Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL062W (NPR2)6.17ON61561527370.0
Skud_5.276.17ON61561523580.0
Smik_5.256.17ON61561523440.0
Suva_5.56.17ON61962023330.0
ZYRO0C07876g6.17ON68149113990.0
TDEL0G045206.17ON67949313830.0
CAGL0L13288g6.17ON64666413221e-175
KNAG0M011406.17ON59463912891e-171
Kpol_1045.726.17ON69550712871e-169
SAKL0E01100g6.17ON71051312731e-167
KAFR0L003806.17ON54062412361e-164
KLTH0C11308g6.17ON69054512041e-157
ACR009W6.17ON68050011881e-154
TPHA0J003106.17ON67568411531e-149
TBLA0G010106.17ON71036810751e-137
Kwal_56.224116.17ON68935310611e-135
Ecym_30216.17ON67435110551e-135
KLLA0D01067g6.17ON66033810481e-134
NCAS0H008706.17ON61235210361e-132
NDAI0D008606.17ON6661615812e-65
Suva_4.3213.307ON138254790.64
SAKL0H21450g4.93ON37494761.1
Suva_10.5737.518ON2633141771.2
ZYRO0F17578g1.45ON81033707.1
KNAG0C005101.45ON78033708.3
NDAI0C054008.520ON183899699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL062W
         (615 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...  1058   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   912   0.0  
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   907   0.0  
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    903   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   543   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   537   0.0  
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   513   e-175
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   501   e-171
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   500   e-169
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   494   e-167
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   480   e-164
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   468   e-157
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   462   e-154
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   448   e-149
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   418   e-137
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   413   e-135
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   410   e-135
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   408   e-134
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   403   e-132
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   228   2e-65
Suva_4.321 Chr4 complement(568645..572793) [4149 bp, 1382 aa] {O...    35   0.64 
SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]...    34   1.1  
Suva_10.573 Chr10 (998844..1006745) [7902 bp, 2633 aa] {ON} YLR4...    34   1.2  
ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} high...    32   7.1  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    32   8.3  
NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_...    31   9.3  

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score = 1058 bits (2737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/615 (86%), Positives = 532/615 (86%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQLLSKSERDPVFFDLKVLE                            EKDTKDMRSSR
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
           KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
           D                                            IYKDWRQSQTSCSSS
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480
           NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR
Sbjct: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540
           IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL
Sbjct: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540

Query: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600
           KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV
Sbjct: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600

Query: 601 ESYLNELGEFKVINS 615
           ESYLNELGEFKVINS
Sbjct: 601 ESYLNELGEFKVINS 615

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/615 (73%), Positives = 490/615 (79%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNT KNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQLLSKSE+D VFFDLK LE                            +KD KD+RSSR
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+DL KDLGLP+S+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLS SDP LVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
           KCVTLSDIFQFSNIYAPSSLIR FLTD LMASDCQSYV FPE+SK+S+LPL+K+L S D+
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
           D                                            + KDWRQSQTS SSS
Sbjct: 361 DSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSS 420

Query: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480
           N+   +NRNRFLPTRSCLFDLYRSLSQG+TLK+WYESK+ ILKENNID+RRFITFGLE+R
Sbjct: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480

Query: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540
           IIYRCYSFPVM+N  SRE KEMT +I KD +N+D+ L+K+N +   S  GS+N+ Q  N+
Sbjct: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540

Query: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600
           K ERPSKVSFEMQR  SLATG++T+PKLSDEEE ILE SIR+AE+FD ICVLLSK KLEV
Sbjct: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600

Query: 601 ESYLNELGEFKVINS 615
           E+YLNELGEFKVINS
Sbjct: 601 ENYLNELGEFKVINS 615

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  907 bits (2344), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/615 (73%), Positives = 485/615 (78%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNT KNYIIPKP+LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQLLSKSE+DPVFFDLK LE                            +KD KD+R+SR
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+DL+KD  LP+S FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           LEDVPLSSVNL+KIIDVNWDPTMM+IVPYIDGLNSIAKISKLSNSDP LVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
           KCVTLSDIFQFSNIYAPSS IRNFLTDPLMA+DCQ YVTFPEVSKIS+LPLNK+L SGD 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
           D                                             Y+DWRQSQTSCSSS
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480
           NIH+ NNRNRFLPTRSCLFDLYRSLSQGQTLK WYESKYMI+K+NNIDIRRFITFGLEKR
Sbjct: 421 NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540
           IIYR YS+PVM++ G RE KE  PII KD  N     EK+ H H  S   S+N     N+
Sbjct: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540

Query: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600
           K  RPSKVSF+MQ+ SSL TG+ST+PKLSD+EE ILEES+R+AE FDKICVLL KPKLEV
Sbjct: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600

Query: 601 ESYLNELGEFKVINS 615
           E+YLNELGEFK+INS
Sbjct: 601 ENYLNELGEFKIINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  903 bits (2333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/620 (73%), Positives = 493/620 (79%), Gaps = 6/620 (0%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNT KNYIIPKPILCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQLLSKSERDPVFFDLK +E                            +KD KD+RS+R
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 181 -----YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235
                Y+D+IKDLGLP+S FSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 236 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIR 295
           TTCVSLEDVPLSSVNLKKIIDVNWDPTMM IVPYIDGLNSIAKISK S+SDP LVIECIR
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 296 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSL 355
           HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMA+DCQSYVTFPE+SK+SNLPLNK+ 
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 356 GSGDQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQT 415
            S DQD                                            + KDWRQSQT
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 416 SCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITF 475
           SCSS+N H I+ RN+FLPTRSCLFDLYRSLSQGQTLK+WYE K+  LKENNIDIRRFITF
Sbjct: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 476 GLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTA 535
           GLE+ IIYRCYSFPVMI+ GSR+ KEMTP+ TK+  N D  L+KR++NH LS TGS++T 
Sbjct: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540

Query: 536 QSGNLKPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSK 595
           Q+ N+K ERPSKVSFEMQR +SLATGK+ +PKLSDEE+ ILE+SIR+AE FDKICVLL K
Sbjct: 541 QT-NVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599

Query: 596 PKLEVESYLNELGEFKVINS 615
            K EVE+YL+ELGEFKVINS
Sbjct: 600 SKQEVENYLSELGEFKVINS 619

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/491 (53%), Positives = 338/491 (68%), Gaps = 20/491 (4%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+  KNYIIPKP LCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQ+LSK+E DP++FD K+ +                               ++ M  ++
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTTEQDGKLNAEKSFKGLTK-----------SQGMALAK 183

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y++++KDL   +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  PP +C+S
Sbjct: 184 YNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSCIS 243

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +EDVP+S+VNLK IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS+SD  LV+EC++HL+YY
Sbjct: 244 IEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYY 303

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
            CV L+DIFQFSNIYAP+SLIR FLTDP +AS+CQS+VT    S +S +P  + L   D 
Sbjct: 304 NCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER-LRKFDL 362

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
           D                                             Y+  ++SQ+S SS+
Sbjct: 363 DDMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNP--------YRFNQRSQSSFSST 414

Query: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480
           N +V ++  R LPT++CLFDLYR+LSQG T++ WY   Y  +K+N+ID+RRFITFG+ K 
Sbjct: 415 NTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKG 474

Query: 481 IIYRCYSFPVM 491
           +IYRC+SFPVM
Sbjct: 475 LIYRCFSFPVM 485

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (55%), Gaps = 15/109 (13%)

Query: 520 RNHNHL-LSATGSRNTAQSGNLKPERPSKVSFEMQRVS------SLATGK------STMP 566
           R  +H+ LSA    N +     KPER SKV+F+M +        S   GK      + + 
Sbjct: 575 REESHVSLSALSGDNVSHPK--KPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLD 632

Query: 567 KLSDEEEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615
           +  + ++ IL ESI  A+  DKICV L KP+ EVE  L+ELG++K+INS
Sbjct: 633 RAKNNQKIILLESIAAADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/493 (52%), Positives = 328/493 (66%), Gaps = 11/493 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+  KNYIIPKP LCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QN +LSK+E+DP+F+  K +E                               ++   S +
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSK-----------SQAYASEK 169

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y  ++ D+    S FS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ PP + +S
Sbjct: 170 YHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSNIS 229

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDPGLVIECI+HLIYY
Sbjct: 230 IEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYY 289

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
            CV L+DIFQFSNIYAP+S +R FLTD +++++CQSYV   E S +  LP  +   S  +
Sbjct: 290 NCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRVNHSATE 349

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
                                                        +Y+  + SQ+S SS+
Sbjct: 350 SVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSN 409

Query: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480
           N +  N   R+LPT+SCLFDLYRSLSQG +L+ WY   Y  ++ N ID+RRFITFG+   
Sbjct: 410 NTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVING 469

Query: 481 IIYRCYSFPVMIN 493
           +IYRCYS+P+M N
Sbjct: 470 LIYRCYSYPIMKN 482

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (59%), Gaps = 11/84 (13%)

Query: 543 ERPSKVSFEMQR-VSSLATG-KSTMPKLSDEEEGILE---------ESIRNAETFDKICV 591
           +RPSKVSF+ Q+ +  ++ G  S+  K+  +EE  LE         ES+  A++ D ICV
Sbjct: 596 DRPSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDTICV 655

Query: 592 LLSKPKLEVESYLNELGEFKVINS 615
            L   + +VE+ +  LGE+K+INS
Sbjct: 656 KLEMSRYDVEALIQNLGEYKIINS 679

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  513 bits (1322), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/664 (44%), Positives = 396/664 (59%), Gaps = 69/664 (10%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++ KNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYG YRI CYPVT+NS IYAR           P++CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQ+LSKSE D + F+LK  +                            +KD    +  R
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNYILGDDISSIMTTQ---QKD----KYER 173

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
            +++I ++    S F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +S
Sbjct: 174 LNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYIS 233

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +E VP+S VNL KI+DVNWDP M++I+PYI+G+N+I +IS+LS+++  LVIECIRHL+YY
Sbjct: 234 IEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYY 293

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLG---- 356
           +C+ L+DIF+FSN+YAP+S +R FL DP MA++CQSYV  P  SK+++L L    G    
Sbjct: 294 RCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSA 353

Query: 357 -SGDQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQT 415
            +GD                                               YK+ +QS++
Sbjct: 354 FNGD-----------IGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSES 402

Query: 416 SCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITF 475
           S S+ N +   N ++ LPTRS LFDLYRSLSQG TLK WY   + I+++N ID+RRFITF
Sbjct: 403 SISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITF 462

Query: 476 GLEKRIIYRCYSFPVMINAGSR-----------EPKEMTPIIT------KDLVNNDKLLE 518
           G+ +RIIYRC ++ V IN+               P  M  I          L  ++ L+ 
Sbjct: 463 GVLRRIIYRCETYSV-INSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMN 521

Query: 519 KRNHNHL----LSATGSRNTAQSG-NLKPERP-------------SKVSFE--------M 552
                 L      A  S NT+ S  +L P  P             SKVSFE         
Sbjct: 522 AYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGF 581

Query: 553 QRVSSLAT--GKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEF 610
           +  S++ T   ++T  KLS  +  I+ +++ +AET DKICVLL  P+  V + L+ELGE 
Sbjct: 582 RWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGEL 641

Query: 611 KVIN 614
           K+IN
Sbjct: 642 KLIN 645

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  501 bits (1289), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 289/639 (45%), Positives = 382/639 (59%), Gaps = 71/639 (11%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M+S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+  KNYIIPKP LCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YRIV YPV + S  YAR           PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LS++ERD   F    L                                TK     +
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALI------------SKTKSFSPDK 168

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
            ++   D+ L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  +
Sbjct: 169 KTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHL 222

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299
           S+EDVP+  V LKKIID+NWDPTM+SI+P+I+G+NSI  I++LS+SDP LVIECI+HLIY
Sbjct: 223 SIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIY 282

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGD 359
           YKCV ++DIFQFSNIYAPSSLI  FLTDP MA DCQ YVT P+ S++ ++PL  S+    
Sbjct: 283 YKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSR 342

Query: 360 QDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSS 419
            +                                               + ++S++S SS
Sbjct: 343 NNKHKKSNSLSSTGVLSWQSNSQYSNNSSEFYSM--------------SNKKRSESSLSS 388

Query: 420 --------SNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRR 471
                   S+ H I     + PTR  LFDLYRSLSQG TL+ WY + +  ++ N ID+R+
Sbjct: 389 EGTPGAGRSDDHTI-----YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRK 443

Query: 472 FITFGLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNH--NHLLSAT 529
           FI FG  K+IIYR  S+PV+        K    II K +    K+ EK  H  N   S +
Sbjct: 444 FIQFGTIKKIIYRVLSYPVL-------EKRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTS 495

Query: 530 GSR--NTAQSGNLKPERPSKVSFEMQRVSSL------ATG------KSTMPKLSDEEEGI 575
             +  +  +  N    R SKVSFE +R ++       A G      K TM  L+ EE+  
Sbjct: 496 DIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGADKETM-ILTKEEKLQ 554

Query: 576 LEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614
           L  ++ N E+FDKICV L + ++E+ + + ++GE++VIN
Sbjct: 555 LLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  500 bits (1287), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 255/507 (50%), Positives = 320/507 (63%), Gaps = 27/507 (5%)

Query: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLITFK 64
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++ ++Y+IPKP LC+KL+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQNQL 124
           YG YRI+ YP+TIN  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSERDPVFFDLKV-----------LEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDT 173
           LSK+E+D  +FD K            L+                             K  
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 174 KDMRSSRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233
                 +Y ++ + +   +S FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 234 PPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIEC 293
           PP   +S+EDVP+S VNLK+IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS+SD  LVIEC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNK 353
           I+H IYY CV +SDIFQFSNIYAP+SL+RNFLTDPLMA++CQ+YVT PE S +  LPL  
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPLES 363

Query: 354 -------SLGSGDQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 406
                  S GS  Q+                                            +
Sbjct: 364 LSKLKLDSDGSDSQN---------LRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDL 414

Query: 407 YKDWRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENN 466
           Y +  +S++S SS N + +N   + LPTRS LFDLYRSLSQG TLK WY+  +  ++ N 
Sbjct: 415 YLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNG 474

Query: 467 IDIRRFITFGLEKRIIYRCYSFPVMIN 493
           IDIR+FI FG+   ++YRC SFPV  N
Sbjct: 475 IDIRKFIIFGIINGLLYRCQSFPVTAN 501

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 62/117 (52%), Gaps = 22/117 (18%)

Query: 513 NDKLLEKRNHNHLLSATGSRNTAQSGNLKPERP---SKVSFE----MQRVSSLATGKST- 564
           N + LEK++   L  ++   +        P+RP   SKVSF+    MQ   S ++G  T 
Sbjct: 587 NSQELEKKSVQSLFESSNPYSKV------PKRPGTLSKVSFQQNSNMQY--SASSGDVTE 638

Query: 565 ------MPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615
                 + KL  + E IL E++ + E  DKICVLL KP+ EVE  L  L +FKVINS
Sbjct: 639 NEDINNLEKLRKQNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVINS 695

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  494 bits (1273), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 248/513 (48%), Positives = 328/513 (63%), Gaps = 21/513 (4%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+T KNY+IPKP LC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YR+ CYPV +N+  YAR           PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXX-XXXXXXXXXXXEKDTKDMRS- 178
           Q+Q+LSK+E DPV+F LK  E                              +D+K+    
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 179 -------SRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 231
                   +Y +++ DL   +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 232 LRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVI 291
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S+SD  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 292 ECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL 351
           EC++HLIYY CV L+DIFQFSNIYA +SLI  FLTDP +AS+CQ+YVT  ++ ++  LP 
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDL-ELYRLPF 359

Query: 352 NK-----SLGSGDQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXI 406
                  S+ S  +                                             +
Sbjct: 360 ESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLMRV 419

Query: 407 YKDWRQSQTSCSSSNIHVINNRNRFL-PTRSCLFDLYRSLSQGQTLKTWYESKYMILKEN 465
                QS T  +     V    +R L PT+SCLFDLYRSL QG+T+K WY+  + I+++N
Sbjct: 420 RDRSGQSTTGSA-----VDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDN 474

Query: 466 NIDIRRFITFGLEKRIIYRCYSFPVMINAGSRE 498
           +ID+RRFITFG+ + +IYRCY++PVM N G+ E
Sbjct: 475 HIDVRRFITFGIVRGLIYRCYAYPVMKNLGALE 507

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 12/101 (11%)

Query: 527 SATGSRNTAQSGN---LKPERPSKVSFEMQRV---------SSLATGKSTMPKLSDEEEG 574
           S  GSR  ++ G+   ++ E  SKV+FE  R                 S + K    EE 
Sbjct: 610 STKGSRKGSRKGSSSTMESETRSKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEKRHEEF 669

Query: 575 ILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615
           +L +S+++ +TFDKIC+ L K + EVE  L E+G + +INS
Sbjct: 670 LLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  480 bits (1236), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 270/624 (43%), Positives = 363/624 (58%), Gaps = 93/624 (14%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++ KN++IPKP LCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T +Y  YR+V YPV ++S  YAR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSKS+                                               R+S 
Sbjct: 121 QSQILSKSQ-----------------------------------------------RTSA 133

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
           +    +D+    + FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 134 FFKDGEDVDFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299
           S+EDVPLS VNL KI+D+NWDPTM+SI+P+IDG+NSI  IS LS+SDP LVIECI+HLIY
Sbjct: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGD 359
           Y CV ++DIFQFSNIYAPSSLI NFL DP++A +CQSYV  P  SKI++LPL     + +
Sbjct: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL-----ASE 308

Query: 360 QDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSS 419
           QD                                                  QS ++ SS
Sbjct: 309 QDDEINNSDMTQKALSSSRSSFSSYFSHKSAYARVSETAHH----------HQSTSTLSS 358

Query: 420 SNIHVINNR-NRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLE 478
           S     N R  + LP++  LFDLYRSL+ G T++ WY+  +  +KEN+ID+R+FI FG+ 
Sbjct: 359 SEGQQDNPRQGQVLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVI 418

Query: 479 KRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSAT-------GS 531
            +IIYR + +P+M +   + P                LL  R ++ ++ +T       G 
Sbjct: 419 NKIIYRVHQYPIMEHKTFKSP----------------LLSDRQNDKIVLSTSDIKFDVGD 462

Query: 532 RNTAQSGNLKPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICV 591
           R      N    + SKV+F+  +      G S    L + E+ IL  ++   E+FD+IC 
Sbjct: 463 RILNSIYN----KLSKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICS 516

Query: 592 LLSKPKLEVESYLNELGEFKVINS 615
            L K K EVES ++E+GE+  INS
Sbjct: 517 KLGKSKNEVESIISEIGEYMTINS 540

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  468 bits (1204), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 239/545 (43%), Positives = 324/545 (59%), Gaps = 7/545 (1%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+T KNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG +R+VCYPV + +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSK+E   V+F LK                               + + +   S++
Sbjct: 121 QSQILSKAENSSVYFQLKA---RNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYASAK 177

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++KDL  P    +I DL+ +I++DLN+YSECLIPID GNAVDIK+FPLL PP++C S
Sbjct: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFS 237

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S+SD  LV+ECI+HLIYY
Sbjct: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
            CV L+DIFQFSNIYA ++ +  FLT+P +A++CQ YV + E + + NLP  +      Q
Sbjct: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERGPSRSGQ 357

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIYKDWRQSQTSCSSS 420
                                                                 TS +S 
Sbjct: 358 GNIRDRSSNGTLDILRKGKQTPLRENSFNSGMDFLSNKHQHTPQSRSSSIPYHNTSDASF 417

Query: 421 NIHVINNRNRFLP--TRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLE 478
                  + + +P  ++SCLFDLYRSL+QGQT++ WY++ +  ++   ID+RRFITFG+ 
Sbjct: 418 GNSDAGLKGKLMPFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVL 477

Query: 479 KRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNH--NHLLSATGSRNTAQ 536
             +IYR YS+PV+ N G  E  E             K L K N   N++LSA   R   +
Sbjct: 478 HGLIYRSYSYPVLRNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLE 537

Query: 537 SGNLK 541
           +   K
Sbjct: 538 NAGFK 542

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/194 (27%), Positives = 91/194 (46%), Gaps = 32/194 (16%)

Query: 448 GQTLKTWYESKYMILKEN----NIDIRRFITFGLEKRIIYRCYSFPVMINAGSREPKEMT 503
           G T  + Y     +LK N    N+     I  GLE    ++  S  +  ++ +   +E+ 
Sbjct: 503 GATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLEN-AGFKARSEKLKQHSTADAAEEVL 561

Query: 504 PIITKDLVNNDKLLEKRNH----NHLLSATGSRNTAQSGNLKPERPS---------KVSF 550
             + + L  +DK   K +H    N+ +S    RN+  S ++     +         KV+F
Sbjct: 562 SDVYRKLALSDK---KTDHVAQGNNPISKVFGRNSEDSTDISTRESANSMGSDIKNKVAF 618

Query: 551 EMQRVSSLATGKSTMPKLSD---------EEEGILEESIRNAETFDKICVLLSKPKLEVE 601
           ++++  +LAT  +   + S+          EE IL +S+R+   FDKIC LL K +  VE
Sbjct: 619 DVRK--TLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDKICTLLGKDRERVE 676

Query: 602 SYLNELGEFKVINS 615
           S L+ELG + V++S
Sbjct: 677 SMLSELGPYNVLHS 690

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 228/500 (45%), Positives = 304/500 (60%), Gaps = 14/500 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+T KNY+IPK  LC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFK+G+YR+VCYPV I +P YAR           PYD  TSPYEPAI RL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSK ERDPV++ LK  E                               TK      
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTK------ 181

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++K +   +    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C+S
Sbjct: 182 YHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSCLS 241

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
            EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S+S   LV+ECI+HL+YY
Sbjct: 242 FEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYY 301

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360
            CV L D+FQFSNIYAP++L+R+FL D ++  +CQ YV   E  +I  LP       G  
Sbjct: 302 DCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHS 361

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIY--KDWRQSQTSCS 418
                                                            KD+  +++   
Sbjct: 362 RNQTASTNTVYTLRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFTQSNKDYYYNRSRNL 421

Query: 419 SSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLE 478
            SN        R LPTR  LFDLYRSL+QGQTLK WY++ Y  ++EN ID+RR I FG+ 
Sbjct: 422 ESNC------KRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVF 475

Query: 479 KRIIYRCYSFPVMINAGSRE 498
            R+IYRCYS+PV  + G+ E
Sbjct: 476 HRLIYRCYSYPVAKSIGTLE 495

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 29/44 (65%)

Query: 572 EEGILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVINS 615
           +E +L +S+++ ++FDKI V L   K EVE  L   GE+ ++NS
Sbjct: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  448 bits (1153), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 284/684 (41%), Positives = 373/684 (54%), Gaps = 80/684 (11%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+  KNY+IPKP LCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIV YP+ INS +YAR           PY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQLLSKSERDPVFFDLKVL-----------EXXXXXXXXXXXXXXXXXXXXXXXXXXXX 169
           Q Q LSK E+D  +FD K++           E                            
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 170 EKDTKDMRS-----SRYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAV 224
            +D  + +      S+Y+ +   +   +   S+ D+LMR+FQDLN+YSEC IPID+GNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 225 DIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSN 284
           DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LSN
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 285 SDPGLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVS 344
           SD  LVIECIRH +YY CV LSDIFQFSNIYAP+S I +FLTDP +A++CQ YVT PE S
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 345 KISNLPLNKSLGSGDQDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 404
            +S LP  K                                                   
Sbjct: 361 LLSALPFKKGRKMVKNRRSASIASHFTSSSSLRQNLNSKASSFISDEGHHNDDTAYPNHD 420

Query: 405 XIYKDWRQSQTSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKE 464
            IY++ R+S++S SS N   ++    +LPT+S LFDLYRSLSQG  L+ WY+  +  +++
Sbjct: 421 SIYENRRRSESSFSSGNNDEMHQNRNYLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRD 480

Query: 465 NNIDIRRFITFGLEKRIIYRCYSFPVMINAGSREPKEMTPIIT----KDLVNNDKLLEKR 520
           N IDIRRFI FG+ KRIIYRC+S+P+        PK           K+L N  K+++ +
Sbjct: 481 NFIDIRRFIIFGIIKRIIYRCHSYPL--------PKNYEAFSKLNDLKNLQNGPKIVKNK 532

Query: 521 NHNHL-----------------------------------------LSATGSRNTAQSGN 539
           + ++                                          LS  G   T+ +G 
Sbjct: 533 SQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVDVADRVLNNVYKKLSTNGRPTTSING- 591

Query: 540 LKPERPSKVSFEMQRVSSLATGKST-----MPKLSDE----EEGILEESIRNAETFDKIC 590
            + + PSKV+F+ Q   +   G          K S E    ++  L +++++AE  D IC
Sbjct: 592 -QGQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFSREININDKIYLLDALQSAENLDNIC 650

Query: 591 VLLSKPKLEVESYLNELGEFKVIN 614
             L   + EVE+ LNEL E+++IN
Sbjct: 651 SNLELSREEVETLLNELTEYRIIN 674

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  418 bits (1075), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 205/368 (55%), Positives = 259/368 (70%), Gaps = 28/368 (7%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M+ +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+T KNYIIPKP LCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           QNQLLS++E D V+FD                                 +K+T  +  SR
Sbjct: 121 QNQLLSRAENDSVYFD-----------------NSHSLLSSEQDSIMHQDKNTSILGFSR 163

Query: 181 ----YSDLIKDLGLPQ-------SAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIF 229
               +S    DL L +       S FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIF
Sbjct: 164 KRFSFSKRPTDLSLSEYPDNESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIF 223

Query: 230 PLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGL 289
           P + PP+  +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LSNSD   
Sbjct: 224 PSMVPPSISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDF 283

Query: 290 VIECIRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNL 349
           V+ECIRHL+YY+ V LSDIFQF+NIYAP+S +R+FLTD  +A+DCQ+YV  P+ S    L
Sbjct: 284 VVECIRHLVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKL 343

Query: 350 PLNKSLGS 357
           PL KS+ +
Sbjct: 344 PLEKSINT 351

 Score = 97.8 bits (242), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 50/65 (76%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFPV 490
           +LPT+SCLFDLYRSLSQG  L  WY   Y ++  N IDIRRFITFGL + ++YRCY+ P+
Sbjct: 405 YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464

Query: 491 MINAG 495
           M NAG
Sbjct: 465 MKNAG 469

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 30/40 (75%)

Query: 575 ILEESIRNAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614
           +L ES+R A+  DKIC+ L KP+ EVE  L+E+G++ +IN
Sbjct: 670 LLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  413 bits (1061), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/353 (53%), Positives = 250/353 (70%), Gaps = 3/353 (0%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+T KNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG++R+VCYPV + +P YAR           PYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSK+E   V+F LK  +                            + ++      +
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEAS---QSESHGYAFEK 177

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++KDL  P    S++DL+ +I++DLNNYSECLIPID GNAVDIK+FPLL PP++C+S
Sbjct: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLS 237

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS+SD  LV+ECIRHL+YY
Sbjct: 238 FEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNK 353
            CV L+DIFQF NIYAP+S +  FLT+P +A++CQ YVT  E + IS+LP  +
Sbjct: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

 Score =  108 bits (271), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 123/265 (46%), Gaps = 77/265 (29%)

Query: 427 NRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCY 486
           N   F  ++SCLFD+YRSLSQGQT+K WY++ +  ++   ID+RRFITFG+   ++YRCY
Sbjct: 424 NNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCY 483

Query: 487 SFPVMIN------------------------AGSREPKE---MTPIITKDLVNNDKLLEK 519
           SFP+M N                        +G+ EP         I   L ++   L +
Sbjct: 484 SFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSSSKLRE 543

Query: 520 RNHNHLLSATGSRN------------------TAQSGN---------------------- 539
           R  NH  +A  + +                  ++QSGN                      
Sbjct: 544 RRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDV 603

Query: 540 ---LKPERPSKVSFEMQRVSSLATG----KSTMPKLSDE---EEGILEESIRNAETFDKI 589
                 +  + V+F+++R+ + AT     K  + +L ++   +E +L +S+R+ E FDKI
Sbjct: 604 VSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKI 663

Query: 590 CVLLSKPKLEVESYLNELGEFKVIN 614
           C  L + + EVE  L +LG + V++
Sbjct: 664 CTRLGRDREEVEKMLEDLGPYNVVH 688

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  410 bits (1055), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/351 (53%), Positives = 254/351 (72%), Gaps = 4/351 (1%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+T KNY+IPKP LC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG+YR+VCYPV IN+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSK ERDP+++ LK  +                             +   +    +
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKI----RRGHHEHAFEK 176

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++K + + +   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C S
Sbjct: 177 YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSCFS 236

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S+SD GLV+EC++HLIYY
Sbjct: 237 VEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYY 296

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL 351
            CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S++  LP 
Sbjct: 297 DCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347

 Score =  105 bits (262), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 58/68 (85%)

Query: 429 NRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSF 488
           NR LPTRSCLFDLYRSLSQGQT+K WY+  + ++++N ID+RRFITFG+ +++IYRCYS+
Sbjct: 423 NRTLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSY 482

Query: 489 PVMINAGS 496
           PV  + G+
Sbjct: 483 PVAKSIGT 490

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 7/77 (9%)

Query: 546 SKVSFEMQ-RVSSL------ATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKL 598
           +KV F+M+ R+S+           ST  K   +++ +L +SI+N ++FDKI + L   K 
Sbjct: 598 AKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQ 657

Query: 599 EVESYLNELGEFKVINS 615
           EVE  L   GE+ +INS
Sbjct: 658 EVEELLKATGEYNIINS 674

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 194/338 (57%), Positives = 245/338 (72%), Gaps = 9/338 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+T KNYIIPKP LC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YAR           PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSR 180
           Q+Q+LSKSE++PV+F LK  +                            EK         
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHTDIKSTGDDGEK--------- 171

Query: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y ++IK+L   Q +  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231

Query: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+HL+YY
Sbjct: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291

Query: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYV 338
            CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V
Sbjct: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV 329

 Score =  118 bits (296), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/249 (32%), Positives = 121/249 (48%), Gaps = 59/249 (23%)

Query: 426 NNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRC 485
           N   R LPTRSCLFDLY+SLSQG+T+K WY+  + I+++N ID+R+ I FG+ +R+IYR 
Sbjct: 412 NQMKRILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRV 471

Query: 486 YSFPVMINAG---------SREPK---------------EMTPIITKDLVNN-------D 514
            S+P++ N G         S+EPK               ++  + TK+  N        D
Sbjct: 472 NSYPIVKNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAAD 531

Query: 515 KLLEKRNHNHLLSATGSRNTAQSGNLKPERPSKVSF-----------EMQRVS---SLAT 560
           +LL+       L        ++      + PS  +F             Q+VS     A 
Sbjct: 532 ELLKSLYQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAG 591

Query: 561 GKSTMPKLSDEEEG--------------ILEESIRNAETFDKICVLLSKPKLEVESYLNE 606
            + T+ ++ D  +G              IL ES+ NAETFDK+C  L K + EVE  L +
Sbjct: 592 QQKTVTEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKD 651

Query: 607 LGEFKVINS 615
           LG + ++NS
Sbjct: 652 LGHYNIVNS 660

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  403 bits (1036), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 196/352 (55%), Positives = 254/352 (72%), Gaps = 10/352 (2%)

Query: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+T KNYIIPK  LC++L+
Sbjct: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68

Query: 62  TFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQ 121
           TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128

Query: 122 NQLLSKSERDPVFFDLKVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKDTKDMRSSRY 181
           +Q+LSK+E DP++F    +                                  +   SR+
Sbjct: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRN--------NDHNDNNDGSRF 180

Query: 182 -SDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCV 239
            +D   +     + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+PP    +
Sbjct: 181 ETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLI 240

Query: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIY 299
           SLEDVP+S +NL  +IDVNWDPTM++IVPYI+G+N I+KI+KL+ +DP LVIECI+HL+Y
Sbjct: 241 SLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVY 300

Query: 300 YKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPL 351
           Y CV ++DIFQFSN+YAP+SLI +FLTD  MA+ CQ+YV  P  SK+S+LP 
Sbjct: 301 YNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPF 352

 Score =  123 bits (309), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 112/197 (56%), Gaps = 15/197 (7%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFPV- 490
           LPT++CLFDLYRSLS G TL++WY+S   I+ ENN+D+R+FI FG+ + +IYRC+S+P+ 
Sbjct: 414 LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIP 473

Query: 491 --MINAGSREPKEMTPIITKDLVNNDKLLEKR----------NHNHLLSATGSRNTAQSG 538
               N G +  + +  I    L         R               ++  G+    ++ 
Sbjct: 474 QRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNV 533

Query: 539 NLKPERPSKVSF-EMQRVSSLATGKSTMPK-LSDEEEGILEESIRNAETFDKICVLLSKP 596
             K ER SKVSF + ++  S+ T +   P  ++ EE  +L +SI + E  DKICV L K 
Sbjct: 534 YKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKS 593

Query: 597 KLEVESYLNELGEFKVI 613
           + +VE +L+ELG +K+I
Sbjct: 594 RQQVERWLDELGNYKII 610

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  228 bits (581), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 133/161 (82%), Gaps = 1/161 (0%)

Query: 193 SAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNL 251
           S  S+QDL+MRI+QDLNNYSECLIPID+GN VDIKIFPLL+PP    +S+EDVP+S V+L
Sbjct: 225 SRISVQDLIMRIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDL 284

Query: 252 KKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQF 311
            KI DVNWDPTM+ ++P+I+G+N I+KISKLSNS P LVIECI+HLIYY CV ++DIFQF
Sbjct: 285 TKITDVNWDPTMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQF 344

Query: 312 SNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLN 352
           SN Y+ +SLI  FLTDP MA+ CQ+YV  P  SK++ LP +
Sbjct: 345 SNTYSTTSLISTFLTDPNMATLCQNYVVLPLGSKLTRLPFH 385

 Score =  201 bits (511), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 108/134 (80%)

Query: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKLI 61
           +++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+  KNYIIPK  LC+KL+
Sbjct: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69

Query: 62  TFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQ 121
           TFKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQ
Sbjct: 70  TFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQ 129

Query: 122 NQLLSKSERDPVFF 135
           NQ+LSK+E DP++F
Sbjct: 130 NQILSKAENDPIYF 143

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 115/213 (53%), Gaps = 30/213 (14%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFPVM 491
           LPT+  LF+LYRSL+Q   LK WY+  Y  + ENNIDIR+FI FG+ K +IYRC+S+P++
Sbjct: 453 LPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIV 512

Query: 492 INAGSREP---KEMTPIITKDLVNNDKLLEKRNHNHLLS----------ATGSRNT---- 534
           I      P   K  +P ++   +++    ++      +S          ++G R+T    
Sbjct: 513 ITPVVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKL 572

Query: 535 AQSGNLKPERP---SKVSFEMQ----------RVSSLATGKSTMPKLSDEEEGILEESIR 581
            +S   K E+    SKVSF  +            +S      +  +L+ ++  IL +SI 
Sbjct: 573 MKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSIS 632

Query: 582 NAETFDKICVLLSKPKLEVESYLNELGEFKVIN 614
           N +  DKICV L +P+ ++E +L+E G++KVIN
Sbjct: 633 NMDNMDKICVKLGRPRSQIEEWLSEFGDYKVIN 665

>Suva_4.321 Chr4 complement(568645..572793) [4149 bp, 1382 aa] {ON}
           YBR081C (REAL)
          Length = 1382

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 27/54 (50%)

Query: 491 MINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNLKPER 544
           MI  G R+       I  D  NND +  +   NHLLSAT     + +GN +P++
Sbjct: 347 MIEKGKRKRSRSDLEIASDEENNDNIDNQAEANHLLSATEGEKFSDAGNKRPKQ 400

>SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]
           {ON} some similarities with uniprot|P40356 Saccharomyces
           cerevisiae YGL025C PGD1 Subunit of the Mediator global
           transcriptional cofactor complex which is part of the
           RNA polymerase II holoenzyme and plays an essential role
           in basal and activated transcription direct target of
           the Cyc8p-Tup1p transcriptional corepressor
          Length = 374

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 224 VDIKIFPLLRPPTTCVSLEDVPLSSVNLKKIIDVNWDPTMMSIVP----YIDGLNSIAKI 279
           + + I   L P TT   LED   S    K+ I      T  SI+P    + D LNS+AKI
Sbjct: 26  LSMGILESLSPKTTLSELEDKLSSDGAHKEAIQQQIATTQESILPIRLCFNDFLNSVAKI 85

Query: 280 SKLSNSDPG---LVIECIRHLIYYKCVTLSDIFQ 310
            ++ N  P    L+I      +Y +   LSD ++
Sbjct: 86  DQVDNKTPQERFLLIRSKLLEVYSRIQALSDDYE 119

>Suva_10.573 Chr10 (998844..1006745) [7902 bp, 2633 aa] {ON} YLR454W
           (REAL)
          Length = 2633

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 62/141 (43%), Gaps = 21/141 (14%)

Query: 415 TSCSSSNIHVINNRNRFLPTRSCLFDLYRSLSQGQTLK-TWYESKYMILKENNIDIRRFI 473
           +SC  + I   N+  +FL  R  LFD ++       +K T  + K++I  ++N+ I +F 
Sbjct: 434 SSCPKNKILKANSHIKFLRRRRILFDYFKCFLPLINMKFTLDDPKFVIKNKDNLIISKFS 493

Query: 474 TF---GLEKRIIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKR--------NH 522
            F    L KR I         +  GS E KE T  I  + + N +LL+ R        N+
Sbjct: 494 VFMISHLSKRYI---------LGDGSSEEKENTQQIFYESLWNIELLDMRLQHIIKHQNY 544

Query: 523 NHLLSATGSRNTAQSGNLKPE 543
            H +    S    Q+  L PE
Sbjct: 545 EHTILRVDSIALEQNIRLLPE 565

>ZYRO0F17578g Chr6 (1461181..1463613) [2433 bp, 810 aa] {ON} highly
           similar to uniprot|P00815 Saccharomyces cerevisiae
           YCL030C
          Length = 810

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 19/33 (57%)

Query: 289 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 321
           +V++CI H     C +  + F+ SN YAP  LI
Sbjct: 669 IVVKCIAHSAIILCGSYDEAFKISNQYAPEHLI 701

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 31.6 bits (70), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%)

Query: 289 LVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI 321
           +V +CI H    KC +  + F  SN YAP  LI
Sbjct: 639 IVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

>NDAI0C05400 Chr3 (1249878..1255394) [5517 bp, 1838 aa] {ON} Anc_8.520
          Length = 1838

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 46/99 (46%), Gaps = 15/99 (15%)

Query: 249  VNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNS-DPGLVIECIRHLIYYKCVTLSD 307
            V    ++   +DPT+  ++  + G +    ISKL  + D   +  C+ ++ Y K +  SD
Sbjct: 998  VTAGTVVSAEYDPTLAKLI--VHGKDRNDAISKLIQALDETKLYGCVTNIDYLKSIVSSD 1055

Query: 308  IFQFSNI---------YAPSSLIRNFLTDPLMASDCQSY 337
            +F+ + +         YAPS++    +T P   +  Q Y
Sbjct: 1056 MFKEARVSTNVLNFYDYAPSAI---EITSPGAHTSVQDY 1091

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,494,928
Number of extensions: 2605607
Number of successful extensions: 7726
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7958
Number of HSP's successfully gapped: 78
Length of query: 615
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 499
Effective length of database: 40,180,143
Effective search space: 20049891357
Effective search space used: 20049891357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)