHNEQHEYI 225

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GFR W    A  P +         F G+ +  ++A+F + GTE + +T+GE  NP ++ P
Sbjct: 226 GFRNWTRGDA--PFV-------NGFRGFATLFVSASFAYGGTESITLTSGETKNPVRNTP 276

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           + IK V +RIL FYI ++ FIG+ VPY+ P L++ +  V TSPF I  +  G+K      
Sbjct: 277 KVIKTVFWRILIFYIFTVFFIGMNVPYDYPNLSEKS--VMTSPFTIVFQMVGSKAAGSFM 334

Query: 379 NAVILTTIISAANSNIYVGSRILFGLS-KNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
           NAVILT+++SA N  ++ GSRILF L  +    PK ++RT    VPY+AV VT A G L 
Sbjct: 335 NAVILTSVVSACNHALFAGSRILFNLGLEGYFFPKLVTRTNWYQVPYVAVLVTWAVGGLC 394

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           +  +  G   ++ WL N+ GV+   AWL I +  IRF + L  +G +  EL F     P 
Sbjct: 395 FGSSFIGAGTLWIWLQNLVGVSNQIAWLSIGVISIRFRRGLSRQGKTH-ELKFVNWTYPY 453

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
             Y+    ++ II++QG+++ +P  +  SF + Y+ +F+FLA W+++    R  F+ +  
Sbjct: 454 GPYFVIISVSFIILVQGWSSSSP-MDVTSFFSYYVELFIFLACWLVWWAFKRDGFV-REK 511

Query: 558 DVDIDSDR 565
           D+D  +D+
Sbjct: 512 DMDFVTDK 519

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  268 bits (685), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 265/514 (51%), Gaps = 22/514 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            N  +K+ +K RH                     L  AGP   +I Y+ +  + Y + Q+
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQA 141

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEM   +  +  +F  ++  F+S +FG A  +++   W     LEL      I++W   
Sbjct: 142 AGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDS 201

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    +I IF+V +  ++ F VK YGE EF   S K+L + GF+I    + CG AGV G 
Sbjct: 202 INADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PG++  G      N  RF G    L+ A F+F G EL  ++  E +N RKS 
Sbjct: 262 IGGKYWRDPGSFADG-----SNATRFKGICFILVTAYFSFGGIELFVLSINEQSNARKST 316

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVLPH 376
           P A K+ V+RIL  Y+ +++ IG  VP+N+ +L  S S  +  SP+++A      +V+PH
Sbjct: 317 PLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPH 376

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++IS ANS +Y   R++  L++   AP+FL+   + G P  A+ V A  G +
Sbjct: 377 IINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVV 436

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            ++  S   ++ F WL  I G++  F W  I +SHIRF +A+K +G S  EL +KA    
Sbjct: 437 GFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGI 496

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNG---------VSFAAAYISIFLFLAVWILFQCI 547
             +YY   F  ++ + Q + A +P  NG           + AA + IF++L  ++L+   
Sbjct: 497 WGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLG-YMLYNKD 555

Query: 548 FRCRFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           F    +  +  +D+D  RR  D E +  ED E K
Sbjct: 556 F--TLLNPLDKIDLDFHRRVYDPEIMRQEDEENK 587

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  266 bits (679), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 170/511 (33%), Positives = 259/511 (50%), Gaps = 35/511 (6%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           ++ VKR LK RH                     L   GP+  L+ +  +G + +S+ +S+
Sbjct: 39  HSGVKRALKNRHISLLALGGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESI 98

Query: 141 GEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           GE+ T  P    F   ++RF S    A +GY Y   +    A E + +  ++QFW  +VP
Sbjct: 99  GELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVP 158

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTG--PV 258
           +  +  IFW    +  L  V  +GE E+W+A  K+L ++ F I+    + G G+ G  P+
Sbjct: 159 IYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSG-GIPGKPPI 217

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF+YW+NPGA   G          F G     +  +  + GTE V + A E+ NPRK+VP
Sbjct: 218 GFQYWKNPGALSHG----------FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVP 267

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            A+++  +RIL  Y+G   F G+ VPYNDP L   T  +  SP  IA+  +G     H+ 
Sbjct: 268 LAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQTKSLK-SPISIALSRAGWAGGVHLV 326

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NA IL T ISA NS++Y+GSR L  L+   LAP+ L+ T K GVP  A+ V  A G ++ 
Sbjct: 327 NAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISL 386

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           M  S G    + +++N++GV  F  W  ISI+H+RF +A   +G S  ELP++A   P  
Sbjct: 387 MNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWT 446

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWK--- 555
             ++      + +IQG+T+  P F    F  AYI   L  A  +L+  I      WK   
Sbjct: 447 TIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI---LLPAAGLLYVGI----NFWKNRN 498

Query: 556 -----IGDVDIDS-DRRDIEAIVWEDHEPKT 580
                I  ++++   RRD++    ED + +T
Sbjct: 499 FKTVNIHGINLEEGQRRDLD----EDSDDET 525

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  267 bits (683), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 164/511 (32%), Positives = 259/511 (50%), Gaps = 16/511 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            +  +K+ +K RH                     L  AGP   +I Y  +  + Y V Q+
Sbjct: 73  SDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQA 132

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P +   F  ++  F+S  FG A  +++   W     LEL      I++W  K
Sbjct: 133 AGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDK 192

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +    ++ I +V +  ++ F V+ YGE EF   S K+L I GF+I    + CG AGV G 
Sbjct: 193 INADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGY 252

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YWR+PGA+     + D    RF G    L+ A F++ G EL  ++  E  NPR+S 
Sbjct: 253 IGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRST 307

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P A K+ ++RIL  Y+ +++ IG  VP+N  +L  +  S    SP+++A+   G KV+PH
Sbjct: 308 PAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPH 367

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
           I NAVIL ++ S ANS +Y   R+L  L++   APK+ +   + G P  A+ + + FG +
Sbjct: 368 IINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVI 427

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S   + +F WL  I G++  F W  I +SH+RF  A+K +G S +EL + +    
Sbjct: 428 AFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITGI 487

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFN-GVSFAAAYISIFLFLAVWILFQCIFRC----- 550
             + Y   F  ++ I Q + A +P  + GV  A A+   +L   VW+ F   +       
Sbjct: 488 WGSLYGCFFNVLVFIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDF 547

Query: 551 RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            F+  +  +D+D+ RR  D E +  ED E K
Sbjct: 548 TFLTDLKKIDLDNHRRLYDPELLRQEDEETK 578

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  268 bits (686), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 160/493 (32%), Positives = 268/493 (54%), Gaps = 14/493 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ ++ RH                     L  AGP G +I Y  MGSL Y + Q+ GE
Sbjct: 115 KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGE 174

Query: 143 MA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           MA  ++ +   F  +    + P F  A  ++Y   W     LEL      I++WT KV  
Sbjct: 175 MAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDP 234

Query: 202 AAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-GPVG 259
             ++ IF+V I  +N+    + Y E EF   S K+L +IGF I    ++CG   T G +G
Sbjct: 235 DVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIG 294

Query: 260 FRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPR 319
            RYW +PGA+       ++   RF G V++L+ AAF+F  +E + +TA E +NPR+++P 
Sbjct: 295 GRYWHDPGAF-----RGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPS 349

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPHIF 378
           A KK+++R L  Y+ S++ +G LVPYN  +L  + S  +  SP+++A+ N G +V+PH  
Sbjct: 350 AAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFI 409

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVI+ +++S +NS  Y   R+L  LS+   APK  S   + G P + + V + F  +A+
Sbjct: 410 NAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAF 469

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
             TS   D+VF WLL ++G++  F W+ I +SH+RF +A+  +G S  E  F +++    
Sbjct: 470 CATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYG 529

Query: 499 AYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RFI 553
           + Y+   + +I++ Q + A  P    K +  SF   Y++  +++A++I ++C  +  R  
Sbjct: 530 SAYSFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLY 589

Query: 554 WKIGDVDIDSDRR 566
            K  D+D+ + R+
Sbjct: 590 IKSQDIDLVAHRQ 602

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  269 bits (687), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 166/496 (33%), Positives = 269/496 (54%), Gaps = 14/496 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ E+K+ +K RH                     L  AGP G L+ +  MG+  Y + Q+
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           +GEMA  +  +   F  +    + PAFG +  ++Y   W     LEL      I++WT K
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 199 VPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT-G 256
           V    ++ IF+V+I  +N+      Y E EF   S K+L +IGF I    ++CG     G
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW  PGA+       +    RF G +++L+NAAF F  +E +G+TA E +NPRK+
Sbjct: 325 YIGGKYWHEPGAF-----RGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKA 379

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLP 375
           +P A KK+++RI+  ++ S+  +G LVPY+ D  L  S   V  SP+++A+   G KV+P
Sbjct: 380 IPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVP 439

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL +++S ANS  Y  SR+L  L++   APK      + G P + + + + FG 
Sbjct: 440 HFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGV 499

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           +A+  TS   D+VF WLL I+G++  F W+ I +SH+RF +A+  +G S  EL F++++ 
Sbjct: 500 IAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVG 559

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
              + YAA  M  I+I Q + A AP    K +  +F   Y+++ + LA++  ++   +  
Sbjct: 560 AWGSSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNW 619

Query: 552 FIW-KIGDVDIDSDRR 566
            I+ +  D+D+ S R 
Sbjct: 620 TIFIRAKDIDLVSHRN 635

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  266 bits (681), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 259/519 (49%), Gaps = 28/519 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +KR LK RH                     +   GP+G +I +   GS        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+ +I  +NLF V+ +GE EF  ++IK + + GF+I C  ++CG G     +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    K LP I 
Sbjct: 302 SAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKALPSIV 360

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +++S  NS I+  SR L  ++   L P +     + G P + +   + FG LA+
Sbjct: 361 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S    +VF WL+ I G+A    WL I++SHIRF  A+K +G S DEL F + +    
Sbjct: 421 LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 480

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           + Y+A    +I+I Q + +  P       K     F   Y+   + L ++I+ +  ++C+
Sbjct: 481 SAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIYYKCQ 540

Query: 552 F-----IWKIGDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
                 +  + D+D+++DR+  DIE +  E  E K + D
Sbjct: 541 TGKWWGVKALKDIDLETDRKDIDIEIVKQEIAEKKMYLD 579

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  266 bits (679), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 253/495 (51%), Gaps = 25/495 (5%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           VKR LK RH                     L   GP+  L+ +  +G +A+SV +S+GEM
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEM 108

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
            T  P    FT  ++RF S A  A  GY Y   +    A E + +  ++QFW  +VPL  
Sbjct: 109 ITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 168

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-GFRY 262
           +I IFW    I  L  V  +GE E+W+A +K++ ++ + I+    + G     P  GF Y
Sbjct: 169 YILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHY 228

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           W +PGA   G          F G     +  +  + GTE V + A E+ NP K+VP A++
Sbjct: 229 WNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVR 278

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           + ++RIL  YIG  +F G  VP++DP L+ ST  V  SP  IAI  +G     H+ NA I
Sbjct: 279 QTLWRILVVYIGIAVFYGATVPFDDPNLSASTK-VLKSPIAIAISRAGWAGGAHLVNAFI 337

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442
           L T ISA N ++Y+GSR L  L+   LAPK L+ T + GVP  A+ V  A G ++ M  S
Sbjct: 338 LITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVS 397

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
            G    + +++N++GV  F  W  IS +H+R  +A   +G S +ELP++A   P     +
Sbjct: 398 VGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLS 457

Query: 503 ATFMTIIIIIQGFTAFAPKFNGVSFAAAYI----SIFLFLAVWILFQCIFRCRFIWKIG- 557
                 + +IQG++ F P F+  +F  AYI     I L++ +     C+F+      +  
Sbjct: 458 LAANIFLALIQGWSYFVP-FDAGNFVDAYILLPVGILLYIGI-----CVFKSNHFRTVDL 511

Query: 558 -DVDIDSDRR-DIEA 570
             +++D  RR D+EA
Sbjct: 512 RSINLDEGRRKDMEA 526

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  265 bits (677), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 166/488 (34%), Positives = 261/488 (53%), Gaps = 19/488 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ R L  RH                     L N GP    ++Y  +G + Y     LGE
Sbjct: 45  DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE 104

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW---TYKV 199
           M+TF+P++ SF  ++++F S +F  A  + YWF+ A++ A +L+ +  V+ +W    +  
Sbjct: 105 MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHF 164

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P      IFW  +  +N+  V+ YGE E+W+A +KV+AI+ F I    +  G       +
Sbjct: 165 PYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYI 224

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF+ W +  A  P +         F G+ S  ++A F + GTE + +T GEA+NP ++ P
Sbjct: 225 GFKNWTHGEA--PFV-------NGFKGFASLFVSACFAYGGTESITLTGGEASNPVRNTP 275

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           + +K V +RIL FY+ S  FIG+ +PY+ P L  ST  V TSPF +  + +GT+      
Sbjct: 276 KIVKTVFWRILIFYVLSTFFIGMNIPYDYPGL--STKSVMTSPFTLVFQMAGTRGAGSFM 333

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAP-KFLSRTTKGGVPYIAVFVTAAFGALA 437
           NAVILT++ISA N  ++ GSRI++ ++ +   P K + RT +   PY+AV +T A G L 
Sbjct: 334 NAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLC 393

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
              +  G   ++ WL NI GV+   AWL I I+ IRF + L+ +G   D L FK    P 
Sbjct: 394 LGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPF 452

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
             Y+   F   II+IQG+ AF P ++   F + Y+ +F+F  V+I++    R  F+ K  
Sbjct: 453 GPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYLELFVFPFVYIIWWLWKRDWFV-KYE 510

Query: 558 DVDIDSDR 565
           D+D  +DR
Sbjct: 511 DMDFVTDR 518

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  266 bits (680), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 177/538 (32%), Positives = 278/538 (51%), Gaps = 21/538 (3%)

Query: 52  LRSFPTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXX 111
           + S   RV+GED   +            ++  +K+ +K RH                   
Sbjct: 61  IHSTHERVSGEDFERLAPDDSS------KHKTLKQNIKPRHVLMISLATGIGTGMLVGNG 114

Query: 112 XPLTNAGPVGALISYLFMGSLAYSVTQSLGEMAT-FIPVTSSFTVFSQRFLSPAFGAANG 170
             L N GP   LI Y  + ++ Y V QS  E+A  +  ++  F  +    +  AF  +  
Sbjct: 115 KSLHNGGPASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVS 174

Query: 171 YMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWV 230
           ++Y   W     LEL      I++W   +   A++ IF+V++ ++N      Y E EF+ 
Sbjct: 175 WVYCLQWLCILPLELVTASMTIKYWNDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFF 234

Query: 231 ASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSS 289
            + KVL +IGF I    + CG AG  G +G  YW +PGA+       +    RF G V+ 
Sbjct: 235 NTCKVLMLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAF-----RGNNGINRFKGLVAV 289

Query: 290 LINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPK 349
           L+NAAF + G E   +TA E  NP+KS+  A KK+V+RI+  Y+ +   +G LVPYN P+
Sbjct: 290 LVNAAFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPE 349

Query: 350 LTQSTSYVS-TSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
           L  S S  +  SPF+IAI + G KV+PHI NAVIL +++S ANS +Y  SRIL  LS+  
Sbjct: 350 LLGSGSAATHASPFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQG 409

Query: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
            APK  +   + G P   + V+  FG L ++  S   + VF WLL I+G++  F W  IS
Sbjct: 410 FAPKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSIS 469

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP----KFNG 524
           +SH+RF +++  +G S DEL +++      AYYA   + +I+I Q + A +P    K + 
Sbjct: 470 LSHVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLILIGQFWVAISPVGSNKLDA 529

Query: 525 VSFAAAYISIFLFLAVWILFQCIFRC-RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            +F   Y+++ + + +++ ++  +R  R I    +VD+ S R+  D E +  E  E K
Sbjct: 530 NNFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFDAEIMQSEQLEEK 587

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/520 (31%), Positives = 258/520 (49%), Gaps = 28/520 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +KR LK RH                     L   GP+  +I +   GS        
Sbjct: 59  DTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHG 118

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +S RFL P+       +Y   W     LE+      IQ+W   +
Sbjct: 119 LGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+ +I  +NLF  + +GE EF  ++IK + I GF+I C  ++CG G     +
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PGA   G          F G +S L+ A+++  GTE+  + +GE  +P K +P
Sbjct: 239 GAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLASGET-DP-KELP 286

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    K LP I 
Sbjct: 287 SAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKLHHIKALPSIV 345

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +I+S  NS I+  SR L  ++   L P+F     + G P   +   + FG LA+
Sbjct: 346 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAF 405

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S+   +VF+WL+ I G+A    WL I++SHIRF  A+K +  + DEL F + +    
Sbjct: 406 LVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWG 465

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           + Y+A    +I+I Q + +  P             F  +Y+   + L ++ + +  +R  
Sbjct: 466 SAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLLIFCIHKVYYRVS 525

Query: 552 F-----IWKIGDVDIDSDRR--DIEAIVWEDHEPKTFWDK 584
           F     +  + D+D+++ R+  DI+ I  E  E K +  K
Sbjct: 526 FGKWWDVKPLKDIDLETGRKNVDIDVIKAEIAERKMYLKK 565

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  265 bits (677), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 260/519 (50%), Gaps = 28/519 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +KR LK RH                     +   GP+G ++ +   GS        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+ +I  +NLF  + +GE EF  +++K + + GF+I C  ++CG G     +
Sbjct: 194 DPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFI 253

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IAI+    KVLP I 
Sbjct: 302 SAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPSIV 360

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +++S  NS I+  SR L  ++   L P +     + G P + +   + FG LA+
Sbjct: 361 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S    +VF WL+ I G+A    WL I++SH+RF  A+K +G S DEL F + +    
Sbjct: 421 LVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWG 480

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           + Y+A    +I+I Q + +  P       K     F   Y+   + + ++++ +  +RC+
Sbjct: 481 SVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVFIFVIHKIYYRCQ 540

Query: 552 F-----IWKIGDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
                 + ++ D+D+++DR+  DIE +  E  E K + D
Sbjct: 541 MGKWWGVKELKDIDLETDRKDIDIEIVKQEIAEKKKYLD 579

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  264 bits (674), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 166/487 (34%), Positives = 272/487 (55%), Gaps = 18/487 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++KR+L  RH                     L   GP    ++Y   G + Y     LGE
Sbjct: 67  DLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGE 126

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK---V 199
           M+T++P++ SF  ++++F S +F  A  + YWF+ A++ A +L+ +  V+ +W  K    
Sbjct: 127 MSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHF 186

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  A   +FWV + ++N+  V+ YGE E+W+A +KV+AII F I    +  G       +
Sbjct: 187 PYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYI 246

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF  W +  A  P +         F G+ S  ++A+F + GTE + +T GEA NP ++ P
Sbjct: 247 GFHNWNHGDA--PFV-------NGFKGFASLFVSASFAYGGTESITLTNGEATNPVRNTP 297

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           + IK V +RIL FY+ S  FI + VPY+ P L  +T  V TSPF I  + +G+K      
Sbjct: 298 KVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL--ATKSVMTSPFTIVFQMAGSKGAGSFM 355

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVI+T++ISA N  ++ GSR+++ +S +   PK++++T +   PY+AV +T A G L +
Sbjct: 356 NAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGGLCF 415

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
             +  G   V+ WL NI GV+   AWL I+I+ IRF + L+ +G +  EL FK    P  
Sbjct: 416 GASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQGKTH-ELKFKNWTYPWG 474

Query: 499 AYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD 558
            Y+   F++ +I+IQG++AF P ++  +F + Y+ +F+F A ++++    R +FI K  D
Sbjct: 475 PYFLVVFVSFVILIQGWSAFDP-WSTSNFFSVYLELFVFPACYLIWWLYKRDKFI-KYED 532

Query: 559 VDIDSDR 565
           +D  +D+
Sbjct: 533 MDFVTDK 539

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  264 bits (675), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 173/517 (33%), Positives = 267/517 (51%), Gaps = 28/517 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            +  +KR+LK RH                     L   GP+  +I +   GS        
Sbjct: 66  HSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHG 125

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +S R L P+       +Y   W     +EL      +QFWT KV
Sbjct: 126 LGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKV 185

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+VI+  +NLF VK +GE EF  + +KV+ IIGF+I    ++CG G     +
Sbjct: 186 DPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFI 245

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G  YW +PGA   G          F G  S  + A+++  G+E+V + + E  +P K +P
Sbjct: 246 GTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLCSAET-DP-KELP 293

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RI+ F++ SL  +G LVPY +  L   +S V+ SPF+IAI+ SG +VLP I 
Sbjct: 294 HAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSS-VNNSPFVIAIKLSGIRVLPSII 352

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +I+S  NS I+  SR L  ++   L P+      + G P + + V + FG LA+
Sbjct: 353 NAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAF 412

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S     VF+WL+ I G+A    WL I+ISHIRF  A+K +  S DEL FK+ +    
Sbjct: 413 LVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYG 472

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           + Y+AT   +I+I Q + +  P       +    SF   Y+   + + V++  +  F+C 
Sbjct: 473 SIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCS 532

Query: 552 ----FIWK-IGDVDIDSDRR--DIEAIVWEDHEPKTF 581
               F +K + ++D+++DR+  DIE +  E  E + +
Sbjct: 533 TGKWFDFKPLAEIDLETDRKNIDIEIVKQEVREREMY 569

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 164/512 (32%), Positives = 265/512 (51%), Gaps = 18/512 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           +  + +K+ +K RH                     L  +GP   +++Y  +  + Y + Q
Sbjct: 96  ISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQ 155

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GEMA   P +  +F  +   F+S  FG A  +++   W     LEL      I++W  
Sbjct: 156 AAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWND 215

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           K+    ++ IF+V +  ++ F V+ YGE EF   S K+L I GF+I+   + CG AG  G
Sbjct: 216 KINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDG 275

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW +PGA+     +   N GRF G    L+ A F++ GTEL  ++  E  NPRKS
Sbjct: 276 YIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKS 330

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLP 375
            P+A K+ ++RI+  Y+ +++ IG  VP+++ +L  S  S    SP+++A    G +++P
Sbjct: 331 TPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVP 390

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL ++IS ANS++Y   R+L  L++   APKFL+   + G P  A+   + FG 
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           + +   S   ++VF WL  I G++  F W  I +SH+RF QA+K +G   +EL +KA   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP---KFNGVSFAAAYIS---IFLFLAVWILFQCIFR 549
              + Y   F  ++   Q + A AP   K   +SF  +Y++    F F   ++L+   F 
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDF- 569

Query: 550 CRFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
             F+  +  +D+D  RR  D E I  E  E K
Sbjct: 570 -TFLIPLESIDLDFHRRVYDPEFIRQEREEKK 600

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  264 bits (675), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 144/431 (33%), Positives = 244/431 (56%), Gaps = 8/431 (1%)

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           +   GP   LI++     +   +++ +  M T++PVT SF  F++RF+  + G A G+ Y
Sbjct: 147 IIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTY 206

Query: 174 WFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASI 233
           +   A     E++ V  V+++WT K+P AA IS+  ++   +NL+ V ++GE EF+++  
Sbjct: 207 FVCQAANVCFEITAVCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIG 266

Query: 234 KVLAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 292
           KV+  IG +I+   ++ G      V GF+ W NPGA+   I   D + GRF G++S L+ 
Sbjct: 267 KVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFAEYI--SDGSVGRFHGFMSCLVF 324

Query: 293 AAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ 352
           A + F G + +G  A EA NPRK +P + +KV  R++ FYIG  + +G+L+PYNDP + +
Sbjct: 325 ALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIR 384

Query: 353 STSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
           +          SP++ A++  G +VLPHI N +ILT+IISA NS++Y  SR+L  L+ + 
Sbjct: 385 AIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDN 444

Query: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
            AP+    TTK GVP            LAY+  S   + V  W LN+   A    ++FI 
Sbjct: 445 QAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFIC 504

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSF 527
           +S+++F +    + +    LP+ +  +P LA+++  ++ +++++ G+T F    ++  SF
Sbjct: 505 VSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSF 564

Query: 528 AAAYISIFLFL 538
             +Y  I  FL
Sbjct: 565 VFSYFMIPFFL 575

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  263 bits (672), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 149/442 (33%), Positives = 227/442 (51%), Gaps = 14/442 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            +  +K+ LK RH                     L   GP+  +I +   G+        
Sbjct: 69  HSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHG 128

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +++W   V
Sbjct: 129 LGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSV 188

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  AW++IF+  I ++NL  V+ +GE EF  + IKVL IIGF+I C  ++CG G     V
Sbjct: 189 PPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFV 248

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG    G          F G  +  + A+++  GTE+  + +GE  +P K +P
Sbjct: 249 GAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLASGET-DP-KELP 296

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RI+ F++ SL  +G LVPY +  L   +S V  SPF+IAI   G K LP + 
Sbjct: 297 SAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSS-VDNSPFVIAIRLHGIKALPSVV 355

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +++S  NS I+  SR L  ++   L P+      + G P + +    AFG LA+
Sbjct: 356 NAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAF 415

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S+  D VF WL+ I G+A    WL I++SHIRF  A+K +G+S DEL F + +    
Sbjct: 416 LVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEFVSAVGVYG 475

Query: 499 AYYAATFMTIIIIIQGFTAFAP 520
           + Y+AT   +I++ Q + +  P
Sbjct: 476 SVYSATINVLILVAQFYVSLWP 497

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 162/521 (31%), Positives = 269/521 (51%), Gaps = 23/521 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K+ LK RH                     L   GP   +I Y+ +  + Y + Q+ GEM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 144 ATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           A   P +  +F  +   F+S ++G A  +++   W     LEL      IQ+WT  +   
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT-DLNGD 208

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFR 261
            ++ IF+V + +++   VK YGE EF     K+L I GF+I+   + CG AG  G +G +
Sbjct: 209 IFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGK 268

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW  PG++  G         RF G    L+   F++ GTEL  ++  E A PRK+ P A 
Sbjct: 269 YWHTPGSFAEG-----GPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAA 323

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHIFNA 380
           KK ++RIL  Y+ +++ IG  VP+N  +L  +  S    SP+++A    G KV+PHI NA
Sbjct: 324 KKSIYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINA 383

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL +++S ANS++Y   R+L  L++   APK L+   + G P +A+ + A FG +A++ 
Sbjct: 384 VILISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVA 443

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
           +S   ++VF WL  I G++  F W  I  SH+RF  A+K +    DE+ +KA      ++
Sbjct: 444 SSDKEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSW 503

Query: 501 YAATFMTIIIIIQGFTAFAPKFNGVSFAA-AYISIFLFLAVWILFQCIFRC-----RFIW 554
           + + F  +++I Q + A +P  +G + +A ++   +L + +W+ F  ++         + 
Sbjct: 504 FGSIFGVLVLIAQFWVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILT 563

Query: 555 KIGDVDIDSDRR--DIEAIVWEDHEPKT------FWDKFWN 587
            +  +D+D+ RR  D + I  ED E K       FW + +N
Sbjct: 564 DLSKIDLDAHRRIYDPDLIRQEDAENKEKLKNSPFWVRVYN 604

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  263 bits (672), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 175/601 (29%), Positives = 285/601 (47%), Gaps = 49/601 (8%)

Query: 1   MTNSKEDADIEEKHMYNEPVTTLFHD---VEASQTHHRRGSIPLKDEKSKELYP--LRSF 55
           ++     +DI+ K   NE +T +  D   ++ +   H   S   + EK   +Y   + SF
Sbjct: 6   LSTQDVSSDIKYKSSKNEFITIIESDNKNIDDNFIPHDTLSTISRKEKKPPIYRRIIDSF 65

Query: 56  PTRVNGEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLT 115
               +G                      +K+ LK RH                     L 
Sbjct: 66  KPPEDGS----------------FHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALA 109

Query: 116 NAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWF 175
             GP+  +I +   GS        LGE+    PV  +F  ++ RFL P+       +Y  
Sbjct: 110 TGGPLAVIIGWAVAGSQIVGTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVL 169

Query: 176 SWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKV 235
            W     LE+      +Q+W   +    +++IF+ +I  +NLF  + +GE EF  +++K+
Sbjct: 170 QWFFVLPLEIIASAITVQYWNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKI 229

Query: 236 LAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAA 294
           + I GF+I C  ++ G G     +G +YW NPG+   G          F G +S L+ A+
Sbjct: 230 ITICGFIILCIVLIAGGGPDHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVAS 279

Query: 295 FTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST 354
           ++  GTE+  + +GE  +P K +P AIK+V +RIL F++ SL  +G LVPY +P L   +
Sbjct: 280 YSLGGTEMTCLASGET-DP-KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGS 337

Query: 355 SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFL 414
           S V  SPF+IAI+    KVLP I NAVIL +I+S  NS I+  SR L  ++   L P + 
Sbjct: 338 S-VDNSPFVIAIKIHNIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWF 396

Query: 415 SRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRF 474
               + G P   + + + FG LA++  S+   +VF+WL+ I G+A    WL I+I H+RF
Sbjct: 397 GYIDRAGRPLTGIIINSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRF 456

Query: 475 MQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-------KFNGVSF 527
             A+K +  + DEL F + +    + Y+     +I++ Q + A  P             F
Sbjct: 457 RLAMKAQNRTLDELEFVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKF 516

Query: 528 AAAYISIFLFLAVWILFQCIFRCR--FIWK---IGDVDIDSDRR--DIEAIVWEDHEPKT 580
              Y+   + + ++I  +  +R      W+   + D+D+D+DR+  DIE I  E HE K 
Sbjct: 517 FQNYLCALILIVLFIGHKIYYRVTTGHWWEYIALKDIDLDTDRKNVDIEIIKQEIHEKKM 576

Query: 581 F 581
           +
Sbjct: 577 Y 577

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  264 bits (674), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 153/468 (32%), Positives = 255/468 (54%), Gaps = 8/468 (1%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++A +++ ++ RH                     L  AGP G +I Y  MG+  Y + Q+
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA ++  +  +F  +    +   FG A  ++Y   W     LEL      I +WT K
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ IF+V+I ++N+F  K Y E +F+  + KVL I GF I    +   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G +YW +PGA+       D++  RF   +++   AAF F  +E + I A E +NPR+++
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY-VSTSPFIIAIENSGTKVLPH 376
           P A K +++RIL  ++ S+  +G LVPY+  +L  S S     SP+++AI + G +V+PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL  ++S +NS  Y   RILF LS+   AP++ +   + G P  A+ ++  FG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           A+   S+  ++VF WLL I+G++  F W+ I +SHIRF +A+  +G S  EL F+++L  
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILF 544
             + YAAT + + +I + + + AP       A ++   +L + + I+F
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVF 585

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  262 bits (669), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 156/507 (30%), Positives = 259/507 (51%), Gaps = 16/507 (3%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +K  +K RH                     L   GP G +I Y+   ++ Y V Q+  E+
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 144 A-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
              +  +  ++  +    +   FG A   +Y   WA    LEL      +++WT  V   
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNPD 187

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFRY 262
            +++IF+V +  ++ F  + Y E EF   S+KVL + GF+I    +  GA   G +G +Y
Sbjct: 188 VFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGASEQGYIGGQY 247

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           W +PGA+G      D+   RF G  S  + AAF + G+E + +TA E ANPR+SVP+A K
Sbjct: 248 WHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKATK 302

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIENSGTKVLPHIFNA 380
           + ++R++  ++  ++ IG LVP+N  +L   +  S    SPF+IA    G +V+PHI N 
Sbjct: 303 RWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIINF 362

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           +ILT++IS  NS +Y   RIL  L+++ + PK  +   + G P + +   + FG +A++ 
Sbjct: 363 IILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFVA 422

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
            S   + VF WL  I G++  F W  I++SH+RF +A++ +G S  EL ++A      +Y
Sbjct: 423 ASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGALGSY 482

Query: 501 YAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RFIW 554
           YA  F  I++I Q + A AP   +G      +   +L   V ++F   ++      R + 
Sbjct: 483 YAIFFNVIVLIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRDFRLVI 542

Query: 555 KIGDVDIDSDRR--DIEAIVWEDHEPK 579
              +VD+ S R+  D E ++ E+ E K
Sbjct: 543 PSSEVDLLSHRQIFDEEVLLQEEAERK 569

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 163/517 (31%), Positives = 259/517 (50%), Gaps = 28/517 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +K+ LK RH                     L   GP+  +I +   GS        
Sbjct: 82  DTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHG 141

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +S RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 142 LGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESI 201

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+V I  +NLF V+ +GE EF  ++IKV+ I GF++ C  ++ G G     V
Sbjct: 202 DPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYV 261

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G RYW NPG    G          F G +S ++ A+++  GTE+  + +GE  +P K +P
Sbjct: 262 GSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP-KELP 309

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    KVLP I 
Sbjct: 310 SAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-VDNSPFVIAIKIHHIKVLPSIV 368

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +I+S  NS I+  SR L  ++   L P +     + G P + +   + FG LA+
Sbjct: 369 NAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAF 428

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S    +VF+WL+ I G+A    WL I++SHIRF  A+K +G S +EL F + +    
Sbjct: 429 LVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWG 488

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIF--R 549
           + Y+A    +I++ Q + +  P       +     F  +Y+   + + +WI  +  +  +
Sbjct: 489 SVYSAIINCLILVAQFYISLWPIGGWKNSEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQ 548

Query: 550 CRFIWK---IGDVDIDSDRR--DIEAIVWEDHEPKTF 581
              IW    + ++D+D  R+  D++ +  E HE K +
Sbjct: 549 TGKIWAFTPLAEIDLDEGRKNIDLDVLKQEIHERKMY 585

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  261 bits (668), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 164/521 (31%), Positives = 256/521 (49%), Gaps = 29/521 (5%)

Query: 82  AEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLG 141
           + +KR LK RH                     L   GP+  +I +   G+        LG
Sbjct: 76  SNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLG 135

Query: 142 EMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           E+   +PV  +F  +S RFL P+       +Y   W     LE+      ++FWT  V  
Sbjct: 136 ELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDP 195

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGF 260
             W+++F+ +I  +NL  V+ +GE EF  +S+KV+ I GF+I C  ++ G G T   VG 
Sbjct: 196 IIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGS 255

Query: 261 RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRA 320
           RYW +PG    G          F G  + ++ A+++  G+E+  + +GE  +P K +P A
Sbjct: 256 RYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KELPHA 303

Query: 321 IKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNA 380
           IK++ +RIL F++ SL  +G LVPY +  L   +S    SPF++A+     KV+PHI N 
Sbjct: 304 IKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSS-AENSPFVLALYLHHVKVVPHIVNG 362

Query: 381 VILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYME 440
           VIL +I+S  NS I+  SR L  ++   L P       +GG P + +   + FG LA++ 
Sbjct: 363 VILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLV 422

Query: 441 TSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAY 500
             +    VF WL+ I G+A    WL I++SH+RF  A+K +  S DEL F + +    + 
Sbjct: 423 KFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQFVSSVGVWGSV 482

Query: 501 YAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCRF- 552
           YA     + ++ Q + A  P       K    +F   Y+   + +A++   +C FR    
Sbjct: 483 YAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIAMFAAHKCYFRITTG 542

Query: 553 ----IWKIGDVDIDSDRR--DIEAIVWEDHEPKTFW-DKFW 586
               I K+ +VD+D+ R   DIE I  E  E K F  +K W
Sbjct: 543 KWWGIKKLSEVDLDTGRVNIDIEIIKEEVAERKKFLRNKAW 583

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  261 bits (666), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 168/528 (31%), Positives = 279/528 (52%), Gaps = 26/528 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           Q   + R LK RH                     L+  GP   LI+Y  M    +SV   
Sbjct: 47  QKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQ 106

Query: 140 LGEMATFIPVTSSFTVFS--QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + EM T IP+    T++S  + +++       G+  +++ A+    E++    ++Q+WT 
Sbjct: 107 MTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWTD 166

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
             P A +ISIF V+   + + PVK +GE EFWV+SIK+L I+G +I    +  G G    
Sbjct: 167 ANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQE 225

Query: 258 --VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT-ELVGITAGEAANPR 314
             +GF YW+ PGA+ P ++  +   G+FL + +++I + F+F    E+V   A EA  PR
Sbjct: 226 HVLGFHYWKKPGAFKPYLV--EGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPR 283

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTS----PFIIAIENSG 370
           +++PRA K+ ++R+  FY+  +L +G++V Y++ +L  + +   +S    PF+I I+ +G
Sbjct: 284 RNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAG 343

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
            +VLPHI NA ILT+  S     +Y  SR L  ++    AP+ L+   K GVPY    +T
Sbjct: 344 IRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGIT 403

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           + F  LAY+  S     VF WL NI  ++GF +W+ +SI++IRF   +    ++ D +PF
Sbjct: 404 SLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPF 462

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWI---LFQC 546
           +      LAY A  F +I+ +  GF  F    ++  +F AAYI++   L +++   ++  
Sbjct: 463 RVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK 522

Query: 547 IFRCRFIWKIGDVDIDSDRRDIEAIVWEDHE-----PKTFWDKFWNVV 589
            +RCR I +I + DI       EA   E++E     P+ + +K W V+
Sbjct: 523 EWRCRDIAEI-EQDILPKITLAEA---EEYEYDIPVPRNWLEKIWMVI 566

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 171/558 (30%), Positives = 270/558 (48%), Gaps = 27/558 (4%)

Query: 44  EKSKELYPLRSFPTRVN-----------GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRH 92
           EKS  ++PL S   R              ED  +              +  +K+ +K RH
Sbjct: 27  EKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKHADSDLEDGSKSITSDDDHMKKAMKSRH 86

Query: 93  XXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIP-VTS 151
                                L  AGP   ++ Y  +  + Y + Q+ GEMA   P + +
Sbjct: 87  VIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYPTMPA 146

Query: 152 SFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVI 211
           SF  ++  F+S  FG A  +++   W     LEL      I++W   +    +I IF+V 
Sbjct: 147 SFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDTINPDVFIVIFYVF 206

Query: 212 ITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWG 270
           +  ++ F VK YGE EF   S K+L I GF+I    + CG AG  G +G +YW NPGA+ 
Sbjct: 207 LLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWINPGAF- 265

Query: 271 PGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILT 330
               + +    RF G    L+   F++ GTEL  ++  E  NPRKS P A K+ ++RIL 
Sbjct: 266 ----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQSIYRILI 321

Query: 331 FYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISA 389
            Y+ +++ IG  VP++  +L  +  S    SP+++A    G KV+PH  NAVIL +++S 
Sbjct: 322 IYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFINAVILISVVSV 381

Query: 390 ANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVF 449
           ANS +Y   R++  L++   APK+ +   + G P  A+ +   FG + ++  S   ++ F
Sbjct: 382 ANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVACSPQEEQAF 441

Query: 450 EWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTII 509
            WL  I G++  F W  I ISHIRF  A+K +G S +EL ++A      + Y+  F  ++
Sbjct: 442 TWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVYSVFFNMLV 501

Query: 510 IIIQGFTAFA-PKFNGVSFAAAYISIFLFLAVWILFQCIFRC-----RFIWKIGDVDIDS 563
            I Q + A + PK NG   A  +   +L   +W++F   +        F+  +  +D+D 
Sbjct: 502 FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLTPLDKIDLDF 561

Query: 564 DRR--DIEAIVWEDHEPK 579
            RR  D E +  ED E K
Sbjct: 562 HRRIYDPELLRQEDAETK 579

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/524 (31%), Positives = 262/524 (50%), Gaps = 25/524 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K+ +K RH                     L   GP G +I Y+   ++ Y V Q+  E
Sbjct: 75  KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCE 134

Query: 143 MA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           +  ++  +  ++  +    +   F  A  ++Y   WAI   LEL      I++W   +  
Sbjct: 135 LGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINP 194

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFR 261
             +++IF+  I  ++ F  + Y E EF   S KVL ++GF+I    + CGA  +G +G +
Sbjct: 195 DVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIGGK 254

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW  PGA+       +K    F G  S  + +AF + G+E + +TA E  NPRKSVP+A 
Sbjct: 255 YWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKAT 309

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVST--SPFIIAIENSGTKVLPHIFN 379
           K+ ++R+L  ++  ++ +G LVPY+ P L  S    ++  SPF+IA  + G KV+PHI N
Sbjct: 310 KRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIIN 369

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           AVIL ++IS  NS  Y   RIL  L++  + PK  +   + G P + +   A FG ++++
Sbjct: 370 AVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFV 429

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S   + VF WL  I  ++  F W  IS+SHIRF  A+K +G S  EL +KA      +
Sbjct: 430 AASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGS 489

Query: 500 YYAATFMTIIIIIQGFTAFAPKFNGVSFAA-AYISIFLFLAVWILFQCIFRCRF-IWKI- 556
           +YA  F  I++  Q + A AP  NG       +   +L   V + F   ++  +  WK+ 
Sbjct: 490 WYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLF 549

Query: 557 ---GDVDIDSDRR--DIEAIVWEDHEPK------TFWDK---FW 586
                VD++S R+  D + I  ED E K      +FW +   FW
Sbjct: 550 IPADKVDLESHRKIFDADLIKQEDFEHKERIRNSSFWVRALDFW 593

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  259 bits (663), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 165/521 (31%), Positives = 258/521 (49%), Gaps = 32/521 (6%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +KR LK RH                     +   GP+G ++ +   GS        
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+VII  +NLF V+ +GE EF  ++IK + + GF+I C  ++ G G     V
Sbjct: 194 DPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYV 253

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P K +P
Sbjct: 254 GAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLASGET-DP-KGLP 301

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IAI+    KVLP I 
Sbjct: 302 SAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAIKLHHIKVLPSIV 360

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           N VIL +++S  NS I+  SR L  ++   L P +     + G P + +   + FG LA+
Sbjct: 361 NVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 420

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S     VF WL+ I G+A    WL I++SHIRF  A+K +G   DEL F + +    
Sbjct: 421 LVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWG 480

Query: 499 AYYAATFMTIIIIIQGFTAFAP-----------KFNGVSFAAAYISIFLFLAVWILFQCI 547
           + Y+A    +I++ Q + +  P           K    ++  A I +F+F+A  I ++C 
Sbjct: 481 SAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLFIFIAHKIYYKC- 539

Query: 548 FRCRFIWKI---GDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
            +    W I    D+D+++DR+  DIE +  E  E K + D
Sbjct: 540 -QTGQWWGIKALKDIDLETDRKNIDIEIVKQEIAEKKMYLD 579

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  259 bits (662), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 167/527 (31%), Positives = 272/527 (51%), Gaps = 26/527 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
           + EV R LK RH                     L++ GP   LISY  M    +++   +
Sbjct: 61  STEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQM 120

Query: 141 GEMATFIPVT--SSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            EM   IP++  SS    +  +L+       G+  +++ ++    E++    +I++WT  
Sbjct: 121 TEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWT-D 179

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP- 257
              A +++IF ++ T+++L PVK +GE EF V+ IK+L I+G ++    +  G G     
Sbjct: 180 ANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHK 239

Query: 258 -VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRK 315
            +GF YW  PGA+   ++    + G FL    ++I + F F    E+    + EAA PRK
Sbjct: 240 VLGFHYWNTPGAFNSYLV--KGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRK 297

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSY----VSTSPFIIAIENSGT 371
           ++PRA ++ V+R+  FY+   L IG++V Y++  L ++ S      + SPF+I I+ +G 
Sbjct: 298 NMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGI 357

Query: 372 KVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTA 431
           ++LPHI NA ILT+  S + S +Y  SR+L  L+    APKF S+  K GVPY +V  T+
Sbjct: 358 RILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATS 417

Query: 432 AFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFK 491
            FG LAY+  S     VF WL NI  ++GF  W+F+SI+++RF +   Y  I+ D +P++
Sbjct: 418 LFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYR 476

Query: 492 AKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
            +    LAY +A F  ++ I  GF  F A  +N   F   Y++I  F+ V  +   I+  
Sbjct: 477 RRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIG-FVGVLFIGSSIYYK 535

Query: 551 RFIWKIGDVDIDSDRRDIEAIVWEDHE--------PKTFWDKFWNVV 589
              W   D+D+   R  +  I   D E        PK + ++ W +V
Sbjct: 536 E--WTFRDMDV-VGREIMPKIDQADQEEKEEYLPPPKNWVERVWRIV 579

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/474 (33%), Positives = 262/474 (55%), Gaps = 12/474 (2%)

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMY 173
           + + GP   LI++     +   ++Q +  M T++PVT SF  F++RF+  + G + G+ Y
Sbjct: 75  IIHGGPGSLLIAFCLWSVVFIGLSQCMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTY 134

Query: 174 WFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASI 233
           +   A     E++ V  V++FWT K+P AA ISI   +   +NLF V  +GE EF+++  
Sbjct: 135 FVCQAANVCFEITAVCLVVEFWTDKIPKAALISILIALFGSLNLFSVFIFGEGEFYLSIG 194

Query: 234 KVLAIIGFLIYCFCMVCGAGVTGPV-GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLIN 292
           KV+  IG + +   ++ G      V GF+ W NPGA+    ISK  + G+F G++S LI 
Sbjct: 195 KVILAIGLIFFTIVVMAGGNPQHKVLGFKNWSNPGAFAE-YISKG-SAGKFHGFMSCLIF 252

Query: 293 AAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQ 352
           A + F G + +G  A EA NPRK +P + +KV  R++ FYIG  + +G+LVP+ND  + +
Sbjct: 253 ALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIK 312

Query: 353 STSY----VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNK 408
           + S        SP++ A++  G  VLPHI N +ILT+IISA NS++Y  SR+L  L+   
Sbjct: 313 AISEGAVGAGASPYVSAMKTLGIGVLPHIVNVLILTSIISAGNSSLYSASRVLHRLALEG 372

Query: 409 LAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFIS 468
            APK L + TK GVP            LAY+  S   + V  W LN+   A    ++FI 
Sbjct: 373 QAPK-LFKITKRGVPIYCCVAVLLVCGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFIC 431

Query: 469 ISHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSF 527
           IS+++F +  K + I    LP+ +  +P L +++  ++ +++ + G+  F    ++  SF
Sbjct: 432 ISYLQFAKGCKAQNIDLKTLPYSSSFLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSF 491

Query: 528 AAAYISIFLFLAVWILFQCIFRCRFIWKIGDVDIDSDRRDI--EAIVWEDHEPK 579
             +Y  I  F+ ++   +   + RF+  + ++D+ S   ++  E   WE++ PK
Sbjct: 492 IFSYFMIPFFIVLFAGHKLYKKTRFVKPV-EMDLFSGIAELAEEDAYWEENPPK 544

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  258 bits (660), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/519 (30%), Positives = 256/519 (49%), Gaps = 28/519 (5%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
             + +KR LK RH                     +   GP+G ++ +   GS        
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           LGE+    PV  +F  +  RFL P+       +Y   W     LE+      +Q+W   +
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
               W++IF+ +I  +NLF  + +GE EF  +++K + + GF+I    ++CG G     +
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW +PG    G          F G ++ L+ A+++  G E+  + +GE  +P K +P
Sbjct: 255 GAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLASGET-DP-KGLP 302

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            AIK+V +RIL F++ SL  +G LVPY +  L   +S V  SPF+IA++    KVLP I 
Sbjct: 303 GAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSS-VDNSPFVIAMKLHHIKVLPTIV 361

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL +++S  NS I+  SR L  ++   L P +     + G P + +   + FG LA+
Sbjct: 362 NAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAF 421

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S     VF WL+ I G+A    WL I++SHIRF  A+K +G S DEL F + +    
Sbjct: 422 LVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWG 481

Query: 499 AYYAATFMTIIIIIQGFTAFAP-------KFNGVSFAAAYISIFLFLAVWILFQCIFRCR 551
           + Y+A    +I+I Q + +  P       K     F   Y+   + L ++++ +  ++C+
Sbjct: 482 SAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLFIFVVHKIYYKCQ 541

Query: 552 F-----IWKIGDVDIDSDRR--DIEAIVWEDHEPKTFWD 583
                 +  + D+D+++DR+  DIE I  E  E K   D
Sbjct: 542 TGKWWGVKSLKDIDLETDRKDIDIEIIKQEIMERKMHLD 580

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  258 bits (659), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/500 (30%), Positives = 254/500 (50%), Gaps = 26/500 (5%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +KR LK RH                     L   GP+  LI +   G+        LGE
Sbjct: 67  NLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGE 126

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           +    PV  +F  +S RFL P+       +Y   W     LE+      ++FWT  V   
Sbjct: 127 VTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPV 186

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            W+++F+ +I  +NLF V+++G+ +F  + IK++ I GF+I C  ++ G G T   +G R
Sbjct: 187 VWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGAR 246

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA   G          F G  + ++ A+++  G+E+  + +GE  +P K +P AI
Sbjct: 247 YWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLASGET-DP-KEIPHAI 294

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAV 381
           K++ +RI+ F++ SL  +G LVPY + +L   ++ V+ SPF+IAI+    +VLPHI N V
Sbjct: 295 KQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSN-VNNSPFVIAIKMHNIRVLPHIINGV 353

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441
           IL +I+S  NS I+  SR L  ++   L P+      + G P   +   + FG LA++  
Sbjct: 354 ILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVK 413

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S+    VF WL+ + G+A    WL I++SHIRF  A+K +G S DEL F + +    + Y
Sbjct: 414 SSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVY 473

Query: 502 AATFMTIIIIIQGFTAF-------APKFNGVSFAAAYISIFLFLAVWILFQCIFRCRF-- 552
           +     ++++ Q + +         P+    +F   Y+   + L +++  +  +R     
Sbjct: 474 SGVMNVVVLVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQ 533

Query: 553 IWKI---GDVDIDSDRRDIE 569
            WKI    ++D++S R++I+
Sbjct: 534 WWKILPLAEIDLESGRKNID 553

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 165/508 (32%), Positives = 261/508 (51%), Gaps = 22/508 (4%)

Query: 81  NAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSL 140
            A++K+ +K RH                     L  AGP G ++ Y+   ++ Y + ++ 
Sbjct: 62  TAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAA 121

Query: 141 GEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199
           GE+   +  +T ++T +S   + PA G +  ++Y   W   F L+L     +IQ+WT   
Sbjct: 122 GELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDIN 181

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGPV 258
           P   +++I + +I  +NLF  K Y E EF+    KVL IIGF+I    + CG AG +G +
Sbjct: 182 P-DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYI 240

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           G +YW  P  +  G          F G       AAF + G E++ ++A E  NPRKS+ 
Sbjct: 241 GDKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSIS 290

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
            A KKV++RI+  Y+ + + +  LVP + P L    S    SP +IA+   G K++PHI 
Sbjct: 291 SACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGS--RASPLVIAVSFHGVKIVPHII 348

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL  ++S  NS++Y   R+L  L++   APK  +   + G P  A FV   FG LA+
Sbjct: 349 NAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAF 408

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +  S   D VF WLL I+G++  F W+ I ISHIRF  A+K +G S  E+ +KA+     
Sbjct: 409 LAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWG 468

Query: 499 AYYAATFMTIIIIIQGFTAFAP-KFNGV---SFAAAYISIFLFLAVWILFQCIFRC-RFI 553
           ++ A     +I+I Q + A +P +  GV   SF  +Y++  + L  +  ++   +  R  
Sbjct: 469 SWIAVVTAFLILIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKDWRIC 528

Query: 554 WKIGDVDIDSDRR--DIEAIVWEDHEPK 579
               +VD+ S R+  D + +  ED E K
Sbjct: 529 IPASEVDLISHRQVFDEDELKQEDLEWK 556

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  258 bits (659), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/515 (31%), Positives = 264/515 (51%), Gaps = 19/515 (3%)

Query: 79  VQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQ 138
           V NA +K+ LK RH                     L+NAGP   LI Y  +    Y + Q
Sbjct: 94  VSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQ 153

Query: 139 SLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           + GE+A   P +  SF  ++ + +S  FG A  ++++  W   F +EL  +   ++FWT 
Sbjct: 154 AAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTT 213

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTG 256
           +V    ++ IF+V + I++   V+ YGE EF++   KVL +IGF+I+  C+  G AG +G
Sbjct: 214 RVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSG 273

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW +PGA+          EGRF G    L++A F++ GTEL  ++  E  NPRK+
Sbjct: 274 YIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKT 328

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS----TSYVSTSPFIIAIENSGTK 372
           +P A K  ++RI+  Y+ +++ +G  VP N P+L  S        S SP+++A      +
Sbjct: 329 IPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVR 388

Query: 373 VLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAA 432
           VLPH  NAV++  ++S +NS +Y   R++  L++    PK+     + G P  A+ +   
Sbjct: 389 VLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFI 448

Query: 433 FGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKA 492
            G +A+  +S   + +F WL  I G++  F W  I +SH+RF  A+K +G   +EL +K+
Sbjct: 449 IGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYKS 508

Query: 493 KLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIFRC- 550
                 + Y   F  ++   Q + A  AP   G   A+ +   +L L +W+ F   F   
Sbjct: 509 NTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYLALPIWLTFYVGFMLW 568

Query: 551 ----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
                F+  +  VD+DS RR  D E +  ED E K
Sbjct: 569 TRDFTFLIPLNKVDLDSYRRYYDPELLRQEDEEHK 603

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  255 bits (652), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 151/439 (34%), Positives = 224/439 (51%), Gaps = 14/439 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
            +KR LK RH                     L   GP+  +I +L  G+        LGE
Sbjct: 76  SLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGE 135

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
           +    PV  +F  +  RFL P+       +Y   W     LE+      IQFW   +   
Sbjct: 136 ITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPV 195

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-VGFR 261
            W++IF+V I  +NLF V+ +GE EF  +SIKV+ I GF+I C  ++ G G T   VG R
Sbjct: 196 VWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGAR 255

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW +PGA   G          F G  S  + A+++  G+E+  + +GE  +P K +P AI
Sbjct: 256 YWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP-KELPSAI 303

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAV 381
           K+V +RI+ F++ SL  +G LVPY +  L   +S V+ SPF+IA      KVLP I NAV
Sbjct: 304 KQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSS-VNNSPFVIACNLYHIKVLPSIINAV 362

Query: 382 ILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMET 441
           IL +I+S  NS I+  SR L  ++   L P+      + G P + +   + FG LA++  
Sbjct: 363 ILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVK 422

Query: 442 STGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYY 501
           S+   +VF WL+ I G+A    WL I++SHIRF  A+K +  + DEL F + +    + Y
Sbjct: 423 SSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSAVGIWGSVY 482

Query: 502 AATFMTIIIIIQGFTAFAP 520
           +A    +I+I Q + +  P
Sbjct: 483 SAVVNVLILIAQFYISLWP 501

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  256 bits (653), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 161/493 (32%), Positives = 246/493 (49%), Gaps = 21/493 (4%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           VKR LK RH                     L   GP+  L+ +  +G +A+++ +S+GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 144 ATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLAA 203
            T  P    FT  ++RF S +  A  GY Y   +    A E + +  + QFW  +VPL  
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYG 170

Query: 204 WISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV-GFRY 262
           +I IFW       +  V  +GE E+W++  K+L ++ F I+    + G     P  GF Y
Sbjct: 171 YILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHY 230

Query: 263 WRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAIK 322
           W NPGA   G          F G     +  +  + GTE V  +A E+ NP +++P AI+
Sbjct: 231 WNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIR 280

Query: 323 KVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIFNAVI 382
           +  +RIL  YIG   F G+ VPYND  L   T  +  SP  IAI  +G +   H+ NA I
Sbjct: 281 QTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALK-SPISIAITRAGWEGGTHLVNAFI 339

Query: 383 LTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYMETS 442
           L T ISA N ++++GSR +  L+   LAPKFL+ T + GVP  A+ +  A G ++ M  S
Sbjct: 340 LVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVS 399

Query: 443 TGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLAYYA 502
            G    + +++N++GV  F  W  I ++H+RF +A   +G +  ELP+KA   P      
Sbjct: 400 VGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIG 459

Query: 503 ATFMTIIIIIQGFTAFAPKFNGVSFAAAYI----SIFLFLAVWILFQCIFRCRFIWKIGD 558
                 + +IQG+T+F P F    F  AY+    +  L++ + +L    F+   +  I  
Sbjct: 460 IAANIFLALIQGWTSFVP-FKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTVDLLTI-- 516

Query: 559 VDIDSDRR-DIEA 570
            D+D  RR D++A
Sbjct: 517 -DLDEGRRVDLDA 528

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  257 bits (657), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 177/592 (29%), Positives = 287/592 (48%), Gaps = 26/592 (4%)

Query: 2   TNSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLKDEKSKELYPLRSFPTRVN- 60
           +N     D +   + +EP T L H    S    R   +P    KSKE+       T+   
Sbjct: 38  SNDYSQRDSDNTSIESEPRTKLVHRFVDS--FKRAQDVP-TGRKSKEIGNNGGSKTKGGF 94

Query: 61  GEDTFSMXXXXXXXXXXXVQNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPV 120
            ED+  +           + N  +K+ +K RH                     L   GP 
Sbjct: 95  EEDSLDLEGSDHDSI---ITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPA 151

Query: 121 GALISYLFMGSLAYSVTQSLGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAI 179
             +I Y+ +  + Y + Q+ GEMA   P +  +F  +S  F+S AFG A  +++   W  
Sbjct: 152 ALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLT 211

Query: 180 TFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAI 238
              LEL      I++W  K+    +I IF+V +  ++LF  V  YGE EF     K+L +
Sbjct: 212 VLPLELITASLTIKYWNDKINADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMV 271

Query: 239 IGFLIYCFCM-VCGAGVTGPVGFRYWRNPGAWGPGIISKDKNEG-RFLGWVSSLINAAFT 296
           IGF+I    +   GAG    +G ++W +PGA+        K  G RF G    L++  F+
Sbjct: 272 IGFIIMSIVINAGGAGNREYIGGKFWHDPGAFA------GKTAGSRFKGICYVLVSGYFS 325

Query: 297 FQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-S 355
           + GTEL  ++  E +NPR+S P+A K  ++RIL  Y+ +++ IG  VPY+  +L  S  S
Sbjct: 326 YGGTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGS 385

Query: 356 YVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLS 415
               SP+++A   +G K+ PH  NAVIL ++IS ANS++Y   R++  L++   APKFL 
Sbjct: 386 ATHASPYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLD 445

Query: 416 RTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFM 475
              + G P +A+      G + ++  S   ++VF WL  I G++  F W  I +SH+RF 
Sbjct: 446 YVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFR 505

Query: 476 QALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISI 534
            A+K +  S +EL +KA      + Y   F  ++   Q +TA  P   +G + A ++ + 
Sbjct: 506 MAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFAN 565

Query: 535 FLFLAVWILFQCIFRC-----RFIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
           +L + +W++F   +       + +  +  +D+D  RR  D E +  ED E K
Sbjct: 566 YLAMPIWLVFYFGYMLWTRDFQLLKPLDKIDLDFHRRIYDPELMRQEDEESK 617

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  255 bits (652), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 166/488 (34%), Positives = 265/488 (54%), Gaps = 19/488 (3%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ R LK RH                     L   GP    I+Y  +G + Y     L E
Sbjct: 49  DLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAE 108

Query: 143 MATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW---TYKV 199
           M+T++P++ SF  ++++F S +F  A  + YWF+ A++ A +L+ +  V+ +W   +   
Sbjct: 109 MSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHF 168

Query: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP-V 258
           P  A   IFW  +  +N+  V++YGE E+W+A +KV+AII F I    +  G       +
Sbjct: 169 PYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYI 228

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
           GF+ W          + +      F G+ S  ++A+F + GTE + +T+GE+ NP ++ P
Sbjct: 229 GFKNWT---------VGEAPFVDGFKGFASLFVSASFAYGGTESITLTSGESDNPLRNTP 279

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHIF 378
           + +K V +RIL FYIG+  FI + VPYN P L  S+  V TSPF I  + +GT       
Sbjct: 280 KIVKTVFWRILFFYIGTTFFIAMNVPYNYPGL--SSGSVVTSPFTIVFKMAGTAGAGSFM 337

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPK-FLSRTTKGGVPYIAVFVTAAFGALA 437
           NAVI+T++ISA N  ++ GSRI++ +      PK  +SRT +  VPY+AV +T A G L 
Sbjct: 338 NAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLC 397

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           +  +  G   ++ WL NI GV+   AWL I+I+ IRF Q L+ +  +  EL FK    P 
Sbjct: 398 FGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQNKTH-ELKFKNWTYPF 456

Query: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIWKIG 557
             Y+    +T II++QG+++FAP +N  +F + YI +F+F   +I++    R  F+ K  
Sbjct: 457 GPYFLVVAVTFIILVQGWSSFAP-WNVSNFFSVYIELFVFPFCFIIWWLYKRDPFV-KCK 514

Query: 558 DVDIDSDR 565
           D+D  +D+
Sbjct: 515 DMDFVTDK 522

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  256 bits (653), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 154/495 (31%), Positives = 254/495 (51%), Gaps = 21/495 (4%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ + ++ RH                     L+ +GP+G +I Y+    + + + Q+ GE
Sbjct: 83  DLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGE 142

Query: 143 MA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           +   +  V  +FT +    + PAFG A  ++Y   W I   L+L      IQFW   V L
Sbjct: 143 LGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFWNVGVNL 202

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGF- 260
             ++   +V++ ++NL   + Y E EF+    K++ + GF+I    +  G    GP G+ 
Sbjct: 203 DVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGYI 262

Query: 261 --RYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318
             +YWRNPG +  G          F G  S    AAF++ G E + ++A E  NP KS+P
Sbjct: 263 GGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLVLSAAEQKNPLKSIP 312

Query: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL-TQSTSYVSTSPFIIAIENSGTKVLPHI 377
            A KKV++RIL  Y+ SL+ +  LVPY  P L   S S   +SPF+IAI + G  V+PH+
Sbjct: 313 SATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFVIAIASHGVSVVPHL 372

Query: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437
            NAVIL +++S ANS +YV  R+L  L++   APKFL+   K G P     V   FG + 
Sbjct: 373 INAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFGMIG 432

Query: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497
           ++  S   + VF WLL+I+G+   F W+ I +SHIRF  A++ +G    E+ +KA+    
Sbjct: 433 FVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQTGYW 492

Query: 498 LAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
            +Y A      +++ Q + A AP     K +  +F   Y++  + L  ++ F+  ++  +
Sbjct: 493 GSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYYKQWQ 552

Query: 552 FIWKIGDVDIDSDRR 566
            +     +++D++R 
Sbjct: 553 LLIPADKIELDNNRN 567

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  256 bits (655), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 166/583 (28%), Positives = 284/583 (48%), Gaps = 32/583 (5%)

Query: 3   NSKEDADIEEKHMYNEPVTTLFHDVEASQTHHRRGSIPLK-DEKSKELYPLRSFPTRVNG 61
           N ++D  I+E      P +   ++   ++   R  +I  K DE+S++    +    +   
Sbjct: 2   NDRDDLLIDEAS--TAPYSHSLYERANAEKQKRDFAITEKQDEESEQQVKPQKTGNKSKL 59

Query: 62  EDTFSMXXXXXXXXXXXVQNAEVK--------RELKQRHXXXXXXXXXXXXXXXXXXXXP 113
           ++                QN+E++        + +K RH                     
Sbjct: 60  QNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQV 119

Query: 114 LTNAGPVGALISYLFMGSLAYSVTQSLGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYM 172
           L  AGP G ++ Y     + Y + Q+ GE+   +  +T ++T +    + P+ G A   +
Sbjct: 120 LGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVV 179

Query: 173 YWFSWAITFALELSVVGQVIQFWTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVAS 232
           Y   W     L+L      +++WT  V    ++++ ++ + I+NLF  + Y E EF    
Sbjct: 180 YTIQWLTVLPLQLVTAAMTVKYWT-SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNI 238

Query: 233 IKVLAIIGFLIYCFCMVCG-AGVTGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLI 291
            K+L +IGF+I    + CG AG    +G  YW NPG +  G          F G  +   
Sbjct: 239 CKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFAHG----------FKGVCTVFC 288

Query: 292 NAAFTFQGTELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL- 350
            AAF++ G E++ ++A E  NP KS+P A KKVV+RIL  Y+ + + +  LVPYN  +L 
Sbjct: 289 YAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSDELL 348

Query: 351 -TQSTSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKL 409
            +  +S    SPF+IA+ + G KV+PH  NAVIL ++IS ANS++Y G R+L  L++  +
Sbjct: 349 GSDDSSGSHASPFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGV 408

Query: 410 APKFLSRTTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISI 469
            PK L+   + G P +   V+ AFG + ++ TS   ++VF WLL I+ ++  F W+ +S+
Sbjct: 409 LPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSL 468

Query: 470 SHIRFMQALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAP-----KFNG 524
           SHIRF  A+  +G S +E+ +KA+     ++ A       ++ Q + A AP     K N 
Sbjct: 469 SHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNV 528

Query: 525 VSFAAAYISIFLFLAVWILFQCIFRCRFIWKIGD-VDIDSDRR 566
             F   Y+++ + L  +   +  F+    W   D +D++S R 
Sbjct: 529 KVFFQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDLNSHRN 571

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 160/512 (31%), Positives = 263/512 (51%), Gaps = 19/512 (3%)

Query: 84  VKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGEM 143
           +++ ++ RH                     +  AG  G LI Y  +G +     QS+GE+
Sbjct: 41  LRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLVCCMQSVGEL 100

Query: 144 ATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPLA 202
               P ++  F  + +RF+ P+ G +  +++   W I   LEL      I++W   +  +
Sbjct: 101 VVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIKYWNASLSPS 160

Query: 203 AWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGPVGFR 261
            ++S+F+ +I ++N F    Y E EF   S+KV+ IIGF+I    +  G  G +G +GFR
Sbjct: 161 LFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTGCVGTSGTIGFR 220

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA--NPRKSVPR 319
           Y  +PG +       +KN         +L+NAAF+  G E + ++A E    N  KS+ R
Sbjct: 221 YLIDPGMF-------NKNYNIIKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPKSIGR 273

Query: 320 AIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTS-YVSTSPFIIAIENSGTKVLPHIF 378
           A  +V  RI  FY+ S+  +GLLVP+N P L  S S  + +SP++ A+  +G  V+PHI 
Sbjct: 274 ACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSSPYVAAVAMNGITVVPHII 333

Query: 379 NAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAY 438
           NAVIL  +IS ANS +Y  SR L  L++   APK+ ++  K G P   +F++A FG +++
Sbjct: 334 NAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMRCLFISALFGLISF 393

Query: 439 METSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGL 498
           +      + +F WLL+I+G++  F W  I I+HIRF  A+K RG S + L +K+      
Sbjct: 394 VAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSLETLGYKSITGVAG 453

Query: 499 AYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-RF 552
           +Y A     +I+++Q + +  P     K N V F   Y+++ + L  +I  +   +    
Sbjct: 454 SYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLFYIGHKVYTKNWSL 513

Query: 553 IWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDK 584
           + +  +VDI +D RDI     ED + K     
Sbjct: 514 LIRASNVDITTD-RDIYCPTIEDPKIKVLMQN 544

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/528 (30%), Positives = 268/528 (50%), Gaps = 32/528 (6%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           +++R LK RH                     L+  GP   LISY+ M    +++   L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 143 MATFIPV--TSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           M    P+   +S    ++ +L+       G+  +++ A+    E++    +IQ+WT    
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWT-DAN 176

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP--V 258
            A ++SIF VI   +   PVK +GE EFWV+ IK++ I G +I    +  G G      +
Sbjct: 177 SAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVL 236

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTF-QGTELVGITAGEAANPRKSV 317
           GF YW++PGA+ P I     N G+FL   +++I + F F    E +   + EA  PR+++
Sbjct: 237 GFHYWKHPGAFKPHI--STGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNM 294

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS----TSYVSTSPFIIAIENSGTKV 373
           PRA  + V+R++ FYIG  L +G+ V Y++  L  +     S  + SPF+I I+  G KV
Sbjct: 295 PRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKV 354

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHI NA ILT   SA  + +Y  SR+L  ++    APK  +R  + GVPY ++ V + F
Sbjct: 355 LPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCF 414

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAY+  S    +VF WL NI+ ++GF +W+F+SI+++RF + + Y  ++ D + F+  
Sbjct: 415 CFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKP 473

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVS-FAAAYISIFLFLAVWILFQCIFRCRF 552
                AY++  F  I+ +  G+  F      VS F A YI+I   + ++I+    ++   
Sbjct: 474 FQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKE-- 531

Query: 553 IWKIGD-----------VDIDSDRRDIEAIVWEDHEPKTFWDKFWNVV 589
            W+  D           +D+  +    E ++    EP T++ K  NV+
Sbjct: 532 -WRFRDMEEIRSELIPKIDMADEEESNEIVI----EPTTWYGKLGNVL 574

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  254 bits (649), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 151/493 (30%), Positives = 249/493 (50%), Gaps = 14/493 (2%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++K  +K RH                     L   GP G LI YL   ++ Y V Q+  E
Sbjct: 70  KLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYLTTSTMLYCVVQACCE 129

Query: 143 MAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVPL 201
           +   +  +  ++  +    +   FG A   +Y   WAI   LEL      I++WT  V  
Sbjct: 130 LGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELVTASMTIKYWTESVNP 189

Query: 202 AAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPVGFR 261
             +++IF++ I  ++ F  + Y E EF   ++KVL + GF+I    + CGA   G +G +
Sbjct: 190 DVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGISLNCGASKLGYIGAK 249

Query: 262 YWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVPRAI 321
           YW NPG +     + +++     G  S  + +AF + G+E + +TA E ANPR+SVP A 
Sbjct: 250 YWSNPGTF-----AGERSINHLKGICSVWVQSAFAYGGSEFIALTAAEQANPRESVPSAT 304

Query: 322 KKVVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIENSGTKVLPHIFN 379
           K+ ++R++  ++  +  I  LVPY   +L  +   S    SPF+IA    G K++PHI N
Sbjct: 305 KRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVIAAAYHGVKIVPHIIN 364

Query: 380 AVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALAYM 439
           A+ILT++IS  NS +Y   RIL  L++N L PK  +   + G P   +     FG L+++
Sbjct: 365 AIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPLATLLFVCVFGLLSFV 424

Query: 440 ETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPGLA 499
             S   + VF WL  I G++  F W  I++SHIRF  A+K +G S  EL + +      +
Sbjct: 425 AASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRSLGELGYTSTTGAIGS 484

Query: 500 YYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFR-----CRFI 553
           YYA  F  ++++ Q + A AP   +G   A ++   +L  AV +LF   ++      + +
Sbjct: 485 YYAVFFNIVVLVAQFWIAIAPIDKHGELDAESFFKNYLAFAVLVLFYVGYKIWYREVQLL 544

Query: 554 WKIGDVDIDSDRR 566
             +  +D+++ R+
Sbjct: 545 IPVDKIDLETHRQ 557

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  253 bits (647), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 163/514 (31%), Positives = 260/514 (50%), Gaps = 21/514 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
            + + K+ L  RH                     L   GP   +I Y+ +  + Y + Q+
Sbjct: 73  SDTQFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQA 132

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GEMA   P +  +F  +   F+S ++G A  +++   W     LEL      I++W  K
Sbjct: 133 AGEMAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYWNDK 192

Query: 199 VPLAAWISIFWVIITIMNLFP-VKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTG 256
           +    ++ IF+V +  ++L   ++ YGE EF   S K+L +IGF+I    +   GAG  G
Sbjct: 193 INADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDG 252

Query: 257 PVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKS 316
            +G +YW  PG++  G         RF G    L++  F++ GTEL  ++  E A PRK+
Sbjct: 253 YIGGKYWHEPGSFAEG-----DATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKA 307

Query: 317 VPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLP 375
            P A KK ++RIL  Y+ +++ IG  VP+N+ +L  +  S    SP+++A    G K++P
Sbjct: 308 TPAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHASPYVLAATIHGVKIVP 367

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL ++IS ANS+++ G R+L  L+    APK LS   + G P +A+ ++   G 
Sbjct: 368 HFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGL 427

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           +A++  ++  ++VF WL  I G++  F W  I  SH+RF  A+K +G   +EL +KA   
Sbjct: 428 IAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTG 487

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAPKFNGVSF-AAAYISIFLFLAVWILFQCIFRCRFIW 554
              + Y A F  +++I Q + A AP  NG    A A+   +L   +W+   C F      
Sbjct: 488 VWGSAYGAFFGVLVLIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWV--ACYFGYMIYN 545

Query: 555 K-------IGDVDIDSDRR--DIEAIVWEDHEPK 579
           K       +  +D+DS RR  D E I  ED E K
Sbjct: 546 KDFTLLSPLDKIDLDSYRRIYDPELIKQEDEENK 579

>SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 598

 Score =  253 bits (647), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 150/497 (30%), Positives = 260/497 (52%), Gaps = 19/497 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +N ++K+ +K  H                     +++AG  G L+ Y  +GS+     QS
Sbjct: 66  ENEKLKQSIKPYHVFMITMATGIGTGLLVGNGKSISDAGVGGTLVGYFIIGSMLVCCMQS 125

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           +GE+    P +   F  + +RF+ P+FG    +++   W I   LEL      I++W   
Sbjct: 126 VGELVVAFPSLAGGFNSYGKRFVDPSFGFTVAWLFCLQWQIVLPLELVTASMTIKYWNNS 185

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGP 257
           +  + +++IF+ +I  ++ F  + Y + EF     KVL I GF+I    +  GA G +G 
Sbjct: 186 LNPSIFVAIFYSLILGISFFGARGYADAEFLFNLSKVLMITGFIILGIIISFGAAGTSGY 245

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA--NPRK 315
           +G +Y + PGA+             F    S+L+NA F+  G E + ++A E A  N  K
Sbjct: 246 IGIKYLKTPGAF--------NTRNTFKSICSTLVNACFSCGGVEFLALSAAEQARGNISK 297

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTS-YVSTSPFIIAIENSGTKVL 374
           S+ RA  +V+ R+  FYI S+  IGLLVPYN P+L  S+S  + +SP++IA+ + G KV+
Sbjct: 298 SIKRACGQVLVRMCVFYILSIFVIGLLVPYNSPELMGSSSEIIHSSPYVIAVASHGVKVV 357

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           PH+ NAVIL  ++S ANS +Y  SR L  L++   AP + ++    G P+  + V+  FG
Sbjct: 358 PHLINAVILIAVVSVANSAMYSSSRTLHALAEQGFAPSYFAKLDSKGRPFRCLVVSGVFG 417

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            L+++      + VF WLL+I+G++  F W  I ++H+RF  A+K +  S +EL  +A  
Sbjct: 418 LLSFIAEYKDQESVFVWLLSISGLSTIFTWTMICVAHLRFRAAMKDQNHSLEELGHRAWS 477

Query: 495 MPGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFR 549
               +YY     ++ +++Q + +  P     + + V+F   Y+++   L +++  +   R
Sbjct: 478 GIYGSYYVIAINSLTLVVQFWVSLFPLDGDGRPDFVNFFQNYMAVPFALCLYVGHKIYTR 537

Query: 550 C-RFIWKIGDVDIDSDR 565
             +FI     +D+D+ R
Sbjct: 538 SWQFIIPADKIDVDTSR 554

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  254 bits (648), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/497 (30%), Positives = 255/497 (51%), Gaps = 21/497 (4%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           +   +++ +K RH                     L  AGP G ++ Y     + Y + Q+
Sbjct: 86  EKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+   +  +T ++T +S   + P+ G A   +Y   W     L+L      +++WT  
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-N 204

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           V    ++++ ++ + I+NLF  + Y E EF     K+L + GF+I    + CG AG    
Sbjct: 205 VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRY 264

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW NPG +  G          F G  +    AAF++ G E++ ++A E  NP +S+
Sbjct: 265 IGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESI 314

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--TQSTSYVSTSPFIIAIENSGTKVLP 375
           P A KKVV+RIL  Y+ + + IG LVPYN  +L  + S+S    SPF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVP 374

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           H  NAVIL ++IS ANS++Y G R+L  L++  + PK L+   + G P +   V+ AFG 
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGC 434

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           + ++ TS   ++VF WLL I+ ++  F W+ + +SHIRF  A+  +G S DE+ +KA+  
Sbjct: 435 IGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTG 494

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAYISIFLFLAVWILFQCIFRC 550
              ++ A       ++ Q + A AP     K +   F   Y+++ + L  +   +  F+ 
Sbjct: 495 YWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKMYFKS 554

Query: 551 -RFIWKIGDVDIDSDRR 566
            RF      +D+DS R 
Sbjct: 555 WRFWIPAEKIDLDSHRN 571

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  251 bits (642), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 154/495 (31%), Positives = 256/495 (51%), Gaps = 15/495 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
              ++K+ LK RH                     L   GPVG LI+Y+ +G +      +
Sbjct: 42  DRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIA 101

Query: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFAL----ELSVVGQVIQFW 195
           + E+A+F+P T +    S++F+  A G      + F W  T++     ELS    V+ +W
Sbjct: 102 IAEVASFMPATGATIRHSEQFIDEAVG------FTFGWISTYSSLMPGELSATAVVMTYW 155

Query: 196 TYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVT 255
           T   P A +I+IF V+  + N++ +++YGE E++   +K+  I   +I    +  G    
Sbjct: 156 TDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGTKQ 214

Query: 256 GPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRK 315
             +GF YWRNPG +   ++  D   G+F+G+ ++L +  +++ G + + I AGE  N R 
Sbjct: 215 ERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 272

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVLP 375
           ++    K V  RI+  Y+ ++  + L+VPYND  +   +    +SPF+IA+E +G KVLP
Sbjct: 273 AIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIATGSGNARSSPFVIAMERAGIKVLP 332

Query: 376 HIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGA 435
           HI NA+ILT+  SA N  I  GSR LF L+    APK   +T+K G+P++ V   ++F  
Sbjct: 333 HIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLP 392

Query: 436 LAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLM 495
           LAYM  S     VF W   +        W+ IS +HI   +AL+ +G SR +LP+   + 
Sbjct: 393 LAYMSCSESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIA 452

Query: 496 PGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIW 554
           P  A+++     I ++  GF  F    F+  SF + Y  I L +A++  ++   + R++ 
Sbjct: 453 PYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYL- 511

Query: 555 KIGDVDIDSDRRDIE 569
           +  +VD+ S   DI 
Sbjct: 512 RPHEVDLQSIFEDIR 526

>TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON} 
          Length = 615

 Score =  253 bits (645), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 163/513 (31%), Positives = 254/513 (49%), Gaps = 20/513 (3%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++ E+K+ +K RH                     L  +GP   +I Y  +  + Y + Q+
Sbjct: 93  ESTELKKAMKSRHVVMMSLGTGIGTGLLVANAKGLAISGPAPLVIGYGLVSFITYFMIQA 152

Query: 140 LGEMA-TFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
            GE+  T+  +  +F V+    +S  FG A  ++    W     LEL      I++WT K
Sbjct: 153 AGELGVTYASLPGNFNVYFGTLVSRPFGFATVWLASVQWLTVIPLELITCAITIKYWTEK 212

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCM-VCGAGVTGP 257
           V    ++ I +V +  +++F VK YGE EF   + K+L I GF+I    + V GAG  G 
Sbjct: 213 VNGDIFVLIIYVFLLFIHIFGVKAYGEAEFLFNTCKILMIAGFIILSIVINVGGAGNDGY 272

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G  YW NPGA+     + D    RF      L+   F++ GTEL  ++  E  NPRKS 
Sbjct: 273 IGGSYWNNPGAF-----ASDNAASRFKSICYILVTGYFSYGGTELFVLSVNEQENPRKST 327

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQST-SYVSTSPFIIAIENSGTKVLPH 376
           P+A K  ++RIL  Y+ +++ IG  VP++  +L  S  S    SP+++A    G KV+PH
Sbjct: 328 PQAAKHSIYRILVIYLLTMILIGFNVPHDSDQLMGSAGSSAHASPYVLAASLHGVKVVPH 387

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL  +IS ANS++Y   R++  L++   APKFL+   + G P + + V A FG +
Sbjct: 388 FINAVILIALISVANSSLYAAPRMMVSLAQQGFAPKFLTYVDREGRPLLGIAVCAVFGVI 447

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
            +  +S   + VF WL  I G++  F W    +SHIRF QA+K +G +  E  + +    
Sbjct: 448 GFAASSDKEEDVFTWLAAIAGLSELFTWSAFFLSHIRFRQAMKVQGKNIKECGYLSVTGI 507

Query: 497 GLAYYAATFMTIIIIIQGFTAFAPKFN-GVSFAAAYISIFLFLAVWILFQCIFRCRFIWK 555
             +     F  ++ I Q + A +P  N G   A A+   +L   +W+ F   F C F +K
Sbjct: 508 WGSIIGLCFNILVFIAQFWVALSPIGNDGKCDAQAFFQSYLAFPIWLAFY--FGCMFYYK 565

Query: 556 -------IGDVDIDSDRR--DIEAIVWEDHEPK 579
                  +  +D+D  RR  D E +  ED   K
Sbjct: 566 DYTLLNPLESIDLDDHRRIYDPEELKKEDLATK 598

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  251 bits (641), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 154/509 (30%), Positives = 254/509 (49%), Gaps = 42/509 (8%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           + A +++ +K RH                     +  AG  G LI YL +G +     QS
Sbjct: 21  EPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQS 80

Query: 140 LGEMATFIP-VTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
           +GE+    P +   F  + ++F+ P+ G    +++   W +   LEL      I++W   
Sbjct: 81  VGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSN 140

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGA-GVTGP 257
           +  + ++S F+++I I+N F    Y E EF    +KV+ +  F++    ++ G  G +GP
Sbjct: 141 LSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGP 200

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAA--NPRK 315
           +GF+Y + PGA+       + N   F     +L+NAAF+  G E + ++A E    N  K
Sbjct: 201 IGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPK 253

Query: 316 SVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVS-TSPFIIAIENSGTKVL 374
           S+ RA ++V  R+  FY+ S+  +GLLVPY+ P L  S S  + TSP++ AI   G +++
Sbjct: 254 SIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIV 313

Query: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434
           PHI NAVIL  ++S ANS +Y  SR L  L++   AP++ +   K G P   + V+A  G
Sbjct: 314 PHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVG 373

Query: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494
            ++++      + VF WLL+I+G++  F W  I I+HIRF  ALK +G S D L +++  
Sbjct: 374 LISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRSNT 433

Query: 495 MPGLAYYAATFMTIIIIIQGFTAFAP-----KFNGVSFAAAY----ISIFLFLA------ 539
               +Y A     ++II+Q + +  P     K + V F   Y    +++ L+L       
Sbjct: 434 GVIGSYIATAINVVVIIVQFWVSLFPLENNGKPDAVKFFQNYMAVPVAVLLYLGHKLYTN 493

Query: 540 ---VWILFQCIFRCRFIWKIGDVDIDSDR 565
               WI   C            VDI++DR
Sbjct: 494 DWTPWIRTHC------------VDINTDR 510

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/525 (30%), Positives = 270/525 (51%), Gaps = 32/525 (6%)

Query: 83  EVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQSLGE 142
           ++ R LK RH                     L+  GP   LI+Y+ +    +S+   + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 143 MATFIPVTSSFTVFS--QRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKVP 200
           M   IP+    +++S  + +L+       G+  +++ A+    E++    ++Q+WT    
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT-DAN 172

Query: 201 LAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP--V 258
            A +ISIF V+  ++ + PVK +GE EFWV+SIK+L I+G +I    +  G G      +
Sbjct: 173 SAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVL 232

Query: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT-ELVGITAGEAANPRKSV 317
           GF YW+NPGA+ P +   + N GRFL   +++I + F+F    E V   + E   PR+++
Sbjct: 233 GFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNM 290

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS----TSYVSTSPFIIAIENSGTKV 373
           P+A ++ ++R+  FYI   L +G++V +N+ +L  +     S  + SPF+I I+ +G K+
Sbjct: 291 PKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKI 350

Query: 374 LPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAF 433
           LPHI NA ILT+  S     +Y  SR L+ ++    APK  ++  + G PY +  + + F
Sbjct: 351 LPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLF 410

Query: 434 GALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAK 493
             LAY+  S     VF WL NI  ++GF +W+F+S+++IRF + +    ++ D +PF+  
Sbjct: 411 SFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRP 469

Query: 494 LMPGLAYYAATFMTIIIIIQGFTAFAP-KFNGVSFAAAYIS----IFLFLAVWILF-QCI 547
               LAY    F  I+ +  G+  F    +N   F A+Y++    IFL+L     + Q  
Sbjct: 470 FQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYKQWT 529

Query: 548 FR------CRFIWKIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFW 586
           FR         + KI D+  + +R D+  +      P+ F +K W
Sbjct: 530 FRDFKEIEVEILPKI-DIADEEERNDVIPV------PRNFMEKVW 567

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 156/529 (29%), Positives = 265/529 (50%), Gaps = 34/529 (6%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           Q  +V R+LK RH                     L+  GP   LISY+ M    + +   
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 140 LGEMATFIPVTSSFTVFSQR--FLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTY 197
           L EM   +P++   ++F+    +L+       G   +++ ++    E++    +IQ+WT 
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT- 181

Query: 198 KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGP 257
               A +ISIF V+   + + PV ++GE EFWV+ IK+  I G +I    +  G      
Sbjct: 182 DANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 258 --VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGT-ELVGITAGEAANPR 314
             +GF YW++PGA+ P ++    N G+FL   +++I + F++    E+V   A EA +PR
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPG--NTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPR 299

Query: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQS----TSYVSTSPFIIAIENSG 370
           +++PR  ++ V+R+  FY+   L IG++V Y++ +L  +     S  + SPF+I I+  G
Sbjct: 300 RNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVG 359

Query: 371 TKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVT 430
            +VLPHI NA ILT+  S   S +Y  SR+L  ++ N   PK  + T + G PY +    
Sbjct: 360 IRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAA 419

Query: 431 AAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPF 490
           + F  LAY+  S     VF WL NI  ++GF  W+ + + ++RF + +++  ++ D++PF
Sbjct: 420 SVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPF 478

Query: 491 KAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISI----FLFLAVWILFQ 545
           + + M  LAY +  F  I+ +  G+  F A  +N   F A Y ++     L++   I ++
Sbjct: 479 RKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

Query: 546 CIFRCRFIWKIGDVDIDSDRRDIEAIVWEDHE--------PKTFWDKFW 586
            I       K+ D+D +     I  I   D E        PK + +K W
Sbjct: 539 TI-------KLRDLD-EVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  249 bits (637), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 266/510 (52%), Gaps = 15/510 (2%)

Query: 80  QNAEVKRELKQRHXXXXXXXXXXXXXXXXXXXXPLTNAGPVGALISYLFMGSLAYSVTQS 139
           ++  +K+ ++ RH                     L N GP   +I Y  + S+ Y V QS
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 140 LGEMAT-FIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYK 198
             E+A  +  +   F  +    +  AFG +  ++Y   W     LEL      I++W   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 199 VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCG-AGVTGP 257
           +   A+++IF+V++  +N      Y E EF+    KVL IIGF I    + CG AG  G 
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 258 VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSV 317
           +G RYW +PGA+         +  RF G V+ L+NAAF + G E   +TA E  NP+KS+
Sbjct: 257 LGARYWHDPGAF-----RGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 311

Query: 318 PRAIKKVVFRILTFYIGSLLFIGLLVPYN-DPKLTQSTSYVSTSPFIIAIENSGTKVLPH 376
             A KK+V+RIL  YI + + +G LVP+N D  L    S    SPF+IA+ + G +V+PH
Sbjct: 312 RSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPH 371

Query: 377 IFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGAL 436
             NAVIL +++S ANS +Y  SRIL  LS+   AP+FL+   + G P + + V+  FG L
Sbjct: 372 FINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLL 431

Query: 437 AYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMP 496
           +++  S   + VF WLL I+G++  F W  IS+SH+R  +A+  +G S DEL + A    
Sbjct: 432 SFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGV 491

Query: 497 GLAYYAATFMTIIIIIQGFTAFAP----KFNGVSFAAAYISIFLFLAVWILFQCIFRC-R 551
             AYYA   +  I++ Q + A +P    K +  +F   Y+++ + + +++ ++   R  R
Sbjct: 492 WGAYYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWR 551

Query: 552 FIWKIGDVDIDSDRR--DIEAIVWEDHEPK 579
            +    +VD+ + R+  D E +  E  E K
Sbjct: 552 LLIPSSEVDLVAHRKIFDAEVLRHEQLEEK 581

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.140    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,372,768
Number of extensions: 2274262
Number of successful extensions: 8820
Number of sequences better than 10.0: 404
Number of HSP's gapped: 7573
Number of HSP's successfully gapped: 418
Length of query: 590
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 475
Effective length of database: 40,294,809
Effective search space: 19140034275
Effective search space used: 19140034275
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)