Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL061C (CIN8)6.16ON1000100047310.0
Smik_5.266.16ON1002100242930.0
Skud_5.286.16ON998100242150.0
Suva_5.66.16ON999100041640.0
TDEL0G045306.16ON95891624280.0
ZYRO0C07898g6.16ON97493723650.0
KAFR0L003706.16ON96392021460.0
NCAS0H008806.16ON100463016500.0
CAGL0B03641g6.16ON98861815950.0
Kpol_1032.66.16ON100464315850.0
NDAI0D008706.16ON106963715790.0
SAKL0E01078g6.16ON94861815490.0
KLLA0D01045g6.16ON96563815380.0
Kwal_56.224036.16ON94362014760.0
Ecym_30206.16ON94460214011e-178
KNAG0M011306.16ON95060513851e-175
KLTH0C11330g6.16ON94167313831e-175
TPHA0M002406.16ON93961713831e-175
TBLA0A072306.16ON109764313831e-173
ACR010C6.16ON94559613661e-172
Kpol_1045.736.16ON96294013551e-171
TPHA0J003006.16ON98291010701e-129
Smik_2.537.387ON11132206552e-70
YBL063W (KIP1)7.387ON11112206542e-70
Skud_2.417.387ON11102206533e-70
Suva_2.547.387ON11102206534e-70
ACR228C7.387ON11294996491e-69
SAKL0F12298g7.387ON11122256463e-69
Ecym_46887.387ON11343066366e-68
TPHA0E008907.387ON12322236332e-67
TDEL0C016007.387ON11052146286e-67
ZYRO0B03234g7.387ON11382136191e-65
NDAI0E043007.387ON11862186145e-65
NCAS0E026407.387ON11022466118e-65
KAFR0L017107.387ON11512266041e-63
TBLA0D006407.387ON11421994661e-46
KLTH0G03850g5.531ON4731733583e-35
SAKL0G18920g2.633ON6493503611e-34
Kwal_47.186085.531ON4791733452e-33
SAKL0G05016g5.531ON5041753443e-33
KLLA0B00759g5.531ON4561743389e-33
ADR145C2.633ON6351823235e-30
Ecym_34152.633ON6621723173e-29
Ecym_40665.531ON4781723043e-28
SAKL0F01760g3.528ON8091783078e-28
Suva_7.443.528ON8051783061e-27
KAFR0F042103.528ON6721783041e-27
CAGL0I07029g3.528ON7051803032e-27
NCAS0E005503.528ON7841803042e-27
Skud_7.533.528ON8051783042e-27
TDEL0D059603.528ON7331813032e-27
Kwal_47.190933.528ON8191793033e-27
TBLA0C039403.479ON7391823013e-27
KLLA0A01606g3.528ON7691823023e-27
Smik_7.483.528ON8051783006e-27
ZYRO0E08668g3.528ON7781812997e-27
YGL216W (KIP3)3.528ON8051782998e-27
KLTH0G01606g3.528ON8191742972e-26
KNAG0B005203.528ON7232592952e-26
TBLA0C049603.528ON8011882952e-26
ZYRO0D12650g5.531ON4781922892e-26
Kpol_423.83.528ON8061812926e-26
CAGL0D04994g3.479ON6921482907e-26
NDAI0I029603.528ON8682612901e-25
TPHA0D034803.528ON8471792891e-25
Kpol_1050.1033.479ON6971522862e-25
Kpol_1004.255.531ON5061952822e-25
TPHA0D032003.479ON7241512844e-25
AGR253W3.479ON7091822827e-25
KNAG0A078803.479ON7641432828e-25
Ecym_12003.528ON8331802829e-25
AER441C3.528ON8184042811e-24
KAFR0B065903.479ON7061502792e-24
NCAS0F034703.479ON6981512782e-24
ZYRO0F07414g8.678ON6542092754e-24
NDAI0B057703.479ON7631562739e-24
NCAS0C013508.678ON6551832711e-23
Kpol_505.393.479ON6921502721e-23
YPR141C (KAR3)3.479ON7291442693e-23
Skud_16.4353.479ON7291442675e-23
ZYRO0B04290g3.479ON7311482675e-23
TDEL0F036403.479ON7041732665e-23
Kpol_1013.78.678ON6201912656e-23
Smik_16.3883.479ON7291442657e-23
SAKL0F03168g3.479ON7061492641e-22
Ecym_44073.479ON7111822612e-22
Suva_16.4693.479ON7311442612e-22
NDAI0E02090singletonON6851962613e-22
KLLA0D05951g8.678ON6682502584e-22
TBLA0C053103.479ON6761832576e-22
KAFR0H024108.678ON6582282577e-22
KLLA0B10956g3.479ON6901512541e-21
Kwal_26.88068.678ON7153182506e-21
KLTH0F14498g3.479ON7021672496e-21
SAKL0H06490g8.678ON6573532488e-21
CAGL0M02189g8.678ON6721942433e-20
TDEL0A062408.678ON6373712424e-20
TPHA0D012708.678ON6961882415e-20
ACR145W8.678ON6852112407e-20
KLTH0D11286g8.678ON6781882362e-19
YPL155C (KIP2)8.678ON7062002362e-19
Ecym_23958.678ON6872152353e-19
Smik_6.3528.678ON7152062327e-19
Skud_16.1278.678ON7062002311e-18
TDEL0B072702.633ON6441992291e-18
TBLA0C018808.678ON4681512191e-17
KNAG0J017208.678ON6251842211e-17
TPHA0D041903.479ON6721442141e-16
Suva_16.1558.678ON7042002051e-15
Kpol_1019.112.633ON6472142041e-15
Suva_11.1452.633ON6571821772e-12
Kwal_55.21164singletonOFF5881621736e-12
TPHA0N016502.633ON6822151747e-12
Kwal_YGOB_55.211643.479ON6571621738e-12
Smik_11.1602.633ON6561241559e-10
YKL079W (SMY1)2.633ON6562201532e-09
Skud_11.1482.633ON6561181513e-09
NCAS0H031802.633ON6602521513e-09
TBLA0A008202.633ON8031761488e-09
ZYRO0E01078g2.633ON6682781406e-08
NDAI0C004802.633ON5983091334e-07
TBLA0C008002.633ON6931341282e-06
KNAG0M025402.633ON5221021227e-06
CAGL0L05104g2.633ON6752031121e-04
KAFR0C040202.633ON6673021084e-04
KNAG0H003602.633ON681117950.013
NCAS0C052002.633ON572153830.31
NDAI0B055405.416ON585105820.51
KNAG0K006903.93ON103081791.1
TBLA0B023703.106ON638169771.8
Kwal_55.197335.696ON67683772.0
SAKL0G02024g5.414ON849366772.2
KLLA0D19580g2.16ON754155762.4
ZYRO0C01716g8.259ON141387762.5
YHR108W (GGA2)5.416ON58548743.8
NCAS0C028308.401ON874135744.6
CAGL0F07997g5.88ON936124745.0
ZYRO0B12144g4.238ON2005106745.5
Suva_15.3045.416ON58748735.9
TBLA0H011308.351ON755156726.6
ZYRO0F06424g8.636ON45278727.4
SAKL0F11704g7.364ON564114718.4
KNAG0M024702.649ON60654718.6
NCAS0D019505.170ON93936719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL061C
         (1000 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...  1826   0.0  
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...  1658   0.0  
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...  1628   0.0  
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...  1608   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   939   0.0  
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   915   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   831   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   640   0.0  
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   619   0.0  
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   615   0.0  
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   612   0.0  
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   601   0.0  
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   597   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   573   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   544   e-178
KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....   538   e-175
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   537   e-175
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   537   e-175
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   537   e-173
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   530   e-172
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   526   e-171
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   416   e-129
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   256   2e-70
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   256   2e-70
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   256   3e-70
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   256   4e-70
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   254   1e-69
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   253   3e-69
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   249   6e-68
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   248   2e-67
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   246   6e-67
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   243   1e-65
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   241   5e-65
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   239   8e-65
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   237   1e-63
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   184   1e-46
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   142   3e-35
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   143   1e-34
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   137   2e-33
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   137   3e-33
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   134   9e-33
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   129   5e-30
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   126   3e-29
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   121   3e-28
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   122   8e-28
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   122   1e-27
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   121   1e-27
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   121   2e-27
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   121   2e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   121   2e-27
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   121   2e-27
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   121   3e-27
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   120   3e-27
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   120   3e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   6e-27
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   119   7e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   119   8e-27
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   119   2e-26
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   118   2e-26
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   118   2e-26
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   115   2e-26
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   117   6e-26
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   116   7e-26
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   116   1e-25
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   115   1e-25
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   114   2e-25
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....   113   2e-25
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   114   4e-25
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...   113   7e-25
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   113   8e-25
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   113   9e-25
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   112   1e-24
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   112   2e-24
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...   111   2e-24
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...   110   4e-24
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...   109   9e-24
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...   108   1e-23
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   109   1e-23
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   108   3e-23
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...   107   5e-23
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   107   5e-23
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...   107   5e-23
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....   106   6e-23
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...   106   7e-23
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...   106   1e-22
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...   105   2e-22
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...   105   2e-22
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...   105   3e-22
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...   103   4e-22
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...   103   6e-22
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   103   7e-22
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...   102   1e-21
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...   100   6e-21
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...   100   6e-21
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...   100   8e-21
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    98   3e-20
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...    98   4e-20
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...    97   5e-20
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    97   7e-20
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    96   2e-19
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    96   2e-19
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    95   3e-19
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...    94   7e-19
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    94   1e-18
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    93   1e-18
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    89   1e-17
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    90   1e-17
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    87   1e-16
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    84   1e-15
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    83   1e-15
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    73   2e-12
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    71   6e-12
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    72   7e-12
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    71   8e-12
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    64   9e-10
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    64   2e-09
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    63   3e-09
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     63   3e-09
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    62   8e-09
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    59   6e-08
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    56   4e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    54   2e-06
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    52   7e-06
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    48   1e-04
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    46   4e-04
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    41   0.013
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.31 
NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON} Anc_5...    36   0.51 
KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa] ...    35   1.1  
TBLA0B02370 Chr2 (552419..554335) [1917 bp, 638 aa] {ON} Anc_3.1...    34   1.8  
Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W...    34   2.0  
SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly...    34   2.2  
KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weak...    34   2.4  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...    34   2.5  
YHR108W Chr8 (328303..330060) [1758 bp, 585 aa] {ON}  GGA2Protei...    33   3.8  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     33   4.6  
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    33   5.0  
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    33   5.5  
Suva_15.304 Chr15 (530683..532446) [1764 bp, 587 aa] {ON} YHR108...    33   5.9  
TBLA0H01130 Chr8 (253122..253152,253271..255507) [2268 bp, 755 a...    32   6.6  
ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {...    32   7.4  
SAKL0F11704g Chr6 (912525..914219) [1695 bp, 564 aa] {ON} simila...    32   8.4  
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    32   8.6  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     32   9.4  

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
            CIN8Kinesin motor protein involved in mitotic spindle
            assembly and chromosome segregation
          Length = 1000

 Score = 1826 bits (4731), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 917/1000 (91%), Positives = 917/1000 (91%)

Query: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN
Sbjct: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEE                   QFMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDSNSNGSSNTGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNSSP 240

Query: 241  XXLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVXXXXXXXXXXXXXXXXXXXXXXXX 300
              LNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAV                        
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVNSRNNSSSNSGSTTNNASSNTNTN 300

Query: 301  XGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360
             GQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI
Sbjct: 301  NGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360

Query: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420
            FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL
Sbjct: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420

Query: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
            VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK
Sbjct: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480

Query: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540
            PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC
Sbjct: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540

Query: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600
            KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN
Sbjct: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600

Query: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660
            NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN
Sbjct: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660

Query: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720
            IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY
Sbjct: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720

Query: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780
            KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL
Sbjct: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780

Query: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840
            NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA
Sbjct: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840

Query: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900
            TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN
Sbjct: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900

Query: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLX 960
            IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRL 
Sbjct: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLS 960

Query: 961  XXXXXXXXXXXXPKKHAIEDENKSSENVDNEGSRKMLKIE 1000
                        PKKHAIEDENKSSENVDNEGSRKMLKIE
Sbjct: 961  NINSNSVQSVISPKKHAIEDENKSSENVDNEGSRKMLKIE 1000

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score = 1658 bits (4293), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 826/1002 (82%), Positives = 878/1002 (87%), Gaps = 2/1002 (0%)

Query: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MP ENQN+ Q+R+SN+ISKNGNSQ+GCHTV NEELNITVAVRCRGRNEREISMKSSVVVN
Sbjct: 1    MPVENQNSSQERTSNNISKNGNSQIGCHTVHNEELNITVAVRCRGRNEREISMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVA PLFQDFIKGY
Sbjct: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSD+AGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEE                   QFMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNSSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSSSRNSSP 240

Query: 241  XXLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQ--AVXXXXXXXXXXXXXXXXXXXXXX 298
              LNDLTPKAALLR+RLRTKSLPNTIKQQ Q QQ   +                      
Sbjct: 241  RSLNDLTPKAALLRRRLRTKSLPNTIKQQQQHQQQQTMNSRNNSSSNSGSATNNISSDTN 300

Query: 299  XXXGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSH 358
               GQR+S+APNDQ+NGIYIQNLQEFHITNAMEGL LLQKGLKHRQVASTKMNDFSSRSH
Sbjct: 301  NNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRSH 360

Query: 359  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 361  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 420

Query: 419  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
            ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 421  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 480

Query: 479  NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538
            NKPQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYM+QDHYKNLNSDLESYKNEVQ
Sbjct: 481  NKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEVQ 540

Query: 539  ECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISD 598
            ECKREIESLTSKN+LLVK+KLKSKETIQSQN QIESLK TIDHLR QLDKQHKTE+EIS 
Sbjct: 541  ECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEISG 600

Query: 599  FNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQE 658
            FN+KLQKLTEVMQMAL DYK+RELDLN+KFE HIT EIK +K+TLF QL+T+QQ +ILQE
Sbjct: 601  FNSKLQKLTEVMQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTLQQRNILQE 660

Query: 659  TNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK 718
            T+IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFN ++EKIDII VDF++
Sbjct: 661  TDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKIDIIGVDFER 720

Query: 719  FYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKK 778
            FYKNIAENLSDISEENNN+KQY  NHFF+NNHQELL+ HVDSTYE IEK+TN+FVENFKK
Sbjct: 721  FYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKTNQFVENFKK 780

Query: 779  VLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838
             LNDHL+ENKKLIM+NLTT TSAVIDQEM LFEPKRVKWE+SFDLIN+CDSMNNEFYNSM
Sbjct: 781  ALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDSMNNEFYNSM 840

Query: 839  AATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLK 898
            A TLSQIKSTVDTSSNSMN+SISVMKGQVEESENAISLLKNN KFNDQF+QLINKH +LK
Sbjct: 841  ATTLSQIKSTVDTSSNSMNKSISVMKGQVEESENAISLLKNNIKFNDQFKQLINKHTILK 900

Query: 899  DNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLR 958
            DNI++SITST+SHITN+DDIYNTIE IM NYGNKENATKDEMIEN+L EIPNLSK+MPLR
Sbjct: 901  DNIESSITSTNSHITNIDDIYNTIEKIMNNYGNKENATKDEMIENLLNEIPNLSKRMPLR 960

Query: 959  LXXXXXXXXXXXXXPKKHAIEDENKSSENVDNEGSRKMLKIE 1000
            +             PKKHAIEDEN S+ N D+E SRK+LK E
Sbjct: 961  ISNTNSNSMQNIISPKKHAIEDENSSNGNPDSESSRKILKTE 1002

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
            YEL061C (REAL)
          Length = 998

 Score = 1628 bits (4215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 821/1002 (81%), Positives = 877/1002 (87%), Gaps = 6/1002 (0%)

Query: 1    MPAENQNTGQDRSSNSISKNGNS--QVGCHTVPNEELNITVAVRCRGRNEREISMKSSVV 58
            MPAE+QNT Q+RSSNSIS NGN   Q+GCH+VPNEELNITVAVRCRGRNEREI MKSSVV
Sbjct: 1    MPAESQNTIQERSSNSISSNGNGNNQMGCHSVPNEELNITVAVRCRGRNEREIGMKSSVV 60

Query: 59   VNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIK 118
            VNVPDITGSKE+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIF+EVAGPLFQDFIK
Sbjct: 61   VNVPDITGSKEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFEEVAGPLFQDFIK 120

Query: 119  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKC 178
            GYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL+DAAGIIPRVLLKLFDTLELQQ+DYVVKC
Sbjct: 121  GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELNDAAGIIPRVLLKLFDTLELQQSDYVVKC 180

Query: 179  SFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXX 238
            SFIELYNEE                   QFMKKLRIFD                      
Sbjct: 181  SFIELYNEELKDLLDNNSNGSSNNGFDGQFMKKLRIFDSSTANNTTSNSASSSRSNSRNS 240

Query: 239  XXXXLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVXXXXXXXXXXXXXXXXXXXXXX 298
                LNDLTPKAALLRKRLRTKSLPNTIKQQ    Q                        
Sbjct: 241  SPRSLNDLTPKAALLRKRLRTKSLPNTIKQQ----QQQQAMNSRNNSSSNSGSAANNSSS 296

Query: 299  XXXGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSH 358
               GQRS M  NDQ+NGIYIQNLQEFHITNA+EGLNLLQ+GLKHRQVASTKMNDFSSRSH
Sbjct: 297  NTNGQRSPMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSH 356

Query: 359  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418
            TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN
Sbjct: 357  TIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 416

Query: 419  ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
            ALVD+SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK
Sbjct: 417  ALVDRSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 476

Query: 479  NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538
            NKPQLG+F+MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLES+KNEVQ
Sbjct: 477  NKPQLGAFMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQ 536

Query: 539  ECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISD 598
            ECKREIESL SKN+LLVKDKLKS+ETIQSQN Q+ESLK TI+HL+AQLDKQHK E+EIS 
Sbjct: 537  ECKREIESLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISG 596

Query: 599  FNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQE 658
            FNNKLQK+TEVMQ+AL DYKKRELDLN+KFE HI+KEIK LK+ LFLQL+ MQQ++I QE
Sbjct: 597  FNNKLQKMTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNIFQE 656

Query: 659  TNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK 718
            T+IQPNLDM+KNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIR++FQ 
Sbjct: 657  TDIQPNLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQN 716

Query: 719  FYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKK 778
            FYKNIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYENIEK+TN+FVENFK 
Sbjct: 717  FYKNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKM 776

Query: 779  VLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838
             LNDHL+ENKKLIMQN+T ATSAVIDQEMDLFEP+R KWENSFDLIN CDSMNNEFYN+M
Sbjct: 777  TLNDHLEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNM 836

Query: 839  AATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLK 898
            AATLSQIK TVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQF+QLI+KH +LK
Sbjct: 837  AATLSQIKKTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFKQLISKHIILK 896

Query: 899  DNIKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLR 958
            DNI++SITSTHSHITNVDDIYNTIE+IM N+GNKENATKDEMI+NILKEIPNLSK++PLR
Sbjct: 897  DNIESSITSTHSHITNVDDIYNTIEDIMTNHGNKENATKDEMIDNILKEIPNLSKRLPLR 956

Query: 959  LXXXXXXXXXXXXXPKKHAIEDENKSSENVDNEGSRKMLKIE 1000
            +             PKKH IEDEN SSEN D+EGSRK+ K E
Sbjct: 957  ISNINGCSVQDIISPKKHTIEDENPSSENADSEGSRKIPKTE 998

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YEL061C
            (REAL)
          Length = 999

 Score = 1608 bits (4164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 820/1000 (82%), Positives = 877/1000 (87%), Gaps = 1/1000 (0%)

Query: 1    MPAENQNTGQDRSSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVN 60
            MPAENQNT Q+RSSN+IS N N+Q+GCH VPNEELNITVAVRCRGRNEREI MKSSVVVN
Sbjct: 1    MPAENQNTIQERSSNNISNNLNAQIGCHGVPNEELNITVAVRCRGRNEREIGMKSSVVVN 60

Query: 61   VPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120
            VPDITGS+E+SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY
Sbjct: 61   VPDITGSEEVSINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGY 120

Query: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180
            NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF
Sbjct: 121  NCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSF 180

Query: 181  IELYNEEXXXXXXXXXXXXXXXXXXXQFMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXX 240
            IELYNEE                    FMKKLRIFD                        
Sbjct: 181  IELYNEELKDLLDNNSNNSSNNGFEGPFMKKLRIFDSNTANNTTSNSASSSRSNSRNSSP 240

Query: 241  XXLNDLTPKAALLRKRLRTKSLPNTIKQQYQQQQAVXXXXXXXXXXXXXXXXXXXXXXXX 300
              LNDLTPKAALLRKRLRTKSLPNTIKQQ+QQQ                           
Sbjct: 241  RSLNDLTPKAALLRKRLRTKSLPNTIKQQHQQQTTNSRNNSSSNPGSTNNNIPGNINTNN 300

Query: 301  XGQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTI 360
              QRSSMAPNDQ+NGIYIQNLQEFHITNAMEGLNLLQ+GLKHRQVASTKMNDFSSRSHTI
Sbjct: 301  -SQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSSRSHTI 359

Query: 361  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420
            FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL
Sbjct: 360  FTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 419

Query: 421  VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
             DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK
Sbjct: 420  ADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 479

Query: 481  PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 540
            PQLG+FIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC
Sbjct: 480  PQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQEC 539

Query: 541  KREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFN 600
            KR+IESL+SKN+LL+KDKLKSK+TIQSQN Q+ESLK TI+ L+AQLDKQHKTE+EIS FN
Sbjct: 540  KRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELEISGFN 599

Query: 601  NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETN 660
            NKLQKLTE+MQ+AL DYK+RELDLN+KFE HI+KEIK LK+TLF QL+ M+Q +I QETN
Sbjct: 600  NKLQKLTEIMQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQNNISQETN 659

Query: 661  IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFY 720
            IQPNLD+IKNEVLTLM TMQEKAELMYKDCVKKILNESPKFFNV++EKIDIIRVDFQ+FY
Sbjct: 660  IQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRVDFQRFY 719

Query: 721  KNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVL 780
             NIAENLSDISEENNN+KQYLKNHFFKNNHQELLN H+DSTYE+IEK+T+EFVENFK  L
Sbjct: 720  NNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEFVENFKNTL 779

Query: 781  NDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAA 840
            NDHL+ENKKLIMQNLT ATSAVI+QEMDLFEPKRVKWENSFDLIN CDSMNNEFYN+MA 
Sbjct: 780  NDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNNEFYNNMAT 839

Query: 841  TLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDN 900
            TLSQIK+TVDTSSNSMN+SISVMKGQVEESENA+SLLKNN KFNDQF+QL+NKH +LKDN
Sbjct: 840  TLSQIKNTVDTSSNSMNKSISVMKGQVEESENAVSLLKNNKKFNDQFKQLVNKHTILKDN 899

Query: 901  IKNSITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEIPNLSKKMPLRLX 960
            I+NSITSTHSHITN+DDIY+TIENIMKNYGNKENA K+EMI+NILKEIP+LSK++PLRL 
Sbjct: 900  IENSITSTHSHITNIDDIYDTIENIMKNYGNKENAVKNEMIDNILKEIPSLSKRVPLRLS 959

Query: 961  XXXXXXXXXXXXPKKHAIEDENKSSENVDNEGSRKMLKIE 1000
                        PKKHAI+DEN S+E  D E SRK+ K E
Sbjct: 960  NTNGNSAQNILSPKKHAIDDENPSNEITDGEESRKIQKTE 999

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/916 (52%), Positives = 637/916 (69%), Gaps = 47/916 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV+VPD+TGS E+SINTTGD GITAQ+N+K YTVD
Sbjct: 13  EELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINSKTYTVD 72

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A+Q L+F ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELS++
Sbjct: 73  EVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSES 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPR+L KLF+TLELQ+ DYVVKCSF+ELYNEE                      +KL
Sbjct: 133 AGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQEIASS--------RKL 184

Query: 213 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTIKQQYQQ 272
           RIFD                           +   P A  LRKR +T     ++ Q +Q 
Sbjct: 185 RIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWKTAP---SVTQSHQN 241

Query: 273 QQAVXXXXXXXXXXXXXXXXXXXXXXXXXGQRSSMAPNDQTNGIYIQNLQEFHITNAMEG 332
            Q                                    DQ  GIYIQNLQ+FHITNA EG
Sbjct: 242 SQ------------------------------------DQNAGIYIQNLQDFHITNAKEG 265

Query: 333 LNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINR 392
           + LLQKGLKHRQVA+TKMNDFSSRSHTIFTITLYK++  E+FR+SKMNLVDLAGSENI+R
Sbjct: 266 IKLLQKGLKHRQVATTKMNDFSSRSHTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISR 325

Query: 393 SGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIA 452
           SGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALIA
Sbjct: 326 SGAQHQRAKEAGSINQSLLTLGRVINSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIA 385

Query: 453 TISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKS 512
           TISPAK+ SEETCSTL+YA+KAKNIKNKPQLGS IMKDILVKNIT ELAKIK+DLLSTKS
Sbjct: 386 TISPAKINSEETCSTLQYAAKAKNIKNKPQLGSVIMKDILVKNITGELAKIKADLLSTKS 445

Query: 513 KEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQI 572
           KEGIYMSQD+YK L +DLESYK EV+ECKR IE+LTS+N LL+KDK  S E    Q  ++
Sbjct: 446 KEGIYMSQDNYKELTNDLESYKTEVKECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKL 505

Query: 573 ESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHI 632
           ++++  +  L ++ +KQ+K E  +    + L+     MQ  + ++++RE D+  K     
Sbjct: 506 QNMRDAMSDLYSKAEKQNKREQNLVATASTLKTTVGTMQSIIKEHERRERDIESKMGDLF 565

Query: 633 TKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVK 692
             E  ++K T+   +  ++Q+   +   +Q N+D I+ E+  L+   Q++ + MYKDCV+
Sbjct: 566 NNEFARVKQTILSNIRDIEQQIDWENIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVE 625

Query: 693 KILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQE 752
           KIL+E+P  F +  EK+  +       ++++ ENLSD+SEE NN++QYL +HFFKNNH+E
Sbjct: 626 KILDETPGHFQLAAEKVSEVEKLIATCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEE 685

Query: 753 LLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEP 812
           +L  H+D TY +I+   ++  + FK+++++HL++NK L++++L TAT  VI +EM LFEP
Sbjct: 686 ILVSHIDRTYHHIQTSADDLFQQFKEMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEP 745

Query: 813 KRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESEN 872
           ++ KWE+SF  IN CDS+N  F N + + L  IKST+ +S  ++N++I+ +K Q++E E+
Sbjct: 746 QKKKWEDSFKYINKCDSINFAFQNGVKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHES 805

Query: 873 AISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNYGNK 932
             S+L N+  F++QF  ++NK ++L +++K S+  T  H   VD +   I++++   G+ 
Sbjct: 806 PASMLSNSRVFSEQFSGILNKQSLLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSS 865

Query: 933 ENATKDEMIENILKEI 948
               + E ++ IL+ +
Sbjct: 866 MEGERVEHVDGILRRM 881

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  915 bits (2365), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/937 (51%), Positives = 645/937 (68%), Gaps = 38/937 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVR RGRNEREI  KSSVVV+VPD+ GS E++INTT D GITAQMN+K Y VD
Sbjct: 13  EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTTDDVGITAQMNSKTYAVD 72

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 73  KVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKTYTMTGDEKLYNDELSDS 132

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPR+L KLF+TL+L+  DYVVKCSF+ELYNEE                     M+KL
Sbjct: 133 AGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLLDDSVENSS--------MRKL 184

Query: 213 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTI-KQQYQ 271
           RI+D                             L     + R+R+RT  L +++ KQQ+Q
Sbjct: 185 RIYDSGSGSNSNSGSRKNSRNNSPK--------LVTDPMINRRRMRTVPLSSSLAKQQHQ 236

Query: 272 QQQAVXXXXXXXXXXXXXXXXXXXXXXXXXGQRSSMAPNDQTNGIYIQNLQEFHITNAME 331
            QQ                            ++   +P+    G+YIQNLQ+FHIT+A +
Sbjct: 237 WQQRREQQHQLREQQQREQQAQQQQKEQQQREQQQDSPS----GVYIQNLQDFHITSARD 292

Query: 332 GLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSENIN 391
           GL LLQKGL++RQVA+TKMNDFSSRSHTIFTITLY++HQ E+F++SKMNLVDLAGSENI+
Sbjct: 293 GLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEMFKVSKMNLVDLAGSENIS 352

Query: 392 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALI 451
           RSGA +QRAKEAGSINQSLLTLGRVIN+L DKS H+PFRESKLTRLLQDSLGGNTKTALI
Sbjct: 353 RSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESKLTRLLQDSLGGNTKTALI 412

Query: 452 ATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTK 511
           ATISPAK+ SEETCSTL+YASKAKNIKN+PQL SFIMKDILVKNIT ELAK+KSDLLSTK
Sbjct: 413 ATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILVKNITAELAKVKSDLLSTK 472

Query: 512 SKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQ 571
            +EG+YMSQD+YK + +DLESYK E+QE KR IE L+S+N+LL+KDK  S E  + Q  +
Sbjct: 473 LREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSLLLKDKKASNEVNELQRIK 532

Query: 572 IESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMH 631
           ++++K  +  L  +L+ QHK E E+ D    L+    + Q  + +Y +RE  ++++ +M 
Sbjct: 533 LQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSVIKEYGQREKQISERMQMI 592

Query: 632 ITKEIKKLKSTLFLQLNTMQQ----ESILQE---TNIQPNLDMIKNEVLTLMRTMQEKAE 684
           + +E  + +  L   +  ++       IL E     IQ NL++++ EV+ L+   Q++AE
Sbjct: 593 LGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLNVLRQEVVELLGLAQKRAE 652

Query: 685 LMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNH 744
            MYKD ++KIL E+P  F  +  K+D + V    +++ + ENLSDISE  NN+KQY  +H
Sbjct: 653 KMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTENLSDISEGYNNLKQYFNDH 712

Query: 745 FFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVID 804
           FFKNNH+E+LN H+D TY+ ++   +  ++ FK++++DHL +NK L+M++L +AT+  ID
Sbjct: 713 FFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKDNKTLMMKSLQSATTEAID 772

Query: 805 QEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMK 864
           +EM LFEP+R KWE SFDLIN+CDS++N F   M + LS IKST  +S++ ++ S+S +K
Sbjct: 773 KEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIKSTFGSSTDVISRSVSKVK 832

Query: 865 GQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIEN 924
            +V+  E+A ++L  N     Q   +INK + L++ +  SI S+  HI+  D++   I N
Sbjct: 833 DEVKGYEDASTILDGNEVVKRQIADIINKDSSLRNGLYKSIKSSQGHISAFDELKERIRN 892

Query: 925 IMKNYGNKENATKDEMIENILKEIPNL---SKKMPLR 958
            + +    EN+T   + +N +   P L   S++ PL+
Sbjct: 893 TIAS----ENST---LHQNKIATTPPLGQNSERSPLK 922

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  831 bits (2146), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/920 (49%), Positives = 608/920 (66%), Gaps = 50/920 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRN+REI  KSSVVV VPDI GSKE++INT+ D G TAQMN+K YTVD
Sbjct: 15  EELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDIGFTAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIFDE+A PLF DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLYN ELSD+
Sbjct: 75  KVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYNEELSDS 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPR+L KLF+TLE    D++VKCSF+ELYNEE                      KKL
Sbjct: 135 AGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCNNDNGN------FKKL 188

Query: 213 RIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAA-----LLRKRLRTKSL---PN 264
           RIFD                              +PK +      L+K+LR ++L    N
Sbjct: 189 RIFDSLGRDSRSNSRNN-----------------SPKMSNNNTTFLKKKLRNEALLRSRN 231

Query: 265 TIKQQYQQQQAVXXXXXXXXXXXXXXXXXXXXXXXXXGQRSSMAPND-------QTNGIY 317
               +    Q +                           + S A ND       QT GIY
Sbjct: 232 IASSKRSSMQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIY 291

Query: 318 IQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRIS 377
           IQNLQEFHIT A EG+ LLQKGLK+RQVASTKMNDFSSRSHTIFTITL+K+ + E+FR+S
Sbjct: 292 IQNLQEFHITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLS 351

Query: 378 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRL 437
           KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN+L DK+ H+PFRESKLTRL
Sbjct: 352 KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRL 411

Query: 438 LQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNIT 497
           LQDSLGGNTKTALIATISPAKVT EETCSTLEYASKAKNIKNKPQLGSFIMKDIL+KNIT
Sbjct: 412 LQDSLGGNTKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNIT 471

Query: 498 MELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKD 557
            EL KIKSDLLSTKSK+GIYM Q HYK L +DL++YK E+QECKR IESLTS+NALL+KD
Sbjct: 472 TELTKIKSDLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKD 531

Query: 558 KLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV---MQMAL 614
           K    E  + Q  +I+++  ++  L A++++Q   E E+   + K+Q  T+    +   +
Sbjct: 532 KRTINENNELQRIKIQTMNESMKKLYAKIERQQSIENEL---DGKIQIFTKTNSKLTKII 588

Query: 615 HDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLT 674
            + K RE  +N KF+  +   +  +   L  Q+   + + I Q   +  NL +IK+E+  
Sbjct: 589 DEMKNREALVNSKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTN 648

Query: 675 LMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEEN 734
           L+ T ++  E  Y++C+ K L+++P  F+ + + +  ++     +Y  IAENLSD+SEE 
Sbjct: 649 LLSTARDNFEKFYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEY 708

Query: 735 NNMKQYLKNHFF---KNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLI 791
           NN KQ++ + F+   K +  ELLN+++++T   IE  +N+ +   + +LN+HL  NK+LI
Sbjct: 709 NNFKQFITDEFYNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELI 768

Query: 792 MQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDT 851
           + +L+  T+ ++  E+D  +PK  KWE S +LIN  D++NNEF +++ ++++ +   +  
Sbjct: 769 INSLSNVTTELMSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQ 828

Query: 852 SSNSMNESISVMKGQVEESENAIS---LLKNNTKFNDQFEQLINKHNMLKDNIKNSITST 908
           +++S+N +I  +    + ++ A S   ++ +N    + F+ +  K++ L + +K     T
Sbjct: 829 TNDSINNNIKKINEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEKNSRLHEFVKEGYLVT 888

Query: 909 HSHITNVDDIYNTIENIMKN 928
           +  +  ++++  +I  ++K+
Sbjct: 889 NESMKKLNELDTSIRTVLKD 908

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/630 (53%), Positives = 464/630 (73%), Gaps = 8/630 (1%)

Query: 305 SSMA-PNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTI 363
           SS+A P++ TNGIYIQNLQEFHITNA EGL+LLQKGLKHRQVASTKMNDFSSRSHTIFTI
Sbjct: 289 SSIAGPDENTNGIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTI 348

Query: 364 TLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK 423
           TLYK+H+D LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L DK
Sbjct: 349 TLYKEHKDNLFRLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADK 408

Query: 424 SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 483
           S H+PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL
Sbjct: 409 SPHVPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 468

Query: 484 GSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKRE 543
           GS I+KDIL+KNIT ELAK+KSDL+STKSK+GIYMS +HY+ L  +LES K EVQE KR 
Sbjct: 469 GSVILKDILLKNITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRM 528

Query: 544 IESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKL 603
           IE L+S+N++L+KDK  + E  + Q  ++ +LK ++ +L  +L+ Q+  E ++ +   +L
Sbjct: 529 IEKLSSQNSMLLKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQL 588

Query: 604 QKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQP 663
           +K  E +   + +Y+ ++  L  +    + + + +LK  L    + ++Q       +++ 
Sbjct: 589 EKSREKLNSLVKNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQSE--GNFDVEM 646

Query: 664 NLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNI 723
           NL +IK+E+ +++   Q K E+MYK+ +++ L ++P     + E +  +      +Y  I
Sbjct: 647 NLKVIKDEITSMLEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEI 706

Query: 724 AENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDH 783
            ENLSDISEE NN+KQYL N FF+NNH++LLN H+++T + + + + E    FK +++ H
Sbjct: 707 TENLSDISEEYNNLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAH 766

Query: 784 LDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLS 843
           L ENKKL++ N  TAT+ VI +EM+LF+PKR KWE S +LIN CDS+NN F+++M   +S
Sbjct: 767 LMENKKLMIDNFRTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVS 826

Query: 844 QIKSTVDTSSNSMNESISVMKGQVEE-----SENAISLLKNNTKFNDQFEQLINKHNMLK 898
           +IK+ + +SS+S++ +I+ +K QV E       +  + L+N+  FN  F ++I K+ +L+
Sbjct: 827 KIKTNLASSSSSIHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEKNMILQ 886

Query: 899 DNIKNSITSTHSHITNVDDIYNTIENIMKN 928
            N KN+I  T   + N+D++  T++  + N
Sbjct: 887 KNRKNAINYTDKSLLNIDELSETVKIALNN 916

 Score =  270 bits (691), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 142/164 (86%), Gaps = 10/164 (6%)

Query: 34  ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDK 93
           ELNITVAVRCRGRNEREI+ KS VVV VPDITG++EISINTTG+TGITAQMN+K YTVDK
Sbjct: 28  ELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYTVDK 87

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-NGE-LSD 151
           VFGP A QDLIF EVA PLF+DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY NG  LSD
Sbjct: 88  VFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTMLSD 147

Query: 152 AAGIIPRVLLKLFDTLELQQN--------DYVVKCSFIELYNEE 187
           AAGIIPR+L KLFDTL+  ++        D+VVKCSF+ELYNE+
Sbjct: 148 AAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNED 191

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/618 (51%), Positives = 440/618 (71%)

Query: 309 PNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK 368
           P DQ+  IYIQNL+EFHIT+AMEGL LLQKGLK RQVASTKMNDFSSRSH+IFTITLYK+
Sbjct: 302 PIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKE 361

Query: 369 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP 428
              ELFR+SKMNLVDLAGSENI+RSGA+NQRAKEAGSINQSLLTLGRVIN+L DKS HIP
Sbjct: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421

Query: 429 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIM 488
           FRESKLTRLLQDSLGGNTKTALIATISPAK+TSEETCSTLEYASKAKNIKNKPQLG+FIM
Sbjct: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481

Query: 489 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLT 548
           KDILV++IT ELAKIKSDLLSTKSKEG+YMS +HYK+L+ D+E YK E++E KR IESLT
Sbjct: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLT 541

Query: 549 SKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTE 608
           ++NA+L +++L  K+        I SLK  +  L++ L +Q   E  I      +Q   E
Sbjct: 542 AQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANE 601

Query: 609 VMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMI 668
            M+  +H ++ ++ +L Q     I+ EI  ++ TL   +  +Q    L++T I  NL  +
Sbjct: 602 EMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRL 661

Query: 669 KNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLS 728
           + EV+ +++  +E+A   Y +CVK +L E+P+ F  V  ++D I    ++ +  IAE LS
Sbjct: 662 EKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLS 721

Query: 729 DISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENK 788
           D+SEE NN+KQYL N+FFKNNH+ELL+ HV +TY  +E+ + + ++NF  +L+ H+ ENK
Sbjct: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781

Query: 789 KLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKST 848
           + +++N+   T  VI+ E+ +F  +R KWE S  LIN CDS+N+ F+ ++ + L +I+  
Sbjct: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841

Query: 849 VDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITST 908
           V +S +++  +IS ++ +    ++   +++ N     Q  ++  K+  L    ++S  + 
Sbjct: 842 VSSSRDNIGATISSIQSRTRNRQSIEEMIQGNDVIRQQITRIKQKNKSLSLFKEHSTETA 901

Query: 909 HSHITNVDDIYNTIENIM 926
            + I +V+ +   ++ IM
Sbjct: 902 TTSIGSVNKVEGNLKVIM 919

 Score =  273 bits (697), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 145/187 (77%), Gaps = 6/187 (3%)

Query: 30  VPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRY 89
           +  EELNI VAVRCRGRNEREI  KSSVVV+VPD   + E+SINTT D GI A+MN+K Y
Sbjct: 27  LATEELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTY 86

Query: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149
           TVDKVFGP ASQ L+++E+A PLFQDFIKGYNCT+LVYGMTSTGKTYTMTGDEKL+NGEL
Sbjct: 87  TVDKVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLHNGEL 146

Query: 150 SDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFM 209
            DAAGIIPRVL +LFDTLE  ++DY+VKCSF+ELYNEE                      
Sbjct: 147 GDAAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLLDSTNTATNSDN------ 200

Query: 210 KKLRIFD 216
           KKLRIFD
Sbjct: 201 KKLRIFD 207

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/643 (49%), Positives = 464/643 (72%), Gaps = 9/643 (1%)

Query: 309 PNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKK 368
           P+ QT GIYIQNL+EFHIT+A EG+ LLQ+GL++RQVASTKMNDFSSRSHTIFTI LYK+
Sbjct: 297 PDKQT-GIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKE 355

Query: 369 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIP 428
           H  ++FRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIP
Sbjct: 356 HDGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIP 415

Query: 429 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIM 488
           FRESKLTRLLQDSLGGNTKTALIATISPAK+ SEETCSTLEYA+KAK+IKNKPQLGS I 
Sbjct: 416 FRESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIIT 475

Query: 489 KDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLT 548
           KDILVKNI  ELAK+K+DLLSTKS++G+YMSQ HYK L +DLESYK EVQECKR I+ LT
Sbjct: 476 KDILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLT 535

Query: 549 SKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTE 608
           ++N LL+KDK  S E    Q  +++S+K +I HL   ++KQH+ E  + D   KL+  + 
Sbjct: 536 TQNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSI 595

Query: 609 VMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMI 668
            MQ  +  + +RE     K +    +E+ +LKS L   L  + ++ ++  T++  N++ I
Sbjct: 596 EMQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKI 655

Query: 669 KNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQK----FYKNIA 724
           K+EV +++ T Q +A  +YKDC+++++ ESP     + +  DII++  QK    + + ++
Sbjct: 656 KDEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLND--DIIKM--QKISDLYNEQLS 711

Query: 725 ENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHL 784
            ++S+++ E+N++KQYL   FFK++H+E+LN H++ TY+NI + +   VE  K  L  +L
Sbjct: 712 ISISELNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYL 771

Query: 785 DENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQ 844
           +E++ +I+ +L   TS ++  EM+LF PK+ KWE+SF++IN CDS+NN+++  ++A LS 
Sbjct: 772 EESRNIIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSN 831

Query: 845 IKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNS 904
           +K++V ++S+ +++ +S M+   + +  +  L +N+ +   QF +++ K++ L+ ++  S
Sbjct: 832 MKTSVTSTSDLVDDHVSQMRKYTDNTSRSTKLTENSKRIGQQFTEMMEKNSKLESHLNES 891

Query: 905 ITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEMIENILKE 947
           IT   S I   D +  +I +  + Y      ++ +   N++K+
Sbjct: 892 ITMNESSINAFDKLSESIHSAFEKYNTANTISRLDESTNLMKQ 934

 Score =  267 bits (682), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 144/184 (78%), Gaps = 7/184 (3%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNI VAVRCRGRNEREI  KSSVVV+VPD+ GS EI+INTT D GI  QMN+K YTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A+Q LIF+EVA PLF DFI+GYNCTVLVYGMTSTGKTYTMTGDE+LYNGELSD+
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGDERLYNGELSDS 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPRVL KLFD +E Q +DY++KCSFIELYNEE                      KKL
Sbjct: 131 AGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQAINSTA-------KKL 183

Query: 213 RIFD 216
           RIFD
Sbjct: 184 RIFD 187

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
           Anc_6.16
          Length = 1069

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/637 (50%), Positives = 453/637 (71%), Gaps = 6/637 (0%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D  NGIYIQNLQEFHI+NA EGL LLQKGLK+RQVASTKMNDFSSRSHTIFTITLYK+H
Sbjct: 341 DDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQVASTKMNDFSSRSHTIFTITLYKEH 400

Query: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429
           Q  LFR+SKMNLVDLAGSENINRSGA+NQRAKE GSINQSLLTLGRVIN+L D++ HIPF
Sbjct: 401 QGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGSINQSLLTLGRVINSLADRNNHIPF 460

Query: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489
           RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGS I K
Sbjct: 461 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSIISK 520

Query: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549
           DIL+KNIT EL+++KSDLLSTKSKEGIYMSQ+HY+ L ++L+++K E  E KR IE L+S
Sbjct: 521 DILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQKLMNELDNHKTEADESKRIIERLSS 580

Query: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609
           +NALL+KDK  S E  + Q  ++   + +I+ L+ +++ Q+  E  +    +KLQ   + 
Sbjct: 581 QNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEKIEIQNGKEQMLVSSVSKLQTSCDT 640

Query: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669
            +  + +Y+ +++D+  K E  +  ++  L++ L    N ++  +   + +I  NLDMI+
Sbjct: 641 FKKMIENYECQQIDVKSKIEQILEDDLLSLRNLLQDHQNKIKTLNSGTDFDIGSNLDMIQ 700

Query: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729
           NEV+ ++ T QEKAE  YK  ++  L ++P+ F  + E I+ I +  Q  +  +A+NLSD
Sbjct: 701 NEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENFKKIGEDINDINIKIQNHHAAVAQNLSD 760

Query: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789
           ISEE NN+KQYL  + F+NNH++L+N H++ST + +    +     FK ++N HL+ N+ 
Sbjct: 761 ISEEYNNLKQYLNENLFQNNHEDLINAHINSTSQTLTNSADVLFNTFKDMMNKHLESNRN 820

Query: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849
           L++ +   AT  VI++EM+LF P++ KWE S DLIN CDS+NN F   +   LS  +S +
Sbjct: 821 LMLNSFKAATDEVINKEMELFIPRKKKWEESIDLINQCDSLNNGFQKEVTDGLSYTRSKI 880

Query: 850 DTSSNSMNESISVMKGQVEE------SENAISLLKNNTKFNDQFEQLINKHNMLKDNIKN 903
             S N M ++ + +K ++        S N  +++++N     QF +L  K+++ +DN++N
Sbjct: 881 TASINQMYDNSTRLKTEMSADNGGYNSINTKNVVEDNQIIRTQFNELARKNSIFQDNVEN 940

Query: 904 SITSTHSHITNVDDIYNTIENIMKNYGNKENATKDEM 940
           S+    + + N++ + ++I+  +++   K   T+ E+
Sbjct: 941 SLKCAVASVNNLNHLEDSIKMAVRDTRIKGGPTEGEV 977

 Score =  286 bits (731), Expect = 9e-81,   Method: Compositional matrix adjust.
 Identities = 129/153 (84%), Positives = 139/153 (90%)

Query: 35  LNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           LNITVAVRCRGRNEREI +KSSV+V VPDI GS E+SINTT D GITAQMN+K YTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           FGP A+Q LIFDEVA PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS++AG
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSESAG 171

Query: 155 IIPRVLLKLFDTLELQQNDYVVKCSFIELYNEE 187
           IIPR+L KLFDTLE+ Q DYVVKCSFIELYNE+
Sbjct: 172 IIPRILFKLFDTLEMNQEDYVVKCSFIELYNED 204

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/618 (50%), Positives = 427/618 (69%), Gaps = 4/618 (0%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           ++Q++ IYIQNLQEFHITNA +G+NLLQ+GLKHRQVASTKMNDFSSRSHTIFTI LYK H
Sbjct: 255 SEQSSAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNH 314

Query: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429
             E+FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 315 NGEVFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 374

Query: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489
           RESKLTRLLQDSLGGNTKTALIATISPAK+ +EET STLEYA+KAKNIKNKPQLG+ +MK
Sbjct: 375 RESKLTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMK 434

Query: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549
           DILVKNIT ELAKIKSD LSTKSK+GIYM+QDHYK L SDLE+YK EVQECKREIE + S
Sbjct: 435 DILVKNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNS 494

Query: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609
           +N LL+KDK  S E  + Q  +I+ L   I HL  ++DKQHK E ++    + L+     
Sbjct: 495 QNVLLLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYT 554

Query: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669
           +Q +L + +  +L    + E  +   +   K ++  QL  M+     +   I  N+D+I+
Sbjct: 555 VQNSLKNCEDYQLQCKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729
            E+  ++ ++   +  + + CV+KIL  +PK F  +   +  I      +   + +NL D
Sbjct: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789
           ISEE NN ++YL  H FKNNH+E L+ HVD TY  ++K   E    FK++++ HL+ENK 
Sbjct: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849
           L++++L TA+  V+ +E+ LF P + KWE+S + IN CDS+NN F +++   L +++  +
Sbjct: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH 909
           + S      +   +K  +++ +    +LKNNTK  +   ++  KH  L+D ++     T 
Sbjct: 795 EGSLEFSKNTAGDVKDSLKKFDGISEVLKNNTKVVNNINEVKEKHTFLRDQVER----TS 850

Query: 910 SHITNVDDIYNTIENIMK 927
           S+I   ++ +  I+  ++
Sbjct: 851 SYIEAANEKFEGIDQFIR 868

 Score =  281 bits (720), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 146/184 (79%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNITV+VRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GITAQMN+K YTVD
Sbjct: 15  QELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVD 74

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF ++A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELSDA
Sbjct: 75  KVFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSDA 134

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPR+L KLFDTLE Q  DY+VKCSFIELYNEE                     +KKL
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNEPQESG--------VIKKL 186

Query: 213 RIFD 216
           RIFD
Sbjct: 187 RIFD 190

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/638 (49%), Positives = 448/638 (70%), Gaps = 4/638 (0%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+Q++ IYIQ+LQEFHIT+A EGL LLQKGL HRQVASTKMND SSRSHTIFT+TLYK  
Sbjct: 263 NEQSSAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNF 322

Query: 370 QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPF 429
             E FR+SK+NLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPF
Sbjct: 323 NGETFRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPF 382

Query: 430 RESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMK 489
           RESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQLGSF+MK
Sbjct: 383 RESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMK 442

Query: 490 DILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTS 549
           DILVKNI+ ELAK+KSD LSTKSKEGIYMS  HY  + +D+E+YK E+QE +REIE L+S
Sbjct: 443 DILVKNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSS 502

Query: 550 KNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV 609
           +N LL KDK  S++TI+SQ  QI +L++++D+L  ++D +HK EIE+++   KL+     
Sbjct: 503 QNQLLHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRN 562

Query: 610 MQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIK 669
           MQ AL  ++  E  L    +  +   I + +  +  +L+ ++Q+++ Q   I  +++ +K
Sbjct: 563 MQGALKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVK 622

Query: 670 NEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729
           + + TL+ T+++ A +M ++  +K++ + PKFFN ++ +++ +     +    + E LS 
Sbjct: 623 DSLETLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQ 682

Query: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789
           I+ ENNN+K YL  HFF+NNHQE+LN H D TY  +   +   +     +++DH+++N+ 
Sbjct: 683 ITAENNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRT 742

Query: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849
           L+M  L TAT+ VI QEM  FEP R  WE SF+ IN CDS++N+F +    +L+ +KS +
Sbjct: 743 LLMDTLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM 802

Query: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH 909
           +++    +     +K  +   ++   +    T  N   + + NKH++L+D ++ +++  H
Sbjct: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTNINGTVDDIKNKHSVLRDELEKNVSFIH 862

Query: 910 SHITNVDDIYNTIENIMKNYGNKENATK---DEMIENI 944
           +       I ++++ IM N+   E  T+   D++I++I
Sbjct: 863 ASSEGFKAIDSSLKRIM-NFRMPEGKTETLADDLIKHI 899

 Score =  281 bits (719), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 141/155 (90%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +ELNITVAVRCRGRNE+EI  KSSVVVN PD+ G+ E+SINT+GD GITA+MN+K YTVD
Sbjct: 11  DELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYTVD 70

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q L+F E+A P+F DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+GELS+A
Sbjct: 71  KVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKLYDGELSEA 130

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEE 187
           AGIIPRVL KLFDTLE+Q++DY+VKCSFIELYNEE
Sbjct: 131 AGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEE 165

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/620 (48%), Positives = 421/620 (67%)

Query: 307 MAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLY 366
           ++P + ++ I+IQNLQEFHI +A EG+ LLQ+GL+HRQVASTKMND SSRSHTIFTI LY
Sbjct: 229 VSPCEPSSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLY 288

Query: 367 KKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH 426
           KK   E FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS H
Sbjct: 289 KKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSLH 348

Query: 427 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSF 486
           IPFRESKLTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GSF
Sbjct: 349 IPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSF 408

Query: 487 IMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIES 546
           IMKD+L+K++T EL KIKSDLLSTKSK+GIYMSQ++YK L ++LE+YK EV+ECKR +E 
Sbjct: 409 IMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAMEK 468

Query: 547 LTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKL 606
           ++++N+LL+K+K  S E  +SQ  ++  L   I+ L  ++D+QHK E E+S+   +L + 
Sbjct: 469 VSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMRA 528

Query: 607 TEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLD 666
              MQ +L  Y+ +    + + E  +   I   K +L  ++  ++        +++ N+D
Sbjct: 529 LHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNVD 588

Query: 667 MIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAEN 726
            +  E+  +   M      ++++ +KK+ +++P +F  +  +++ I      +  N+  +
Sbjct: 589 AVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMIH 648

Query: 727 LSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDE 786
           LS ISEE NN+K YL  HFFKNN QE L+ HVD TY  ++   N      +++LN+ LD 
Sbjct: 649 LSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELDT 708

Query: 787 NKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIK 846
           NK+ +MQ+L  A S V+ +EM L +P +  WENS + IN+CD +NN F N +  T+++I 
Sbjct: 709 NKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEIF 768

Query: 847 STVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSIT 906
            T+D    +   +    K ++     A S L+NN       + +  KHN+LK  +++S  
Sbjct: 769 KTIDQGQKTSQVTTEDAKSELTRVRAAFSSLQNNGIILQNVDSIKKKHNLLKSQVQDSAN 828

Query: 907 STHSHITNVDDIYNTIENIM 926
              +      +I N+I++++
Sbjct: 829 YMQAATQKFGEIDNSIQDLL 848

 Score =  277 bits (709), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 130/185 (70%), Positives = 146/185 (78%), Gaps = 8/185 (4%)

Query: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           +EELNITVAVRCRGRNE+E+  +SSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTV
Sbjct: 4   DEELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTV 63

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DKVFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+
Sbjct: 64  DKVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSE 123

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 211
            AGIIPRVL KLFD L  Q +DY++KCSFIELYNEE                      KK
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEE--------LKDLLDETPDSSMPKK 175

Query: 212 LRIFD 216
           LRIFD
Sbjct: 176 LRIFD 180

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  544 bits (1401), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 283/602 (47%), Positives = 419/602 (69%), Gaps = 14/602 (2%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           +Q++ IYIQNLQEFHITNA EG+++LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK ++
Sbjct: 242 EQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKSYE 301

Query: 371 DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430
            ELFRISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFR
Sbjct: 302 GELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFR 361

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490
           ESKLTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLGSF+MKD
Sbjct: 362 ESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYATKAKNIKNRPQLGSFMMKD 421

Query: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSK 550
           ILVK+I+ EL+K+KSD LSTK+KEGIYMS +HY+ + +DLE+Y+ E+QE KR++ES +S+
Sbjct: 422 ILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLENYQTEIQESKRQVESFSSQ 481

Query: 551 NALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVM 610
           N+LL+KDK  S++  + Q+ +I  L+ TI++L  ++++QH+ EI++    +KL++    M
Sbjct: 482 NSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHRNEIDLVSTIHKLKEALHTM 541

Query: 611 QMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKN 670
           + +L +Y+  EL L    +  + + I   + ++   L T++   + +  +I  N+D I+ 
Sbjct: 542 KGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVKTRMLDKNLSINHNMDEIRT 601

Query: 671 EVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDI 730
                + +++     M  + VK + ++    +    E +  +    Q +   +   L+++
Sbjct: 602 IFHETLDSVRSAGSDMCTNIVKIVKDQPSTSYQQFKEALGDLDTKVQTYSVTLTNKLTEM 661

Query: 731 SEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKL 790
           +EENNNMK+YL  HF KNN+QE+L+  ++  Y   +  ++  + +   ++  H++E++ L
Sbjct: 662 TEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASDALISSVVSMMESHMEESRNL 721

Query: 791 IMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVD 850
           ++ ++  A S +ID+E+++F+P + +W  SF+ IN+CD+ + +F N     L+ +K   D
Sbjct: 722 MLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAAHQQFENKSTKLLTNLKELAD 781

Query: 851 TS-------SNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKN 903
            S       +  + E+++  +G V ++    S++K     ND       KH ML+D+ +N
Sbjct: 782 NSVVAADDVAKQVQENVTNFEGIVRQASAKESIVKQMNDIND-------KHKMLEDHFEN 834

Query: 904 SI 905
           +I
Sbjct: 835 NI 836

 Score =  277 bits (709), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 146/185 (78%), Gaps = 10/185 (5%)

Query: 32  NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           NEELNITVAVRCRGRNEREI  KS+VVV VPD+TGS E+SINTTGD GI  +MN++ YTV
Sbjct: 18  NEELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTV 77

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           D+VFGP A Q LIF  +A PLF DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY+GELSD
Sbjct: 78  DQVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGELSD 137

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKK 211
           +AGIIPRVL +LFDTLE  ++D++VKCS+IELYNEE                    + K+
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEE----------LKDLLDDTPDYSKR 187

Query: 212 LRIFD 216
           LRIFD
Sbjct: 188 LRIFD 192

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score =  538 bits (1385), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/605 (48%), Positives = 410/605 (67%), Gaps = 35/605 (5%)

Query: 308 APNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 367
            P  QT GIYIQNL++FHI+ A EGL LLQ+GL+ RQVA+TK+ND SSRSHTIFTITLYK
Sbjct: 263 VPPTQT-GIYIQNLKDFHISTAKEGLQLLQRGLQRRQVATTKLNDVSSRSHTIFTITLYK 321

Query: 368 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 427
           K +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L DKS HI
Sbjct: 322 KFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHI 381

Query: 428 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFI 487
           PFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLGSFI
Sbjct: 382 PFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFI 441

Query: 488 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESL 547
           +KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K E+ E KR  +SL
Sbjct: 442 IKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSL 501

Query: 548 TSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLD-----------KQHKTEIEI 596
             +N LL K+K    E       + +SLK+ +D+LR+QL            +  K   ++
Sbjct: 502 VQENELLGKEKKSGAE-------RADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQV 554

Query: 597 SDFN---NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQE 653
           +D N    +L+ L EV Q   H+  K       KF+  +  E+  L + +  Q +T++  
Sbjct: 555 TDMNRIQTELKSLIEVYQQK-HETSK------HKFQRLLKDELATLTAKILSQWDTLKN- 606

Query: 654 SILQETN--IQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDI 711
             +   N  I  ++D I+ EV+ L+ T +E AE +YK C+  +L E+PK F ++ + +  
Sbjct: 607 --VNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGD 664

Query: 712 IRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNE 771
           IR   ++ Y  +A N SD+SEE N  KQYL   FF+NNH E++  H D    N++K +++
Sbjct: 665 IRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDD 724

Query: 772 FVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMN 831
            +++ +  + ++L  N +++  ++      VI++EMDLF PK+ KWE S DLIN  DS++
Sbjct: 725 LLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLS 784

Query: 832 NEFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESE-NAISLLKNNTKFNDQFEQL 890
           N+F N+M  ++  I S +  S+ SM+ SIS +K  + E++ N+   + +N    + F+ +
Sbjct: 785 NKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAI 844

Query: 891 INKHN 895
             K N
Sbjct: 845 QEKSN 849

 Score =  209 bits (532), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 101/156 (64%), Positives = 129/156 (82%), Gaps = 4/156 (2%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           +++NITVAVRCRGRN+REI  KS +VV VPD+T + E+SINT+G +GI AQ+ AK YTVD
Sbjct: 23  DDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEVSINTSGGSGIEAQLQAKTYTVD 82

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELSD 151
           KV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD E    G+++ 
Sbjct: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142

Query: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEE 187
            AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+
Sbjct: 143 QAGIAPRILVKLFECL---QDDYVVKCSFVELYNED 175

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  537 bits (1383), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 296/673 (43%), Positives = 431/673 (64%), Gaps = 13/673 (1%)

Query: 314 NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 373
           + I+IQNLQEFHI +A EG+ LLQ+GL+HRQVASTKMND SSRSHTIFTI LY+K   E 
Sbjct: 235 SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIMLYRKCNGES 294

Query: 374 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 433
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DK+ HIPFRESK
Sbjct: 295 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 354

Query: 434 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILV 493
           LTRLLQDSLGGNTKTALIATISPAK+ SEET STLEYA+KAKNIKNKPQ+GSFIMKD+LV
Sbjct: 355 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGSFIMKDVLV 414

Query: 494 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNAL 553
           KN+T EL KI+SDLL+TKSK+GIYMSQ++YK L ++LE+YK EVQECKR IE L+++N L
Sbjct: 415 KNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYKTEVQECKRAIERLSTQNGL 474

Query: 554 LVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMA 613
           L K+K  + E  +SQ  +I+ L   ID L  ++D+QHK E E+S+   +L +    MQ +
Sbjct: 475 LTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQELSNVVQELMRALRTMQNS 534

Query: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQET--NIQPNLDMIKNE 671
           L  Y+ +      + E  + + I   K +L   LN +++    +E   ++  N+D +  E
Sbjct: 535 LKVYEDQGHRFQTEMERVLYENIGSFKHSL---LNEIEKLKGTEEDGFDVDANIDTLTKE 591

Query: 672 VLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDIS 731
           +  +   +      + +  + KI  ++P +   +  +++ I      +  ++  +LS IS
Sbjct: 592 LNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHVVGSYSSDLMMHLSSIS 651

Query: 732 EENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLI 791
           EE N++K YL  HFFKNN Q+ L+ HVD TY  ++   N      ++++N+ L+ NK+++
Sbjct: 652 EEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLKLREMMNEELETNKEIM 711

Query: 792 MQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDT 851
           MQ+L  A S V+ +EM L +P +  WE+S + IN+CD +N+ F   + + +  +   ++ 
Sbjct: 712 MQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFEKDIGSVVRDVFEKINE 771

Query: 852 SSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSH 911
                  ++      +   ++A   L+ +       E++  KHNMLK  +++S +   + 
Sbjct: 772 GLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIEEIKKKHNMLKLKVQDSASYMEAA 831

Query: 912 ITNVDDIYNTIENIMKNYGNKENATKDEMIENILKEI---P----NLSKKMPLRLXXXXX 964
                +I ++I+ ++ +    +  +++  IE +L+++   P      S K P+R+     
Sbjct: 832 TQKFGEIDDSIQGLLNSQAVSQPHSENR-IEGLLEQLNGKPLKPLGPSGKTPMRITQGCI 890

Query: 965 XXXXXXXXPKKHA 977
                   P+K +
Sbjct: 891 ASSDQLSLPRKRS 903

 Score =  275 bits (702), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 145/184 (78%), Gaps = 8/184 (4%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNE+E+  KSSVVV VPD+TG+ E+SINTTGDTGITAQ+N+K YTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           +VFGP A Q LIF  +A PLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE+LY+GELS+ 
Sbjct: 65  RVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDERLYDGELSEG 124

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPRVL KLFD L+   +DY++KCSFIELYNEE                      +KL
Sbjct: 125 AGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEE--------LKDLLDETPDSSMPRKL 176

Query: 213 RIFD 216
           RIFD
Sbjct: 177 RIFD 180

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  537 bits (1383), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 286/617 (46%), Positives = 425/617 (68%), Gaps = 2/617 (0%)

Query: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 374
            IYIQNL+EFHI NA EG+ LLQKGLK+RQVASTKMND SSRSHTIFTI LYK+H+ E+F
Sbjct: 237 SIYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFTINLYKEHKGEIF 296

Query: 375 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKL 434
           +ISKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN++ DK+ HIPFRESKL
Sbjct: 297 KISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIADKNIHIPFRESKL 356

Query: 435 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVK 494
           TRLLQDSLGGNTKTALIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGS IMKD+ +K
Sbjct: 357 TRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQLGSIIMKDVRLK 416

Query: 495 NITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALL 554
           ++  ELAKIK DL STK K+G+YM+Q+HYK+L +DLESYK E+QEC R ++SL  +NALL
Sbjct: 417 DLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDRIVKSLELQNALL 476

Query: 555 VKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTE-IEISDFNNKLQKLTEVMQMA 613
           +KDK  S E  + Q   +  +  T+ +++  L+ QHK E I + +  +  +K  + M+  
Sbjct: 477 LKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAHSREKSLK-MKTV 535

Query: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVL 673
           + +Y ++E  +    +     E+ KLK  L   LN + +E+++ +TN++ N+ +IK++V+
Sbjct: 536 IKEYSEKEERIQSNMKSIFNDELIKLKELLIENLNGIAKENLIVQTNVKDNIKLIKDDVI 595

Query: 674 TLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEE 733
           +++   QE ++ ++ +  ++I+ E+P    +    +   +   + ++ N+ ENL  I ++
Sbjct: 596 SIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETYFANLFENLESIKQQ 655

Query: 734 NNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQ 793
            + + +Y  N FFK+NH  ++N HV++T   IEK  ++  + F++ +    ++N+KLI++
Sbjct: 656 YSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQNMEAFAEQNEKLILE 715

Query: 794 NLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSS 853
           NL T +S +I  EM+ F+  + +W+ SF  IN CD +NN +++ M   L  +K  + +S 
Sbjct: 716 NLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYHDQMHTYLRNMKGKLQSSD 775

Query: 854 NSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHIT 913
             + + ++ +K  V+   +   LL  +    D + Q+I+K + L D+++ S+ ST + + 
Sbjct: 776 EIIKKHMNQIKSNVDSLNSTPKLLNTDRAIGDNYNQIISKRDKLHDHLQISLNSTQNSLL 835

Query: 914 NVDDIYNTIENIMKNYG 930
             D+I  +I+    NY 
Sbjct: 836 VFDEICKSIQFAFANYS 852

 Score =  268 bits (684), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 124/186 (66%), Positives = 148/186 (79%), Gaps = 11/186 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGD--TGITAQMNAKRYT 90
           +E+NI VAVRCRGRN+REI  KSSV+V+VPD+ GS EISINT+ D  +G+TAQ+N+K YT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
           VDKVFGP A+Q LIF+E+A PLF DF++GYNCTVLVYGMTSTGKTYTMTGDEKLY G+LS
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGDEKLYKGDLS 132

Query: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMK 210
           D+AGIIPRVL KLF+T+E Q ++YV+KCSFIELYNEE                     +K
Sbjct: 133 DSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLIDSNNTK---------LK 183

Query: 211 KLRIFD 216
           KLRIFD
Sbjct: 184 KLRIFD 189

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  537 bits (1383), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 312/643 (48%), Positives = 424/643 (65%), Gaps = 24/643 (3%)

Query: 305 SSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT 364
           S  AP D  N IYIQNLQEF+I NA +G+ LLQKGL+HR+VASTKMND SSRSHTIFTIT
Sbjct: 324 SEKAP-DNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTIT 382

Query: 365 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
           LYK+H   L+R+SKMNLVDLAGSENIN+SGA +QRAKEAGSINQSLLTLGRVIN+L DKS
Sbjct: 383 LYKEHNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKS 442

Query: 425 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 484
            HIPFRESKLTRLLQDSLGGNTKT LI+TISPAK+  +ET STLEYASKAKNIKNKP LG
Sbjct: 443 IHIPFRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLG 502

Query: 485 SFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREI 544
           SFIMKD+L+KNIT EL KIKSDL+ST+ K+G+YMSQ HYK LN+DLESYK EVQE KR  
Sbjct: 503 SFIMKDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRAN 562

Query: 545 ESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQ 604
           E L S+N  L+KDK  S E  + Q  QIE     I  L   LD+ +K E  + +   +L+
Sbjct: 563 ERLISQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLK 622

Query: 605 KLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESI--------- 655
            +   MQ  + +Y++R+L++ +  +  +  E K LK+ L   L+ +    I         
Sbjct: 623 NVGTSMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIIS 682

Query: 656 -------LQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEK 708
                  +  +N Q N+D+I+N  L +++ +QEK++ +Y  C+++IL++ P   N    K
Sbjct: 683 NNSSIEAIDSSNFQKNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKF--K 740

Query: 709 IDIIRVDFQ---KFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENI 765
           I+I  +DFQ   +F K I ENLSD+SEE NN K+YL N F +NN++ +L  H++S    I
Sbjct: 741 IEINSIDFQYNDQFNK-ITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQI 799

Query: 766 EKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLIN 825
           E  +N  + N  K +N+    N KL  + L    + ++ +E +  +P + KW  S ++IN
Sbjct: 800 ESFSNNLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIIN 859

Query: 826 DCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMK-GQVEESENAISLLKNNTKFN 884
             D +NN F+N M   + QI + +  S N +N SI+ +K  ++ E+E    +L +NT++ 
Sbjct: 860 STDKINNTFHNDMNNRILQINNLILQSHNDINNSINDIKVNEIRENEAVNEILSSNTEYV 919

Query: 885 DQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMK 927
           +   +L  K+   ++ +K    S+ + I  +D     IE+ +K
Sbjct: 920 NNINELKIKNMDYQEKLKCIGKSSENSINYLDSTKQVIESGLK 962

 Score =  275 bits (704), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 148/190 (77%), Gaps = 10/190 (5%)

Query: 27  CHTVPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNA 86
            HT   EELNITVAVRCRGRNERE+  KSSVVV+VPDI GS E+SINT+ + GI A MN+
Sbjct: 4   THT-SGEELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNS 62

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           K YTVDKVFGP ASQDL+F E+A PLF+DFIKGYNCT+LVYGMTSTGKTYTMTGDEKLY+
Sbjct: 63  KTYTVDKVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGDEKLYD 122

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXX 206
           GELSD+AGIIPRVL KLF++ E+  +DY++KCSF+ELYNE+                   
Sbjct: 123 GELSDSAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVDNT------- 175

Query: 207 QFMKKLRIFD 216
              KKLRIFD
Sbjct: 176 --YKKLRIFD 183

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  530 bits (1366), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 281/596 (47%), Positives = 409/596 (68%), Gaps = 8/596 (1%)

Query: 314 NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDEL 373
           +GIY+QN+QEFHI NA EG+N+LQKGLKHRQVASTKMNDFSSRSHTIFTI LYK    EL
Sbjct: 246 SGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIMLYKNCDGEL 305

Query: 374 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESK 433
           FR+SKMNLVDLAGSENI+RSGA NQRAKEAGSINQSLLTLGRVIN+L DKS HIPFRESK
Sbjct: 306 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSIHIPFRESK 365

Query: 434 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILV 493
           LTRLLQDSLGGNTKTALIATISPAK+ ++ET STLEYA+KAKNIKN+PQLG+ +MKDILV
Sbjct: 366 LTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLGALMMKDILV 425

Query: 494 KNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNAL 553
           KNI+ ELAKIKSD LSTKSK+GIYMS +HY+ + +DLE+ + E+QE KR+IESLTS+N L
Sbjct: 426 KNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQIESLTSQNNL 485

Query: 554 LVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMA 613
           L+KDK  S+E  + QN +I+ L++TI++L  ++++QH  E E++   +KL++    MQ +
Sbjct: 486 LLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELATTIHKLKEALHTMQGS 545

Query: 614 LHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVL 673
           L  Y+  EL L    +  + + I   + ++   L  ++   + +  +I+ N++ I     
Sbjct: 546 LKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLSIKENINNITTIFD 605

Query: 674 TLMRTMQEKAELMYKDCVKKILNESP----KFFNVVIEKIDIIRVDFQKFYKNIAENLSD 729
             +++++     M  D + K++ E+P    K FN   E +  ++ +   +   +   L++
Sbjct: 606 DTLKSVEANGSDMC-DTLVKLIKETPSMYLKEFN---ETVSSLKSELSSYSNALTNKLTE 661

Query: 730 ISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKK 789
           ISEENN++++YL  H FKN+ QE+L+  ++S Y+ ++  +++ +     ++  H++E++ 
Sbjct: 662 ISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSMVGAHVEESRT 721

Query: 790 LIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTV 849
           L++ ++    + +ID E  LF+P R +W  S D IN CD+ +  F     + L ++K   
Sbjct: 722 LMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKSTSGLDKLKELS 781

Query: 850 DTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSI 905
           D S  S  ++++  K + +   + +  L  +     Q   + +KH ML+D+  +++
Sbjct: 782 DASLKSSEDAVNKAKHRTDSFHDFVQKLCCDQSLKKQMHDISDKHRMLEDHFDDNV 837

 Score =  271 bits (692), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 125/184 (67%), Positives = 143/184 (77%), Gaps = 10/184 (5%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92
           EELNITVAVRCRGRNEREI  KSSVVV VPD+TGS E+SINTT + GI A+MN++ YTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTVD 78

Query: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
           KVFGP A Q LIF E+A PLF DF+KGYNCTVLVYGMTSTGKTYTMTGDEKLY+G+LSD+
Sbjct: 79  KVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGDEKLYDGQLSDS 138

Query: 153 AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFMKKL 212
           AGIIPR++ KLFD LE   +D++VKCS+IELYNEE                      K+L
Sbjct: 139 AGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHDSS----------KRL 188

Query: 213 RIFD 216
           RIFD
Sbjct: 189 RIFD 192

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  526 bits (1355), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 320/940 (34%), Positives = 527/940 (56%), Gaps = 60/940 (6%)

Query: 34  ELNITVAVRCRGR--NEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           E NI V  R +G+  NE+   ++  +++  P +   K        D  +      + + +
Sbjct: 12  ECNIKVVARFKGQIDNEKGDDVRDQIIIEEPGLIKFK------GKDDAV-----KREFGM 60

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE-KLYNGELS 150
           D +F     Q+ ++ +   P+FQDFI GYNC+ LVYG T +GKTYT++G+E  L + E S
Sbjct: 61  DHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLLHSEAS 120

Query: 151 D-AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXXXXXXXXXXXXXXXXXXQFM 209
             + G+IPRVL +LFD L     D+VVKCS++E+YNEE                     +
Sbjct: 121 RLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSLLSAS-----I 175

Query: 210 KKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLPNTIKQQ 269
           KKLRI D                            D +P  +       +KS+P  I ++
Sbjct: 176 KKLRIVDSGSPNVKNGANSNCNTR-----------DNSPLTS-------SKSIPTAIIRK 217

Query: 270 YQQQQAVXXXXXXXXXXXXXXXXXXXXXXXXXGQRSSMAPNDQTNGIYIQNLQEFHITNA 329
              +Q++                          Q  + AP       YIQNL+EFHITNA
Sbjct: 218 KMGRQSLTALKQANTLSISRSNSFNEYSPQRHIQEKTGAP-------YIQNLEEFHITNA 270

Query: 330 MEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISKMNLVDLAGSEN 389
            EG+ LL +GLK+RQ+AS+K   +SSR+ TIFTI LYK+ + E+FR+SK N VDLAG+E+
Sbjct: 271 KEGIQLLHRGLKNRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEH 330

Query: 390 INRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTA 449
            ++    NQR K+   INQ +  L +++N+L +K   IPF++SKLT L++D+L GN+K+ 
Sbjct: 331 SHKIEGTNQRFKDINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSI 390

Query: 450 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLS 509
            I T+   K + +E   TLE+ +K +++K  P LG  I K+ L+K+I+ ELAK+KSDLLS
Sbjct: 391 FILTLRFNKDSLDEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLS 450

Query: 510 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQN 569
           TKSKEG+YMS +HY  L  DL+ +K E+ + K+ I+ L  ++  L KDK   +E  + Q 
Sbjct: 451 TKSKEGVYMSHEHYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQR 510

Query: 570 CQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFE 629
            +++S++ ++  +   ++KQ + E ++ +  +KL++    M + +  Y  RE  +  + +
Sbjct: 511 IKLQSMRDSVSMMYTNIEKQQRREHDLINSTDKLKETVNNMNVTIARYTDRESSVQTQMK 570

Query: 630 MHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKD 689
               +E+ KLKS L   L   ++  ++    I+ NL+    E+  +++  + + + ++ D
Sbjct: 571 TLFNEELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLD 630

Query: 690 CVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNN 749
           C+KK+  ESPK F+  I+ +  +     + Y N+AE LSD+SEE NN+KQY+   FFKNN
Sbjct: 631 CIKKMSEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNN 690

Query: 750 HQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDL 809
           H+ELL  +V+ TY  ++K +++F+  F  +L  +L+ NK +++QN+ +ATS VI+ EM+ 
Sbjct: 691 HEELLKTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNH 750

Query: 810 FEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEE 869
           F P++ KWE S +LI      +NEF       + +++ T+  +S S+ +++S MK ++ E
Sbjct: 751 FIPQKEKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKINE 810

Query: 870 SENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNY 929
            + A ++++NN    ++F  ++ K+ +LKD +  ++TST   I   D + ++I N+ KN 
Sbjct: 811 LQKAANIIENNEVVTEEFISIMKKNGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKN- 869

Query: 930 GNKENATKDEMIENILKEI----------PNL-SKKMPLR 958
              E  T     ++ILKEI          PN+ ++K P+R
Sbjct: 870 ---EIDTNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVR 906

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  416 bits (1070), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 295/910 (32%), Positives = 483/910 (53%), Gaps = 50/910 (5%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPD-ITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NITVAVRCR   + E    S  ++++ D   G+    I     TG       K YT+D V
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTIISIGDNEDGTSNEVIVLDESTG-----RKKIYTLDAV 63

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----EKLYNGELS 150
           +G    Q  +FDE   P ++ F  GYN +++ YG   +GK YT+ G+    +   N E S
Sbjct: 64  YGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNANNAE-S 122

Query: 151 DAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEEXXX---XXXXXXXXXXXXXXXXQ 207
           +  G++PRVL +LF  LE   ND+++KCSF+E+YN+E                       
Sbjct: 123 ENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLLIDTGNNANGNNSNGATGS 182

Query: 208 FMKKLRIFDXXXXXXXXXXXXXXXXXXXXXXXXXXLNDLTPKAALLRKRLRTKSLP--NT 265
             KKLRI D                           N      A++RKR+  +SLP  N+
Sbjct: 183 TGKKLRIVDSASNGLRSAGSSNSSTRDNSPLT----NSKKIPTAMMRKRMGKRSLPPNNS 238

Query: 266 IKQQYQQQQAVXXXXXXXXXXXXXXXXXXXXXXXXXGQRSSMAPNDQTNGIYIQNLQEFH 325
           I         +                            S  + +++ N IYIQNLQE  
Sbjct: 239 ISNNTANNNRLSLSRTNSF-----------------SDYSLQSSHERLNSIYIQNLQEIT 281

Query: 326 ITNAMEGLNLLQKGLKHRQVASTKM----NDFSSRSHTIFTITLYKKHQ-DELFRISKMN 380
           IT   EG+ +++KGLK+R++AST      N+FS RSH+IF ITLYK+ + +E+FR+SK++
Sbjct: 282 ITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEEVNEVFRMSKLS 341

Query: 381 LVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQD 440
            V+ AGSE  + + + N      G+ N +L +  ++IN +V+ S +  F +SKLT+LLQ+
Sbjct: 342 FVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASFLDSKLTQLLQN 395

Query: 441 SLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMEL 500
           +  G T+T  IA I+P K   + TCS L  A+K K IKN+P+ GS I K+ L+K ++ EL
Sbjct: 396 NFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITKESLIKILSNEL 455

Query: 501 AKIKSDLLSTKSKE-GIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKL 559
            K KSDLLS KS + GIYM + HY  L   LESYK ++Q  K  I  LT K   +  +K 
Sbjct: 456 VKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELTKKGNEIRIEKR 515

Query: 560 KSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDYKK 619
             +E  + Q  ++++L+ TI +L   L+KQ K E E+ +   KL  +   MQ ++  Y  
Sbjct: 516 TFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILGNMQKSVEKYSD 575

Query: 620 RELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTM 679
           +E+ L  K ++   KE+ KLK++L      ++        N+  N+D IK E+L +    
Sbjct: 576 KEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNIKAEILKIANQS 635

Query: 680 QEKAELMYKDCVKKILNESPKFFNVVIEKIDIIRVDFQKFYKNIAENLSDISEENNNMKQ 739
           Q K + +  +   ++L+ SPK+F  +   +  +    +  +   +E LSDISEE NN+  
Sbjct: 636 QSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLSDISEEFNNLNN 695

Query: 740 YLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDHLDENKKLIMQNLTTAT 799
           Y+ ++F K++H+EL++ +++ TY  ++  + EF ENFKK+L+ ++++N K + +++T+ T
Sbjct: 696 YINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNTKSLSKSITSLT 755

Query: 800 SAVIDQEMDLFEPKRVKWE-NSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNE 858
           S +++ E+  F P++ KWE  S ++I + +    +  N  +  L+++ S   ++S     
Sbjct: 756 SEIVENELTQFNPEKKKWELASNEIIENFNESITKNKNKNSEILAKLLSESTSTSELFIN 815

Query: 859 SISVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDI 918
           ++S +K  VE  E    +  +N     +F ++INK+  LKD I ++  S+ + I + D++
Sbjct: 816 NMSSIKKNVEIVEEFSEIFNSNDLIKSEFLEIINKNKKLKDLITDNFNSSENSIDSFDNL 875

Query: 919 YNTIENIMKN 928
              ++N+ KN
Sbjct: 876 KEAMQNVFKN 885

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  256 bits (655), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+  + I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 370 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 421
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 422 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTP 414

Query: 482 QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 521
           Q+   + KD  +K+   E+ K+K+DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQD 454

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/161 (44%), Positives = 94/161 (58%), Gaps = 16/161 (9%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD          +KL 
Sbjct: 109 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDKLL 168

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
            GE    AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGE---HAGIIPRVLVDLFKELSTLNREYSVKISFLELYNE 206

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  256 bits (654), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+  + I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 294

Query: 370 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 421
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 422 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 414

Query: 482 QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  129 bits (323), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 93/158 (58%), Gaps = 10/158 (6%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 52  NIHVYVRCRSRNKREIEEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 108

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 109 GAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 168

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
           L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 169 LGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNE 206

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  256 bits (653), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+  + I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 234 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVE 293

Query: 370 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 421
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 294 QDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 353

Query: 422 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481
           D S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN P
Sbjct: 354 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEYATRAKSIKNTP 413

Query: 482 QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 414 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 453

 Score =  127 bits (318), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 69/158 (43%), Positives = 93/158 (58%), Gaps = 10/158 (6%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KEI ++       ++  + K Y  D+VF
Sbjct: 51  NIHVYVRCRSRNKREIDEKSSVVISTLGPQG-KEIILSNGSHQSYSS--SKKTYQFDQVF 107

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-------EKLYNGE 148
           G  + Q+ +F+  A    ++ + GYNCT+  YG T TGKTYTM+GD       +   N  
Sbjct: 108 GAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINILGDVQSTDNLL 167

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
           L + AGIIPRVL+ LF  L     +Y VK +F+ELYNE
Sbjct: 168 LGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNE 205

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  256 bits (653), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/220 (58%), Positives = 168/220 (76%), Gaps = 8/220 (3%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+  + I ++ +QE  I +A EGLNLL +G   R+VA+TK ND SSRSHT+FTIT     
Sbjct: 235 NNNNSSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIE 294

Query: 370 QDE--------LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV 421
           QD           +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALV
Sbjct: 295 QDSKEHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALV 354

Query: 422 DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481
           D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN P
Sbjct: 355 DHSNHIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSP 414

Query: 482 QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQD 521
           Q+   + KD  +K+   E+ K+++DL ++++K+GI+++QD
Sbjct: 415 QVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQD 454

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 97/177 (54%), Gaps = 19/177 (10%)

Query: 26  GCHTVP---------NEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTG 76
           G H VP           E NI V VRCR RN REI  KSSVV++     G KEI ++   
Sbjct: 33  GKHPVPPPICNNSNATSESNIHVYVRCRSRNRREIDEKSSVVISTLGPQG-KEIILSNGS 91

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
               ++  + K Y  D+VFG  + Q+++F   A    ++ + GYNCT+  YG T TGKTY
Sbjct: 92  HQSYSS--SKKTYQFDQVFGAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTY 149

Query: 137 TMTGDEKLY-------NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
           TM+GD  +        N  L + AGIIPRVL+ LF  L     +Y VK SF+ELYNE
Sbjct: 150 TMSGDINILGDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNE 206

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  254 bits (649), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 182/499 (36%), Positives = 283/499 (56%), Gaps = 54/499 (10%)

Query: 308 APNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT--- 364
           +PN  +  I+++ ++E +I +A EGL LL  G   R+VA+TK ND SSRSHTIFTIT   
Sbjct: 245 SPNGYS--IFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCNDLSSRSHTIFTITTNV 302

Query: 365 --LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 422
             ++    ++  ++ K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD
Sbjct: 303 TKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVD 362

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQ 482
            S HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA++AK+IKN PQ
Sbjct: 363 HSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYATRAKSIKNTPQ 422

Query: 483 LGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKR 542
           +   + K+  +     E+ +++ +L ++ SKEGIY++Q+ ++      ES    V+E + 
Sbjct: 423 VNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFET----YESNSILVEEQQA 478

Query: 543 EIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTT--------------IDHLRAQLDK 588
           +I++L  +   L +  L+  + I+ ++ QI+ L                 I+ + ++L+ 
Sbjct: 479 KIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTIYINGIHSKLED 538

Query: 589 QHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLN 648
              T I I + N KL +     +  +H+    ++D  +   + I++EI  L S      N
Sbjct: 539 YEHTMIGIHNNNMKLLEDINDNRGNIHEDLLAKVDHIETCNLIISREITSLISI----RN 594

Query: 649 TMQQESILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEK 708
            +Q  S           D  K  +  +   +QEK   + +   +  L+    F +   E+
Sbjct: 595 VLQAYS-----------DRFKTVLGGVFEELQEKLTQVGRTTEESQLDVDLSFVDEKFEE 643

Query: 709 I-DIIRVDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEK 767
           + DII+   +   + + E++S       NMK  L+     ++   LL +   + +  ++K
Sbjct: 644 VTDIIKATCENLVRTMDEHVS-------NMK--LETTDLTSSCASLLEKECQALHGKLQK 694

Query: 768 RTNEFVENFKKVLNDHLDE 786
               +VE+ K+ LN  L E
Sbjct: 695 ----YVESMKQELNSTLQE 709

 Score =  139 bits (351), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 98/161 (60%), Gaps = 15/161 (9%)

Query: 34  ELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDK 93
           E NI V VRCR RNEREI  KSSVV++     G +E+ +   G TG     + K YT D+
Sbjct: 52  EYNIKVYVRCRSRNEREIREKSSVVISTLGNNG-REVILTNPG-TG-----SNKTYTFDR 104

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE----- 148
           VFG  + Q+ +F++VA     + I+GYNCTV  YG T TGKTYTM+GD  +         
Sbjct: 105 VFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGSSEDDPN 164

Query: 149 ---LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
              LS+ AGIIPRVL++LF  L     DY VK SF+ELYNE
Sbjct: 165 FVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNE 205

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  253 bits (646), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/225 (57%), Positives = 166/225 (73%), Gaps = 8/225 (3%)

Query: 307 MAPNDQTNG---IYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTI 363
           + P   T G   I ++ ++E +I +A EGL LL +G   RQVASTK ND SSRSHT+FTI
Sbjct: 240 IKPEKNTQGSHSIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVASTKCNDLSSRSHTVFTI 299

Query: 364 TLYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418
           T      D     E  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVIN
Sbjct: 300 TTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVIN 359

Query: 419 ALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
           ALVD S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IK
Sbjct: 360 ALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETVSTLEYATRAKSIK 419

Query: 479 NKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 523
           N PQ+   + KD  +     E+ +++ +L +T++K+GIY++Q+ Y
Sbjct: 420 NTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQEKY 464

 Score =  137 bits (344), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 99/162 (61%), Gaps = 12/162 (7%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR-YTVDKV 94
           NI V VRCR RN+REI  KSSVV++     G +++ ++    +   +  N K+ YT D+V
Sbjct: 54  NIKVYVRCRSRNKREIGEKSSVVISTMGAQG-RDVILSNPSSSSSGSLTNVKKTYTFDRV 112

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------ 148
           FG  + Q+++F+ VA     + ++GYNCTV  YG T TGKTYTM+GD  +          
Sbjct: 113 FGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDINILGSTTHNHDQ 172

Query: 149 ----LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
               LS+ AGIIPRVL+ LF  L+ +  DY VK SF+ELYNE
Sbjct: 173 SSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNE 214

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  249 bits (636), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 205/306 (66%), Gaps = 18/306 (5%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT----- 364
           N   + I ++ ++E +I +A EGL LL +G   R+VA+T+ ND SSRSHTIFTIT     
Sbjct: 249 NSSGHSIMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATRCNDLSSRSHTIFTITTNVTK 308

Query: 365 LYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
           ++    ++  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 309 IHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 368

Query: 425 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 484
            HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET STLEYA++AK+IKN PQ+ 
Sbjct: 369 QHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEETASTLEYATRAKSIKNTPQIN 428

Query: 485 SFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESYKNEVQECK 541
             + K+  +     E+ K++ +L +  +KEGIY++++ Y+   S+   +E  + ++   +
Sbjct: 429 QLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYETYESNCILVEEQQAKIDNLQ 488

Query: 542 REIESLTSK---NALLVKDKLKSKETIQSQNCQI----ESLKTTIDHLRAQLDKQHKTEI 594
            +I+    K      LVK+K    + I+S N +I    + L   +D LR +++     EI
Sbjct: 489 EQIKRFKEKYLEQTKLVKEKDTQVKMIKSINERITMYNKKLTDYLDKLRFRVEDY---EI 545

Query: 595 EISDFN 600
           +++D +
Sbjct: 546 KVNDIH 551

 Score =  141 bits (355), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 96/159 (60%), Gaps = 15/159 (9%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN REI  KSSVVV+     G + I  N +  TG     N K YT D+VF
Sbjct: 56  NIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQS--TG-----NNKTYTFDQVF 108

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA--- 152
           G  + Q+ +FD+VA     + ++GYNCTV  YG T TGKTYTM+GD  +    L D    
Sbjct: 109 GVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLEDPNYV 168

Query: 153 -----AGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
                AGIIPRVL++LF  L+ +  DY VK SF+ELYNE
Sbjct: 169 LLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNE 207

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  248 bits (633), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/223 (56%), Positives = 165/223 (73%), Gaps = 11/223 (4%)

Query: 308 APNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTI---- 363
           A N   + I ++ ++E +I +A EGL LL +G   R+VASTK+ND SSRSHTIFTI    
Sbjct: 332 ASNCNGSSITVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKLNDLSSRSHTIFTIITNV 391

Query: 364 ----TLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 419
                +  KH     +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINA
Sbjct: 392 TKVDPVTGKH---FVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINA 448

Query: 420 LVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
           LVD+S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+IKN
Sbjct: 449 LVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISLEETVSTLEYATRAKSIKN 508

Query: 480 KPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 522
            PQ+   + KD  +     E+ +++++L   ++KEGIY++QD 
Sbjct: 509 TPQINQSLSKDTFIHEYINEIDRLRNELKLARTKEGIYITQDQ 551

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 108/241 (44%), Gaps = 72/241 (29%)

Query: 13  SSNSISKNGNSQVGCHTVPNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEI-- 70
           S   +  N +S+   HT   ++ NI V VRCR R +REI  KSSVV++     G+K I  
Sbjct: 31  SDGGVYVNDSSKSLSHT---KDDNIKVYVRCRSRTQREIDEKSSVVISTLGANGNKVILS 87

Query: 71  --------SINTTGDTGITAQ-----------------MNAKRYTVDKVFGPGASQDLIF 105
                   + N  G T                       N + YT DKVFG  + Q+ +F
Sbjct: 88  PNQSRKLYNTNANGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLF 147

Query: 106 DEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLYNGELSDAAGI 155
           + VA     + ++GYNCTV  YG T TGKTYTM+GD          +K+  GE    AGI
Sbjct: 148 ESVAKNYIYEMLQGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGE---HAGI 204

Query: 156 IPRVLLKLFDTLE-----------------------------LQQNDYVVKCSFIELYNE 186
           IPRVL+ LF  L                              L+  +Y VK SF+ELYNE
Sbjct: 205 IPRVLVYLFKELSKNDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNE 264

Query: 187 E 187
           +
Sbjct: 265 K 265

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  246 bits (628), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 122/214 (57%), Positives = 163/214 (76%), Gaps = 5/214 (2%)

Query: 316 IYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 371
           I ++ ++EF+I +A EGL LL  G   R+VA+TK ND SSRSHT+FTIT      D    
Sbjct: 248 IMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTVFTITTNVARTDPVSN 307

Query: 372 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430
            +  +I K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S HIP+R
Sbjct: 308 EQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDNSQHIPYR 367

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490
           ESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   + K+
Sbjct: 368 ESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAKSIKNTPQVNQSMSKN 427

Query: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYK 524
             +     E+ +++ +L +++ KEG+Y+++D ++
Sbjct: 428 SCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

 Score =  140 bits (352), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 97/161 (60%), Gaps = 17/161 (10%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           N+ V VRCR RNE+EI  KSSVV++     G + I  N  G    +   + + YT D+VF
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGREVILSNGAG----SLSHSKRTYTFDQVF 96

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+ +FDEVA     + ++GYNCTV  YG T TGKTYTM+GD          +K+ 
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISILGDLDSQDKIL 156

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
            GE S   GIIPRVL+ LF  L  + N+Y VK SF+ELYNE
Sbjct: 157 LGEHS---GIIPRVLVDLFKQLSQETNEYTVKVSFLELYNE 194

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  243 bits (619), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/213 (56%), Positives = 160/213 (75%), Gaps = 5/213 (2%)

Query: 316 IYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 371
           I ++ ++E +I +A EGL LL KG   R+VA+TK ND SSRSHTIFTI  +    D    
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 372 -ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFR 430
            +  +I K+NLVDLAGSENINRSGA N RA+EAG IN+SLLTLGRVINALV+ S HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKD 490
            SKLTRLLQDSLGG TKT +IATISPA+++ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 491 ILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 523
             +     E+ +++ +L +++ +EG+Y++Q+ Y
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY 480

 Score =  134 bits (337), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 74/159 (46%), Positives = 93/159 (58%), Gaps = 13/159 (8%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVVV+     G   I  N +           K Y  D+VF
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSS----PLSHPKKTYMFDEVF 99

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+ IF EVA    Q+ ++GYNCTV  YG T TGKTYTM+GD  ++ G+       
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGDMSIW-GDLDSQDKI 158

Query: 149 -LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
            L + AGIIPRVL+ LF  L  +  ++ VK SF+ELYNE
Sbjct: 159 LLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNE 197

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  241 bits (614), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 123/218 (56%), Positives = 160/218 (73%), Gaps = 5/218 (2%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N+ ++ I ++ ++E +I +A EGL LL  G   R+VASTK ND SSRSHT+FTI      
Sbjct: 283 NNASSSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLSSRSHTVFTIATNITK 342

Query: 370 QDEL-----FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
            D +      +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD S
Sbjct: 343 IDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHS 402

Query: 425 GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLG 484
            HIP+RESKLTRLLQDSLGG TKT +IATISPAK++ EET STLEYA +AK+IKN PQ+ 
Sbjct: 403 QHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLEYAIRAKSIKNTPQIN 462

Query: 485 SFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDH 522
             + KD  +     E+ +++ +L +++ K+GI ++QD 
Sbjct: 463 QSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQ 500

 Score =  135 bits (341), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 95/158 (60%), Gaps = 12/158 (7%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR R+EREI  KSSVV++     G++ I  N +           K Y+ D+VF
Sbjct: 108 NIKVYVRCRSRSEREIKEKSSVVISTLGPQGNQVILSNPSSPLSYPK----KSYSFDRVF 163

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGE------ 148
           G  + Q+ +F++ A     + + GYNCTV  YG T TGKTYTM+GD   L N E      
Sbjct: 164 GAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILGNLESKDMIL 223

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
           L + AGIIPRVL+ LF  L L +NDY VK SF+ELYNE
Sbjct: 224 LGEHAGIIPRVLVNLFKMLAL-ENDYSVKISFLELYNE 260

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  239 bits (611), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 124/246 (50%), Positives = 175/246 (71%), Gaps = 8/246 (3%)

Query: 313 TNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT-----LYK 367
           ++ I ++ ++E +I +A +GL LL  G   R+VA+TK ND SSRSHT+FTIT     L  
Sbjct: 239 SSSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTITTNITKLDP 298

Query: 368 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 427
              ++  +  K+NLVDLAGSENINRSGA N+RA+EAG IN+SLLTLGRVINALVD + HI
Sbjct: 299 VSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHTQHI 358

Query: 428 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFI 487
           P+RESKLTRLLQDSLGG TKT +IATISPAK++ +ET STLEYA++AK+IKN PQ+   +
Sbjct: 359 PYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIKNTPQVNQSM 418

Query: 488 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSD---LESYKNEVQECKREI 544
            KD  +     E+ +++ +L +++ K+GI ++QD +    S+   ++  K ++Q  + +I
Sbjct: 419 SKDSCINEYVHEIERLRQELKTSRQKDGISITQDQFDLYESNGILVDEQKTKIQNMEEQI 478

Query: 545 ESLTSK 550
           +    K
Sbjct: 479 QRFKDK 484

 Score =  130 bits (327), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 95/159 (59%), Gaps = 14/159 (8%)

Query: 37  ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR-YTVDKVF 95
           I V VRCR RNEREI  KSSVV++     G+ + S        +     AKR YT D+VF
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVIST---LGAPQ-STQLLLSNPLLPLAYAKRTYTFDRVF 116

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE------- 148
           G  + Q+ +F++ A     + ++GYNCTV  YG T TGKTYTM+GD  +  G+       
Sbjct: 117 GAESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMV 176

Query: 149 -LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
            L + AGIIPRVL++LF  L+  +  Y VK SF+ELYNE
Sbjct: 177 LLGEHAGIIPRVLVELFRWLDGNEG-YSVKVSFLELYNE 214

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  237 bits (604), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 126/226 (55%), Positives = 169/226 (74%), Gaps = 7/226 (3%)

Query: 303 QRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFT 362
           Q+SS   N+  + I ++ ++E +I +A EGL LL +G   R+VASTK ND SSRSHTIFT
Sbjct: 243 QKSSR--NNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVASTKCNDLSSRSHTIFT 300

Query: 363 ITLYKKHQD-----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 417
           IT      D     +  +I K+NLVDLAGSENI+RSGA N RA+EAG IN+SLLTLGRVI
Sbjct: 301 ITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQEAGLINKSLLTLGRVI 360

Query: 418 NALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 477
           NALVD S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK++ EET STLEYA++AK+I
Sbjct: 361 NALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISMEETISTLEYATRAKSI 420

Query: 478 KNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHY 523
           KN PQ+   + KD+ +     E+ +++ +L +++ K+G+Y++Q+ +
Sbjct: 421 KNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQEQF 466

 Score =  132 bits (331), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 94/161 (58%), Gaps = 17/161 (10%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN+REI  KSSVV++     G KE+ ++   D         K Y  D+VF
Sbjct: 59  NIQVYVRCRSRNQREIEEKSSVVISTMGAQG-KEVVLS---DPSSVLSHTKKTYIFDQVF 114

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD----------EKLY 145
           G  + Q+++F+  A     + ++GYNCT+  YG T TGKTYTM+GD          +K+ 
Sbjct: 115 GVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINILGDLESQDKIL 174

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
            GE    AGIIPRVL+ LF  L  +  +Y VK SF+ELYNE
Sbjct: 175 LGE---HAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNE 212

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  184 bits (466), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 132/199 (66%), Gaps = 31/199 (15%)

Query: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 371
            I ++ +QE  I NAMEGLNLL KG   R+V STK+ND SSRSHTIFTIT      D   
Sbjct: 207 SIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKSTKLNDLSSRSHTIFTITTNIIKLDNQT 266

Query: 372 --ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--- 426
             E  +I K+NLVDLAGSENI +SG   +R++E G IN+SLLTLGRVINAL DK+ +   
Sbjct: 267 NKEYIKIGKLNLVDLAGSENITKSGL--KRSQETGLINKSLLTLGRVINALSDKTNNTHG 324

Query: 427 ---------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 465
                                IP+RESKLTRLLQDSLGG TKT +IATISPAK   +ET 
Sbjct: 325 SNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKTCLDETI 384

Query: 466 STLEYASKAKNIKNKPQLG 484
           STLEYA++A +IKN P++ 
Sbjct: 385 STLEYATRAMSIKNNPKIN 403

 Score =  131 bits (330), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 97/166 (58%), Gaps = 24/166 (14%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI V VRCR RN++EI  KSSVVV+     G++ I  N+T         N  +Y  D VF
Sbjct: 9   NIKVYVRCRSRNQKEIDEKSSVVVSTLGQNGNQIIISNST---------NKNKYIFDNVF 59

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY-------NGE 148
           G  + Q+ IF+ VA    Q+ I GYNCT+  YG T TGKTYTM+GD  +        N  
Sbjct: 60  GVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNIIGDLNSTKNIL 119

Query: 149 LSDAAGIIPRVLLKLFDTLEL----QQN----DYVVKCSFIELYNE 186
           L + AGIIPRVL++LF +LE     Q+N     Y VK SF+ELYNE
Sbjct: 120 LGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNE 165

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  142 bits (358), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 8/173 (4%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF-- 374
           +++ LQEF + +  E L+ L++G + + V +T +N+ SSRSHTIFTI + +K    L   
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 375 --RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 430
             R S + L+DLAGSE  N SGA  +R KE  +IN+SL TLGRVI  L  K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 483
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 52/93 (55%), Gaps = 15/93 (16%)

Query: 101 QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVL 160
           Q  +++++A       + GYN  +  YG T +GK++TMTG  +L         GI+PR+ 
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL--------PGIVPRMC 114

Query: 161 LKLFDTLELQQND-------YVVKCSFIELYNE 186
            +LF+  E+ ++        + ++CS++E+YNE
Sbjct: 115 QELFEVREMYESSDDQASTQFKIRCSYLEIYNE 147

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 188/350 (53%), Gaps = 39/350 (11%)

Query: 303 QRSSMAPND-QTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIF 361
           +R S++ +D + +GIY++ L   ++T+  E L+ +++G   R V+ST MN  SSRSH+I 
Sbjct: 183 KRISLSLHDTKDSGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIV 242

Query: 362 TITLYKKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420
            I L K++  +E  + S + LVDLAGSE + ++ A     +EA  IN SL  LG VINAL
Sbjct: 243 RINLEKRNALEENIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINAL 302

Query: 421 VD-------KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 473
                     S HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+
Sbjct: 303 TQVESKSKRTSAHIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSR 362

Query: 474 AKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESY 533
           AK IKN      F    IL KN       ++  L   KS+E  Y+ +         + + 
Sbjct: 363 AKKIKN------FA---ILNKNNLSSRNLLEQQLEELKSRETGYLLR---------ISTL 404

Query: 534 KNEVQECKRE--IESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLR--AQLDKQ 589
           + E+ E K +  IE  + K      D L+  + ++S   Q+ESL   I H    A  D  
Sbjct: 405 EKELLESKAQNDIEDPSQKPLPPTPDLLEENKKLKS---QVESLAGLISHSNSGATDDPS 461

Query: 590 HKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKL 639
              +  I +  N+ + + E+ Q +L +    +++LN+KF+  +    +++
Sbjct: 462 ISYDDLIQNLMNRCENVVEI-QASLDE----QVELNKKFQQSLASTTERM 506

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 64/109 (58%), Gaps = 11/109 (10%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           + Q N + +T D+VF  G++Q+ +++ VAG + + F +GYN T+L YG T +GK++TM G
Sbjct: 67  STQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTGSGKSHTMFG 126

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNE 186
            +        +  G+IPR+   +F  +E    +   + V  SF+E+Y E
Sbjct: 127 PK--------ENRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLE 167

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  137 bits (345), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 74/173 (42%), Positives = 114/173 (65%), Gaps = 8/173 (4%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 376
           +++ L+EF +++  + LN +++G + R + ST +N++SSRSHTIFTI++ +K +  L  +
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 377 ----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 430
               S + L+DLAGSE    +     R KE  +IN+SL TLGRVI+ L  +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 483
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQL 339

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 84/192 (43%), Gaps = 29/192 (15%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R   ERE+    S++  V D    +    N   +T        + +  D+ F
Sbjct: 4   NIKVAVRLRRPLEREVD--ESIIARVEDGNVIQVKDRNQKNET--------RSFHFDQCF 53

Query: 96  GPG----ASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
                  A Q  ++++++       + GY+  V  YG T +GK++TMTG          +
Sbjct: 54  AYSENIEADQLELYEQLSREYLLHALDGYHTCVFAYGQTGSGKSHTMTGS--------PE 105

Query: 152 AAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEEXXXXXXXXXXXXXXXXX 204
           + GI+ R+  +LF+  E+ ++        + ++CS++E+YNE                  
Sbjct: 106 SPGIVSRMCQELFEVREIYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGRCRIRERAD 165

Query: 205 XXQFMKKLRIFD 216
              F++ LR FD
Sbjct: 166 KTTFVEGLREFD 177

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 111/175 (63%), Gaps = 8/175 (4%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ----DE 372
           +++ L EF +    E L  +++G + R V  T MN+ SSRSH IFTI++ +       D 
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 373 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGH--IPFR 430
             R S + LVDLAGSE ++ +GA   R KE  +IN+SL TLGRV++ L  K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 431 ESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGS 485
           +S LT +L+++LGGN+KT +IA +SP     EET STL YA+ AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARVNS 370

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 22/173 (12%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VAVR R    RE        V  P  +   +  I+T+           K +T D  F
Sbjct: 4   NIKVAVRLRSPLPREHGQPIITQVTSP-TSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 96  ----GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE---KLYNGE 148
                    Q++I+D +        + GYN  +L YG T +GK++TM G E     +N +
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGPEVSKHFHNNQ 122

Query: 149 LS-------DAAGIIPRVLLKLFDTLELQQND-------YVVKCSFIELYNEE 187
            +        A GIIPRV   LFD   +  ++       + + CS++E+YNE+
Sbjct: 123 TALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQ 175

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  134 bits (338), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 5/174 (2%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI 376
           ++Q++  F +    E L  L  G   R VAST+MN  SSRSH IFT+++ ++  D   R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 377 SKMNLVDLAGSENINRSGALN--QRAKEAGSINQSLLTLGRVINALVDKSGH-IPFRESK 433
           S + LVDLAGSE  N +  ++  +R KE  +IN+SL TLGR I+ L   S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 434 LTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFI 487
           LT +L+++LGGN+KT +IA ISP  +  EE+ STL YA+ AK IK +  +   +
Sbjct: 269 LTWVLKENLGGNSKTCMIACISPIDL--EESLSTLRYATTAKEIKLRATMNEIV 320

 Score = 62.4 bits (150), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T +   + +  D +F   +SQ  I  E+        ++GYN  +  YG T +GKTYTM G
Sbjct: 29  TVEPPLRSFNFDHIFDTSSSQTDIPGELCSKYVLHALEGYNACIFAYGQTGSGKTYTMRG 88

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQNDY-VVKCSFIELYNEE 187
                    +   GIIP +   LFD LEL +     V  ++ E+YNE+
Sbjct: 89  T--------NSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEK 128

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  129 bits (323), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 80/182 (43%), Positives = 112/182 (61%), Gaps = 4/182 (2%)

Query: 303 QRSSMAPNDQ-TNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIF 361
           +R+S+  ++  T G+Y++      +++  E LN +  G   R   ST MN  SSRSH I 
Sbjct: 175 KRASLTVHESNTFGVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIV 234

Query: 362 TITLYKKHQDEL-FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL 420
            I L K+   E   + S + LVDLAGSE + ++ A+    +EA  IN SL +LG VINAL
Sbjct: 235 KINLLKRDNLEGNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINAL 294

Query: 421 V--DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
              +K  HIP+R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IK
Sbjct: 295 TQKEKRTHIPYRDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIK 354

Query: 479 NK 480
           NK
Sbjct: 355 NK 356

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 12/105 (11%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A+ +  D VFG  A Q+ +FD VA  +   F  GYN T+L YG T +GK+YTM G     
Sbjct: 57  ARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP---- 112

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNE 186
                   G+IPR+  ++F+ + L +N    +YVV  SF+E+Y E
Sbjct: 113 ----PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLE 153

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  126 bits (317), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 77/172 (44%), Positives = 106/172 (61%), Gaps = 4/172 (2%)

Query: 313 TNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDE 372
           T G+Y+Q+     +++  E L+ +  G   R  +ST MN  SSRSH I  I L K+   E
Sbjct: 213 TFGVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKRDNLE 272

Query: 373 -LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---GHIP 428
              + S + LVDLAGSE ++++ A+    +EA  IN SL +LG VINAL  K     HIP
Sbjct: 273 GSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIP 332

Query: 429 FRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           +R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+NK
Sbjct: 333 YRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENK 384

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 64/112 (57%), Gaps = 12/112 (10%)

Query: 79  GITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM 138
           G+  +  ++ +  D VFG  ++QD ++D VA  +   F  GYN T+L YG T +GK+YTM
Sbjct: 77  GVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQTGSGKSYTM 136

Query: 139 TGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCSFIELYNE 186
            G          D  G+IPR+  ++F+ + L ++    +YVV  SF+E+Y E
Sbjct: 137 FGP--------IDNRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYLE 180

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  121 bits (304), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/172 (41%), Positives = 106/172 (61%), Gaps = 7/172 (4%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK----KHQDE 372
           YI+ L +  + +  E L  +++G   R VA T +N+ SSRSH I TI + +       D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 373 LFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-DKSGHIPFRE 431
           + R+S + LVDLAGSE    S   ++R KE  +IN+SL+TL RV+  L  +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 432 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQL 483
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHL 342

 Score = 67.4 bits (163), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 76/161 (47%), Gaps = 23/161 (14%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVF 95
           NI VA+R R +  RE S  S +         S EI++       +   +    Y  D+VF
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKT-----SNEITLQKDNTANVITTVEHTFY-FDQVF 57

Query: 96  GPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGI 155
              ++Q  I+ E+A       ++GY+  V+ YG T  GKTYTM G E+          GI
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTMMGTEQ--------EPGI 109

Query: 156 IPRVLLKLFDTLELQQND---------YVVKCSFIELYNEE 187
           IP V  +LF  +++ Q++         + V  S+ ++YNE+
Sbjct: 110 IPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQ 150

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  122 bits (307), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D   GI + NL         + ++L+ +G  +R  + T  N+ SSRSH +  I + +K++
Sbjct: 247 DSIKGISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNR 306

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 422
                E    + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL      
Sbjct: 307 TAELSEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRR 366

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
            + H+P+R+SKLTRLL+ SLGGN KT +I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 367 STCHVPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (52%), Gaps = 10/102 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +++    PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 134 QKFVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISG------ 187

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNE 186
               +  G+I   + +LF  +E  ++   + +  S++E+YNE
Sbjct: 188 --TPEQPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNE 227

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL   H T   + +NL+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 422
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 61/123 (49%), Gaps = 16/123 (13%)

Query: 71  SINTTGDTGITAQMNAK----RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 126
           SIN+ G     +Q        ++  DK+F   +SQ  ++ E   PL    + GYN TV  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 127 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIEL 183
           YG T  GKTYT++G             G+I   + +LF   D L+ ++N + +  S++E+
Sbjct: 191 YGATGCGKTYTVSGT--------PSQPGVIFLAMEELFNKIDDLKDEKN-FEISLSYLEI 241

Query: 184 YNE 186
           YNE
Sbjct: 242 YNE 244

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 110/178 (61%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK--K 368
           DQ + I + NL      N  + ++L+ +G  +R  + T+ N+ SSRSH++  I + +  K
Sbjct: 206 DQNSKISVTNLSYHRPENVQDVIDLVIRGNLNRSSSPTEANEVSSRSHSVLQIHVKQVLK 265

Query: 369 HQDELFRI----SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--D 422
           + D++       S ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 266 NFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIRLYEGANINKSLLALGNCINALCINK 325

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           KS HIP+R+SKLTRLL+ SLGGN KT +I  +SP+ +  +ET +TL+YA++AK IK K
Sbjct: 326 KSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSLHYDETLNTLKYANRAKEIKTK 383

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 13/104 (12%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ++Q+ IF++   PL    + G+N TV  YG T  GKTYT+ G       
Sbjct: 91  KFIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTING------- 143

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND-----YVVKCSFIELYNE 186
             S+  GII R + +LF  +E+   D       +  S++E+YNE
Sbjct: 144 -TSEDPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNE 186

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 104/180 (57%), Gaps = 10/180 (5%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL +   T   E ++L+ +G  +R  + T+ N+ SSRSH +  I + +K++
Sbjct: 267 DTDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNR 326

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----- 421
                E      ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 327 TPDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGND 386

Query: 422 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
                H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 ERPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 52/101 (51%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 155 KFVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSG------- 207

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
              +  GI+ + + +LF  +E  ++   + +  SF+E+YNE
Sbjct: 208 -TPENPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNE 247

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 106/180 (58%), Gaps = 10/180 (5%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL   +     E ++L+ KG  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 262 DGANKISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNR 321

Query: 371 DELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----- 421
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL      
Sbjct: 322 TADLTSEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGG 381

Query: 422 -DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
            ++S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 382 TNRSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 55/101 (54%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   ASQ+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 150 KFVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGT------ 203

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNE 186
              +  GII RV+ +LF+ +E  ++   + +  S++E+YNE
Sbjct: 204 --PEQPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNE 242

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 107/178 (60%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH++  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNK 323

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 422
                     + ++++DLAGSE  + +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           ++ HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RTCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNE 186
                 GII   + +LF+ + +L+ + ++ +  S++E+YNE
Sbjct: 206 --PSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNE 244

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 105/181 (58%), Gaps = 13/181 (7%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL         + ++L+  G  +R  ++T  N+ SSRSH +  I + +  +
Sbjct: 240 DSENRISVANLSHHRPKTVEDVMDLVVLGNTNRTTSATDANETSSRSHAVLQINIVQSSR 299

Query: 371 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
                 D  F  +K++++DLAGSE    +    +R +E  +IN+SLL LG  INAL    
Sbjct: 300 TAEITSDHTF--AKLSIIDLAGSERAASTKNRGERLQEGANINRSLLALGNCINALCISD 357

Query: 425 G-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
           G     H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 358 GTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 417

Query: 480 K 480
           K
Sbjct: 418 K 418

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q+ ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 128 KFVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGT------ 181

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNE 186
              +  G+I   + +LF  +E  ++   + +  S++E+YNE
Sbjct: 182 --PERPGVIFLAMQELFARMEELEDTRKFEISVSYLEIYNE 220

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  121 bits (303), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 109/179 (60%), Gaps = 9/179 (5%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D    I + NL    ++   + ++L+ KG  +R  ++T  N+ SSRSH +  + + ++++
Sbjct: 236 DSHRHITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNR 295

Query: 371 D----ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV---DK 423
                E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL     K
Sbjct: 296 TAELTEDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRK 355

Query: 424 SG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
            G  H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 356 RGGYHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 61.6 bits (148), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (52%), Gaps = 10/102 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D+VF   +SQ  +++    PL    + G+N TV  YG T  GKTYT++G      
Sbjct: 123 QKFVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSG------ 176

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNE 186
               +  GII   + +LF  +E  Q+   + +  S++E+YNE
Sbjct: 177 --TPENPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNE 216

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 103/182 (56%), Gaps = 13/182 (7%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-K 368
           +DQ+   Y+ N++ F I N  + + L+ K    R  +ST +N  SSRSH IF I L    
Sbjct: 556 DDQSKITYVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYN 615

Query: 369 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 420
           H+     ISK+NLVDLAGSE IN S     R KE  SIN+SL  LG VI+AL        
Sbjct: 616 HKTNEKCISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHL 675

Query: 421 ----VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 476
               + K+ HIPFR SKLT LL+ SL G++KT +   +S  +    ET ++L +A+K  N
Sbjct: 676 NSNDLQKTRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNN 735

Query: 477 IK 478
            K
Sbjct: 736 TK 737

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF        +F+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 444 FEFDHVFKQDEGNSEVFNEIEQ-LIQSALDGYNVCIFAYGQTGSGKTYTM---------- 492

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNE 186
           L+   G+IP  +  +F++++ L++N  +Y V C FIELYNE
Sbjct: 493 LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNE 533

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 107/182 (58%), Gaps = 14/182 (7%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 369
           D  N  ++ NL +    N  E ++L+ KG  +R  + T  N+ SSRSH +  I + + + 
Sbjct: 235 DSYNRTFVSNLSKHSPENVEEVMDLVIKGNMNRTTSPTDANETSSRSHAVLQIHVAQMNR 294

Query: 370 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
                QD+ F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   S
Sbjct: 295 TADIKQDQTF--ATLSIIDLAGSERAAVTKNRGERLLEGANINRSLLALGNCINALCVSS 352

Query: 425 ------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
                  H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK
Sbjct: 353 TRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSGHYDETLNTLKYANRAKEIK 412

Query: 479 NK 480
            K
Sbjct: 413 TK 414

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 57/108 (52%), Gaps = 12/108 (11%)

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
           +   +++  D++F    +Q  +++    PL    + G+N TV  YG T  GKT+T++G  
Sbjct: 118 RFGEQKFIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGT- 176

Query: 143 KLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEE 187
                  S+  GII   + +LF  +E Q  D   + ++ SF+E+YNE+
Sbjct: 177 -------SEQPGIIFLTMQELFIRME-QLKDTKKFQLQLSFLEIYNEQ 216

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 105/178 (58%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  + I + NL   H T   + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 422
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 52/101 (51%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNE 186
                 GII   + +LF+ +     + ++ +  S++E+YNE
Sbjct: 206 --PSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNE 244

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  119 bits (299), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 106/181 (58%), Gaps = 13/181 (7%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D    I + NL  ++     + ++L+ KG  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 239 DSNESIRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNR 298

Query: 371 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 421
                 D  F  + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL    
Sbjct: 299 TADLKSDHTF--ATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLND 356

Query: 422 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
              +S H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK 
Sbjct: 357 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKT 416

Query: 480 K 480
           K
Sbjct: 417 K 417

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  D++F   ++Q  +++    PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 127 RFVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGS------ 180

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
              +  GII + + +LF+ +E  ++   + +  SF+E+YNE
Sbjct: 181 --PENPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNE 219

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 70/178 (39%), Positives = 104/178 (58%), Gaps = 8/178 (4%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL   H     + ++L+ +G  +R  + T+ N+ SSRSH +  I + + ++
Sbjct: 264 DTQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNK 323

Query: 371 ----DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV----D 422
                     + ++++DLAGSE    +     R  E  +IN+SLL LG  INAL      
Sbjct: 324 LVDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGS 383

Query: 423 KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           +S HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 384 RSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 64.7 bits (156), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 55/101 (54%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   +SQ  ++ E   PL    + G+N TV  YG T  GKTYT++G       
Sbjct: 152 KFVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSGT------ 205

Query: 148 ELSDAAGIIPRVLLKLFDTL-ELQ-QNDYVVKCSFIELYNE 186
                 GII   + +LF+ + +L+ + D+ +  S++E+YNE
Sbjct: 206 --PSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNE 244

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  119 bits (297), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 70/174 (40%), Positives = 106/174 (60%), Gaps = 9/174 (5%)

Query: 316 IYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD---- 371
           I + NL    +    + ++L+ KG  +R  ++T  N+ SSRSH +  + + +K++     
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 372 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DKSG---H 426
           E  + + ++L+DLAGSE  + +    +R  E  +IN+SLL LG  INAL    K G   H
Sbjct: 301 EDHKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGFH 360

Query: 427 IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
           +P+R+SKLTRLL+ SLGGN KT +I  ISP     +ET +TL+YA++AK IK K
Sbjct: 361 VPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (50%), Gaps = 17/124 (13%)

Query: 71  SINTTGDTGITAQMNAKR-----YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVL 125
           SI T   +     MN++R     +  D+VF   ASQ+ +++    PL    + G+N TV 
Sbjct: 102 SITTPPPSHGPRSMNSRRSGEQKFVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVF 161

Query: 126 VYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIE 182
            YG T  GKTYT++G         ++  GII   + +LF  +E Q  D   + +  S++E
Sbjct: 162 AYGATGCGKTYTVSGT--------AENPGIIFLTMQELFAKME-QLKDTKKFELTASYLE 212

Query: 183 LYNE 186
           +YNE
Sbjct: 213 IYNE 216

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 126/259 (48%), Gaps = 55/259 (21%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITL----- 365
           D    I + NL      +  + L+L+ +G  +R  + T+ N  SSRSH +  I +     
Sbjct: 254 DSNEKISVSNLSYHSPRSVQDVLDLVIRGNDNRTTSPTEANSVSSRSHAVLQIHIMQRNK 313

Query: 366 ---YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 422
               K+HQ        ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL  
Sbjct: 314 LVDLKEHQT----FGTLSIIDLAGSERAAATKNRGRRLHEGANINRSLLALGNCINALCS 369

Query: 423 KSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 477
             G     H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK I
Sbjct: 370 NDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSAHYDETLNTLKYANRAKEI 429

Query: 478 KNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEV 537
           K K           +++N                           ++ LN  + SY   +
Sbjct: 430 KTK-----------VIRN---------------------------HQTLNRHVASYLKMI 451

Query: 538 QECKREIESLTSKNALLVK 556
            E KR I+ L ++ A +V+
Sbjct: 452 TEQKRTIDELEARQAQMVQ 470

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 53/108 (49%), Gaps = 10/108 (9%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   +  ++  DK+F    SQ+ ++      L    + G+N TV  YG T  GKTYT++G
Sbjct: 135 TGSADETKFVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSG 194

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
                     +  GII R + +LF  ++      D+ +  SF+E+YNE
Sbjct: 195 TR--------ENPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNE 234

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  118 bits (295), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 111/188 (59%), Gaps = 23/188 (12%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  N I + NL  +      E ++L+ +G  +R  +ST  N+ SSRSH +  I L ++++
Sbjct: 221 DANNKISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNK 280

Query: 371 --------DELFRISKMNLVDLAGSENINRSGALNQRAK---EAGSINQSLLTLGRVINA 419
                   ++LF  S ++++DLAGSE   R+ +   R +   E  +IN+SLL LG  INA
Sbjct: 281 LNNDINSTEQLF--STLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINA 335

Query: 420 LVDKSG-------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 472
           L   +        HIP+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA+
Sbjct: 336 LCINTSSHSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYAN 395

Query: 473 KAKNIKNK 480
           +AK IK K
Sbjct: 396 RAKEIKTK 403

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           R+  DK+    ++Q  +F     PL    + GYN TV  YG T  GKTYT++G       
Sbjct: 109 RFIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGT------ 162

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
              +  GII   L  LF+ +E  ++  +  +  S++E+YNE
Sbjct: 163 --PENPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNE 201

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/192 (38%), Positives = 108/192 (56%), Gaps = 11/192 (5%)

Query: 303 QRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFT 362
           QR         +  +++ L+E  + N  E ++ + KG ++R V ST MN  SSRSH IF 
Sbjct: 165 QRKCKIRERHDHSTFVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFH 224

Query: 363 ITL-----YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 417
           I++     +KK    +   S   LVDLAGSE +  + A  +  +E  SIN+SL  LGRVI
Sbjct: 225 ISVNQKETHKKTGTVVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVI 284

Query: 418 NALVD----KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 473
           + L +    +S  IP+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS 
Sbjct: 285 SLLAEGDRQRSQMIPYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASL 342

Query: 474 AKNIKNKPQLGS 485
            K +K    + S
Sbjct: 343 TKKVKTNATINS 354

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 69/157 (43%), Gaps = 34/157 (21%)

Query: 57  VVVNVPDITGSKEISINTTGDT------------GITAQMNA-KRYTVDKVFGPGAS--- 100
           VVV V    G+  I     GDT              + Q NA K +  D  FG   S   
Sbjct: 7   VVVRVKKPQGNLPIVCKVHGDTISLINDDKKAFRLSSPQKNAAKEFRYDHCFGSTDSVDR 66

Query: 101 -QDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRV 159
            Q +I++ +        ++GYN  +L YG T +GKT+TM G++           GI+PR 
Sbjct: 67  DQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGEK--------GNEGIVPRF 118

Query: 160 LLKLFDTLELQQ---------NDYVVKCSFIELYNEE 187
             +LF+   +            D+ VKCSF E+YNE+
Sbjct: 119 CRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQ 155

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  117 bits (292), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 68/181 (37%), Positives = 106/181 (58%), Gaps = 13/181 (7%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D  + I + NL         + ++L+ KG  +R  ++T  N+ SSRSH +  I + + ++
Sbjct: 257 DNESKISVANLSHHRPKTVQDVMDLIIKGNINRTTSATDANETSSRSHAVLQIHISQTNR 316

Query: 371 ------DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--- 421
                   +F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    
Sbjct: 317 TVDLTSSHVF--ATLSIIDLAGSERAASTKNRGERLYEGANINKSLLALGNCINALCLND 374

Query: 422 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
              +S H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 375 GTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSTHYDETLNTLKYANRAKEIKT 434

Query: 480 K 480
           K
Sbjct: 435 K 435

 Score = 58.2 bits (139), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F  G+SQ  ++      L    + G+N TV  YG T  GKTYT++G       
Sbjct: 145 KFIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGT------ 198

Query: 148 ELSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNE 186
              +  GII   + +LF  +E      ++ +  S++E+YNE
Sbjct: 199 --PEQPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNE 237

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  116 bits (290), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 71/148 (47%), Positives = 93/148 (62%), Gaps = 4/148 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRS 393
           +L++  K R  AST  N+ SSRSH+IF I L  K++    +    +NLVDLAGSE +N S
Sbjct: 540 VLKRANKLRSTASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSS 599

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             + +R +E  SIN+SL  LG VI+AL    G   HIPFR SKLT LLQ SL G++KT +
Sbjct: 600 MVVGERLRETQSINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLM 659

Query: 451 IATISPAKVTSEETCSTLEYASKAKNIK 478
              ISPA +   ET ++L +ASK  N K
Sbjct: 660 FVNISPAALHLNETINSLRFASKVNNTK 687

 Score = 74.7 bits (182), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 57/117 (48%), Gaps = 17/117 (14%)

Query: 76  GDTGITAQMNAKR---YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           GD G+T      +   +  DK+F    + D IF EV G L Q  + GYN  +  YG T +
Sbjct: 381 GDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEV-GQLIQSSLDGYNVCIFAYGQTGS 439

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNE 186
           GKTYTM          L+   GI+P  +  +F   D L  +   Y V C FIE+YNE
Sbjct: 440 GKTYTM----------LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNE 486

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  116 bits (290), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 134/261 (51%), Gaps = 55/261 (21%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 369
           D+ + I + NL   +  +  + ++L+ +G  +R  +ST+ N+ SSRSH +  I + + + 
Sbjct: 302 DKDSKISVSNLSYHYPKSVQDVIDLVIRGNINRSTSSTEANEVSSRSHAVLQIHIMQTNT 361

Query: 370 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
                 +  F  + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL   +
Sbjct: 362 KIDLTSEHTF--ATLSIIDLAGSERAAATKNRGERLYEGANINKSLLALGNCINALCIPT 419

Query: 425 G---------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 475
                     HIP+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL+YA++AK
Sbjct: 420 NNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAK 479

Query: 476 NIKNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKN 535
            IK K           +++N                            ++LN  + SY  
Sbjct: 480 EIKTK-----------IIRN---------------------------QQSLNRHVGSYLK 501

Query: 536 EVQECKREIESLTSKNALLVK 556
            + E KREIE+L ++ A +++
Sbjct: 502 MITEQKREIENLRTREAQMIE 522

 Score = 68.6 bits (166), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 60/107 (56%), Gaps = 10/107 (9%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A+ N  ++  DK+F   +SQD ++      L    + G+N TV  YG T  GKTYT++G 
Sbjct: 184 AKKNEMKFVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGT 243

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNE 186
           +        +  GII RV+ +LF+ +E  +++  + +  S++E+YNE
Sbjct: 244 Q--------ENPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNE 282

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 99/179 (55%), Gaps = 9/179 (5%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ 370
           D    I + NL         E ++ + +G  +R  + T  N+ SSRSH +  I + +  +
Sbjct: 239 DSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSRSHAVLQIHIAQTDR 298

Query: 371 DELF----RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG- 425
                     + ++++DLAGSE    +    +R  E  +IN+SLL LG  INAL    G 
Sbjct: 299 TPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLALGNCINALCISDGT 358

Query: 426 ----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
               H+P+R+SKLTRLL+ SLGGN KT +I  ISP+    +ET +TL YA++AK+IK K
Sbjct: 359 RRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLTYANRAKDIKTK 417

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 52/101 (51%), Gaps = 10/101 (9%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F   A+Q  +++     L    + G+N TV  YG T  GKT+T++G       
Sbjct: 127 KFVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISG------- 179

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
              +  GII   + +LF  +E  ++  +  +  S++E+YNE
Sbjct: 180 -TPEQPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNE 219

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 101/152 (66%), Gaps = 4/152 (2%)

Query: 327 TNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLA 385
           +N  E   L+Q+  K R+ A T MN+ SSRSH++F + +   ++D   R    +NLVDLA
Sbjct: 543 SNRRELQELVQRLNKVRRTAKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLA 602

Query: 386 GSENINRSGALN-QRAKEAGSINQSLLTLGRVINALVDKSG--HIPFRESKLTRLLQDSL 442
           GSE +NRSG ++ +R +E   IN+SL ++G VI+AL   SG  HIPFR +KLT LL+ SL
Sbjct: 603 GSERMNRSGLVDKERIEETKQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSL 662

Query: 443 GGNTKTALIATISPAKVTSEETCSTLEYASKA 474
            G++KT ++ T+SP+  +  ET ++L +A+K 
Sbjct: 663 QGSSKTLMLVTVSPSNSSRNETMNSLRFATKV 694

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F    S   +F EV   L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVK-ELVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 149 LSDAAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNE 186
           L++  GIIP  L  + D   +++     Y +K  F+E+YN+
Sbjct: 457 LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYND 497

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 107/195 (54%), Gaps = 28/195 (14%)

Query: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD--- 371
            +YI+N+ E  ++N  + +  ++ G ++R   ST MN  SSRSH I +IT+ +   D   
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITIKRTDIDLNT 247

Query: 372 --ELFRISKMNLVDLAGSENINRSGAL----NQRAKEAGSINQSLLTLGRVINALVDK-- 423
              +   S    VDLAGSE   RS A     N R KE  SIN+SL TL RV+ +L  +  
Sbjct: 248 NSSIISDSICRFVDLAGSE---RSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREE 304

Query: 424 ---------SGH---IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYA 471
                    S H   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL YA
Sbjct: 305 LKYNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRYA 362

Query: 472 SKAKNIKNKPQLGSF 486
             A+ IK    + ++
Sbjct: 363 DIAQTIKTNSIINTY 377

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 71/165 (43%), Gaps = 20/165 (12%)

Query: 37  ITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFG 96
           ++V VR   R+E         V+N   I  S      TT           K +  DK F 
Sbjct: 5   VSVYVRVAPRDESRRHRAICKVINTDSILLSSNPKRQTTFIRSSFENKEEKIFKFDKCFD 64

Query: 97  PGA----SQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDA 152
            G     SQ   +        +D + GYNC +L YG T +GKTYTM G+ K      +D 
Sbjct: 65  EGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMGESK------NDT 118

Query: 153 AGIIPRVLLKLFDTLE----------LQQNDYVVKCSFIELYNEE 187
            G+IPR    LF  +E           Q+++Y V CS  E+YNE+
Sbjct: 119 RGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQ 163

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  114 bits (284), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 94/151 (62%), Gaps = 8/151 (5%)

Query: 334 NLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK---MNLVDLAGSENI 390
           N+L+K  K R  A+T  N+ SSRSH++F I  Y K ++E+   S    +NLVDLAGSE +
Sbjct: 570 NVLKKATKLRATAATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERL 627

Query: 391 NRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTK 447
           N S A+  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++K
Sbjct: 628 NSSQAVGARLRETQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSK 687

Query: 448 TALIATISPAKVTSEETCSTLEYASKAKNIK 478
           T +   ISP K    ET ++L +ASK  + K
Sbjct: 688 TLMFVNISPTKSHLNETINSLRFASKVNSTK 718

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D++F    S   +F E+ G L Q  + G+N  +  YG T +GKTYTM          
Sbjct: 430 YKFDRIFDQADSNTEVFKEI-GQLVQSSLDGHNVCIFAYGQTGSGKTYTM---------- 478

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNE 186
           L+D  G+IP  +  +FD  E  +     Y + C FIE+YNE
Sbjct: 479 LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNE 519

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score =  113 bits (282), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 72/182 (39%), Positives = 105/182 (57%), Gaps = 6/182 (3%)

Query: 302 GQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIF 361
            Q+  +  + +  G YI N+    +T+  +   +L+K  K R  A+T+ N+ SSRSH++F
Sbjct: 525 SQKHDIRHDHEKQGTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVF 584

Query: 362 TITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 419
            + +  +  H  E  +  K+NLVDLAGSE IN S    +R +E  +IN+SL  LG VI A
Sbjct: 585 MVHINGRNLHTGETSQ-GKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYA 643

Query: 420 L-VDKSG--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 476
           L    +G  +IPFR SKLT LLQ SL G++KT +   I P      ET ++L +ASK  +
Sbjct: 644 LNTPDAGKRYIPFRNSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNS 703

Query: 477 IK 478
            K
Sbjct: 704 TK 705

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 77/161 (47%), Gaps = 24/161 (14%)

Query: 33  EELNITVAVRCRGR----NEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKR 88
           +EL   + V CR R    NE +  M   ++    +  G++ ++IN   + G     N   
Sbjct: 361 QELRGNIRVYCRVRPPLLNEPQ-DMSHILIEKFNEAKGAQSLTINR--NEGRILSYN--- 414

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D +F P  +   IF+E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 415 FQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 463

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNE 186
           L+   G+IP  L  +F     L+ +  +Y ++C +IE+YNE
Sbjct: 464 LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNE 504

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 68/143 (47%), Positives = 90/143 (62%), Gaps = 3/143 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-KHQDELFRISKMNLVDLAGSENINRS 393
           +L++  K R  AST  N+ SSRSH+IF I L+   H+ +      +NLVDLAGSE ++ S
Sbjct: 612 VLKRATKLRSTASTLSNEHSSRSHSIFIIELHGVNHKTKEESCGVLNLVDLAGSERVHSS 671

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG--HIPFRESKLTRLLQDSLGGNTKTALI 451
               +R +E  +IN+SL  LG VI AL DK+   HIPFR SKLT LLQ SL GN+KT + 
Sbjct: 672 QVTGERLRETQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMF 731

Query: 452 ATISPAKVTSEETCSTLEYASKA 474
             ISP+     ET ++L +ASK 
Sbjct: 732 VNISPSSSHINETINSLRFASKV 754

 Score = 76.3 bits (186), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 55/101 (54%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F  G S D +F EV G L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 472 FKFDKIFDTGESNDEVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 520

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNE 186
           L    G+IP  +  +FD +E L++   +Y + C F+E+YNE
Sbjct: 521 LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNE 561

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  113 bits (282), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 105/180 (58%), Gaps = 12/180 (6%)

Query: 311 DQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH- 369
           D  N   + NL      +  + ++L+ KG  +R  + T  N+ SSRSH +  I + +   
Sbjct: 241 DTDNTTTVANLSYHTPRSVQDVMDLVIKGNINRTTSPTDANETSSRSHAVLQIHVVQSSR 300

Query: 370 -----QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS 424
                +D+ +  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL    
Sbjct: 301 SVDLKEDKTY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMTG 358

Query: 425 ----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNK 480
                H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK K
Sbjct: 359 RRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 10/102 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   A+Q  +F     PL    I G+N TV  YG T  GKT+T++G      
Sbjct: 128 QKFMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISG------ 181

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
               +  GII   + +LF  +E  ++   + +  S++E+YNE
Sbjct: 182 --TPENPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNE 221

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  112 bits (281), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 110/404 (27%), Positives = 207/404 (51%), Gaps = 63/404 (15%)

Query: 311 DQTNGIYIQNLQEFHITNAMEG-LNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           D  +   + NL  +H    +E  ++L+ +G  +R  + T  N+ SSRSH +  + + +  
Sbjct: 239 DSDSTTTVANLS-YHTPETVEDVMDLVIRGNVNRTTSPTDANETSSRSHAVLQVHVVQSS 297

Query: 370 ------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV-- 421
                 +D+++  + ++++DLAGSE  + +    +R  E  +IN+SLL LG  INAL   
Sbjct: 298 RTVDLKEDKMY--ATLSIIDLAGSERASATKNRGERLHEGSNINKSLLALGNCINALCMT 355

Query: 422 --DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
                 H+P+R+SKLTRLL+ SLGGN KT +I  +SP+    +ET +TL+YA++AK+IK 
Sbjct: 356 GRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSAHYDETLNTLKYANRAKDIKT 415

Query: 480 K---------PQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDL 530
           K           +GS++      K IT +    K ++   +S+E         K ++  L
Sbjct: 416 KVIRNQHSLDRHVGSYL------KMITAQ----KQEIEELRSREA--------KVIDLRL 457

Query: 531 ESY---KNEVQECKRE-IESLTSKNALLVKDKLKSKETIQS-QNCQ---IESLKTTIDHL 582
           + +   +N++Q    E +  L S   +L  D+ +  +T++S   C+   ++ ++T ++HL
Sbjct: 458 QQFRLSRNKLQMAMWEGVNQLKSNYQVL--DRFQRTKTMKSLMLCKRHFLQLVQTEVNHL 515

Query: 583 RAQLDKQHKTEIEISDFNNKL--QKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLK 640
             QL +  K +  +S F   +  Q LT++ ++      +   D   +F++ + +  K+  
Sbjct: 516 -LQLTESTKVDHPLSGFCQTINEQLLTKICEL------EDSFDAEDEFQLTL-EHAKEAD 567

Query: 641 STLFLQLNTMQQ--ESILQETNIQPNLDMIKNEVLTLMRTMQEK 682
              F Q+ T  +  +++  E  ++   + IKNE++     M +K
Sbjct: 568 MARFQQMETWDEATDALWYEQQLEHLAESIKNEIMVNASAMMDK 611

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (51%), Gaps = 10/102 (9%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  DK+F   ASQ  +F     PL    + G+N TV  YG T  GKT+T++G      
Sbjct: 126 QKFMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISG------ 179

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQN--DYVVKCSFIELYNE 186
               D+ GII   + +LF  +   ++   + +  S++E+YNE
Sbjct: 180 --TPDSPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNE 219

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/150 (46%), Positives = 92/150 (61%), Gaps = 8/150 (5%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 391
           +L +  K R  ASTK N+ SSRSH+IF I L+ K+    ++ + I  +NLVDLAGSE IN
Sbjct: 555 VLHRATKLRSTASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERIN 612

Query: 392 RSGALNQRAKEAGSINQSLLTLGRVINAL---VDKSGHIPFRESKLTRLLQDSLGGNTKT 448
            S    +R +E   IN+SL  LG VI+AL     K  HIPFR SKLT LL+ SL GN+KT
Sbjct: 613 SSQVSGERLRETQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKT 672

Query: 449 ALIATISPAKVTSEETCSTLEYASKAKNIK 478
            +   IS +     ET ++L +ASK  + K
Sbjct: 673 LMFVNISASLNHVNETINSLRFASKVNSTK 702

 Score = 78.2 bits (191), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 77/160 (48%), Gaps = 24/160 (15%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTG---ITAQMNAKRY 89
           +EL   + V CR R      +KS   +  P+ +  K  S++    T    IT   N  +Y
Sbjct: 369 QELRGNIRVYCRLR----PPLKS---IEDPNTSHIKVYSLDNDHGTQTMEITKNNNTNKY 421

Query: 90  TVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGEL 149
             DK+F    S   IF EV G L Q  + GYN  +  YG T +GKT+TM          L
Sbjct: 422 KFDKIFDQFESNSEIFKEV-GQLVQSALDGYNVCIFAYGQTGSGKTFTM----------L 470

Query: 150 SDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNE 186
           + + GIIP  +  +F   D L+ +  +Y + C F+E+YNE
Sbjct: 471 NPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNE 510

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 8/151 (5%)

Query: 334 NLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 390
           N+L++  K R  AST  N+ SSRSH+IF I L   +    +E + I  +NLVDLAGSE I
Sbjct: 547 NILKRANKLRSTASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERI 604

Query: 391 NRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTK 447
           N S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+K
Sbjct: 605 NSSQVTGDRLRETQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSK 664

Query: 448 TALIATISPAKVTSEETCSTLEYASKAKNIK 478
           T +   ISP+     ET ++L +ASK  + K
Sbjct: 665 TLMFVNISPSANHINETINSLRFASKVNSTK 695

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 72/167 (43%), Gaps = 29/167 (17%)

Query: 33  EELNITVAVRCRGRNE-REISMKSSVVVNVPDITGS---------KEISINTTGDTGITA 82
           +EL   + V CR R     I  K +  + V D             K I +N    T I  
Sbjct: 343 QELRGKIRVYCRIRPPLPNIESKDTAHIKVEDFDDDNGIQSMEVMKGIEVNNNNATQI-- 400

Query: 83  QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDE 142
               +R+  DK+F    +   +F EV G L Q  + GYN  +  YG T +GKTYTM    
Sbjct: 401 ---PQRFKFDKIFNQTDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM---- 452

Query: 143 KLYNGELSDAAGIIPRVLLKLFD---TLELQQNDYVVKCSFIELYNE 186
                 L    GIIP  +  +F+    L+ +   Y + C F+E+YNE
Sbjct: 453 ------LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNE 493

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 82/209 (39%), Positives = 105/209 (50%), Gaps = 27/209 (12%)

Query: 302 GQRSSMAP------NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSS 355
           G RSS  P       D   G+ I  L E    ++ E L  ++ G K R+   T  N  SS
Sbjct: 242 GTRSSKTPVELKLREDSKYGVKIVGLTERRCESSDELLKWIRIGDKSRKTGETTYNTRSS 301

Query: 356 RSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLG 414
           RSH I  I L K    E   +S  ++L DLAGSE   ++   N+R KE   IN+SLL LG
Sbjct: 302 RSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFINKSLLALG 358

Query: 415 RVINALVDKS-------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 461
            VI+ L  +S             GHIP+R+SKLTR+LQ +L GN     I TI      S
Sbjct: 359 TVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICTIDTRPDAS 418

Query: 462 EETCSTLEYASKAKNIK----NKPQLGSF 486
            ET +TL +AS+AKN+      KP L S 
Sbjct: 419 SETLNTLRFASRAKNVSLHIFRKPLLPSM 447

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 64/136 (47%), Gaps = 15/136 (11%)

Query: 56  SVVVNV-PDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQ 114
           SVV+ + P+  G +E+      D       +   +  D VF    +   ++ + + P+  
Sbjct: 90  SVVIRLKPN--GGRELDPWFVRDEHTMQHADYGEFKYDHVFKTACNNVEVYAQTSKPMID 147

Query: 115 DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL--ELQQN 172
              +G N TV  YGMT +GKT+TM G E        +  G+IP  +  L+  +  E  Q 
Sbjct: 148 RVFEGLNATVFAYGMTGSGKTFTMAGTE--------ETLGLIPLSVAYLYSRVMEESLQG 199

Query: 173 D--YVVKCSFIELYNE 186
           D  + +  S++E+YNE
Sbjct: 200 DSRFEIAVSYLEIYNE 215

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score =  109 bits (273), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 94/156 (60%), Gaps = 13/156 (8%)

Query: 334 NLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENI 390
           N+L++  K R  AST  N+ SSRSH+IF I L   ++   ++ + I  +NLVDLAGSE I
Sbjct: 602 NILRRANKLRSTASTLSNEHSSRSHSIFIIHLKGTNEITGEKSYGI--LNLVDLAGSERI 659

Query: 391 NRSGALNQRAKEAGSINQSLLTLGRVINALVD--------KSGHIPFRESKLTRLLQDSL 442
           N S    +R +E  +IN+SL  LG VI+AL          K  HIPFR SKLT LLQ SL
Sbjct: 660 NSSQVTGERLRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSL 719

Query: 443 GGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
            GN+KT +   ISP+     ET ++L +ASK  + K
Sbjct: 720 IGNSKTLMFVNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (51%), Gaps = 14/102 (13%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  DK+F    + D +F EV G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 452 KFKFDKIFNQNETNDDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 501

Query: 148 ELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNE 186
            L    GIIP  +  +F   + L+ +   Y ++C F+E+YNE
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNE 542

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 102/183 (55%), Gaps = 18/183 (9%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L+E    ++ E +  +++G  HR+ A T  N  SSRSH I  I L   +
Sbjct: 273 DDSKYGVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTN 332

Query: 370 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 424
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 333 VIDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAAS 389

Query: 425 ----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKA 474
                     GHIP+R+SKLTR+LQ +L G++    I TI   K ++ ET +TL +AS+A
Sbjct: 390 HGNSPNANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRA 449

Query: 475 KNI 477
           KN+
Sbjct: 450 KNV 452

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 48/98 (48%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D V+ P  S   I++ +  P+     +G+N TV  YGMT +GKTYTM G       +
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTMMGSGGDGGDD 194

Query: 149 LSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNE 186
                  +  +  K+ +   + +  + V  S++E+YNE
Sbjct: 195 DGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNE 232

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 8/150 (5%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ---DELFRISKMNLVDLAGSENIN 391
           L++K  K R  A+T  N+ SSRSH+IF I L   +    +  + I  +NLVDLAGSE +N
Sbjct: 539 LIKKATKLRATATTAANERSSRSHSIFIIHLRGSNNITGESSYGI--LNLVDLAGSERLN 596

Query: 392 RSGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKT 448
            S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL GN+KT
Sbjct: 597 SSQVEGARLRETQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKT 656

Query: 449 ALIATISPAKVTSEETCSTLEYASKAKNIK 478
            +   ISP +   +ET ++L +ASK    K
Sbjct: 657 LMFVNISPTQQQIQETLNSLRFASKVNTTK 686

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 14/103 (13%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           +++  D++F        +FDE+ G L Q  + GYN  +  YG T +GKT+TM        
Sbjct: 395 QKFQFDRIFDQHEVNKDVFDEI-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM-------- 445

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNE 186
             L+   G+IP  +  +F   D+L+ +  +Y V C F+E+YNE
Sbjct: 446 --LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNE 486

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH-QDELFRISKMNLVDLAGSENINRS 393
           +L+K  K R  AST  N+ SSRSH+IF I L   + +        +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVS 636

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 451 IATISPAKVTSEETCSTLEYASKA 474
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 79/161 (49%), Gaps = 23/161 (14%)

Query: 33  EELNITVAVRCRGRNE-REISMKSSVVVNV---PDITGSKEISINTTGDTGITAQMNAKR 88
           +EL   + V CR R   + +    + ++NV    D +G + + +    +T   AQ++   
Sbjct: 381 QELRGNIRVYCRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNT---AQVH--E 435

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          
Sbjct: 436 FKFDKIFDQQDTNVDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 484

Query: 149 LSDAAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNE 186
           L+   GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 485 LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNE 525

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 393
           +L+K  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINIS 636

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 451 IATISPAKVTSEETCSTLEYASKA 474
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 53/163 (32%), Positives = 79/163 (48%), Gaps = 27/163 (16%)

Query: 33  EELNITVAVRCRGRNEREI--SMKSSVV-VN-VPDITGSKEISINTTGDTGITAQMNAKR 88
           +EL   + V CR R   E   ++ +S++ VN   D  G + + +     T I +      
Sbjct: 381 QELRGNIRVYCRIRPPLETLENLDTSLIRVNEFDDNRGVQSMEV-----TKIQSTTQVHE 435

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTM--TGDEKLYN 146
           +  DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM  TGD     
Sbjct: 436 FKFDKIFDQQNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTMLNTGD----- 489

Query: 147 GELSDAAGIIPRVLLKLF---DTLELQQNDYVVKCSFIELYNE 186
                  GIIP  +  +F   + L+ +  DY V C FIE+YNE
Sbjct: 490 -------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNE 525

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score =  107 bits (267), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/148 (45%), Positives = 87/148 (58%), Gaps = 4/148 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLY-KKHQDELFRISKMNLVDLAGSENINRS 393
           LL+K  + R  AST  N+ SSRSH++F I L    H         +NLVDLAGSE IN S
Sbjct: 566 LLRKANRLRSTASTSANERSSRSHSVFIIFLKGSNHLTGEQSDGILNLVDLAGSERINSS 625

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             L +R +E  +IN+SL  LG V++AL        HIPFR SKLT LLQ SL GN+KT +
Sbjct: 626 QVLGERLRETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLM 685

Query: 451 IATISPAKVTSEETCSTLEYASKAKNIK 478
              IS  +    ET ++L +ASK  + K
Sbjct: 686 FVNISACESHLNETLNSLRFASKVNSTK 713

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/155 (31%), Positives = 77/155 (49%), Gaps = 18/155 (11%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVN-VPDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   + E    + + VN   D  G + + I  + +TG +   N   +  D++
Sbjct: 377 NIRVFCRIRPPLKYENPNTAHLTVNKFDDENGCQTMEIVKSNNTGNSIPQN---FKFDRI 433

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    + + +F+E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 434 FDQNETNENVFEEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPRNG 482

Query: 155 IIPRVLLKLFDTLE-LQQN--DYVVKCSFIELYNE 186
           IIP  +  +F  +E L++   +Y + C FIE+YNE
Sbjct: 483 IIPATISHIFSWIENLKERGWNYEINCQFIEIYNE 517

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score =  107 bits (266), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 100/173 (57%), Gaps = 4/173 (2%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           N +T    I N+    +T+      LL++  K R  AST  N+ SSRSH+IF + L  ++
Sbjct: 524 NQETKETTITNVTTVPLTSKNTVDELLKRANKLRSTASTACNERSSRSHSIFIVHLSGEN 583

Query: 370 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--VDKSG- 425
                R    +NLVDLAGSE IN S  + +R +E  SIN+SL  LG VI+AL   D S  
Sbjct: 584 VLTGERSHGILNLVDLAGSERINTSQVIGERLRETQSINKSLSCLGDVIHALGSADASKR 643

Query: 426 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
           HIPFR SKLT LLQ SL GN+KT +   IS     + ET ++L +ASK  + K
Sbjct: 644 HIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHTNETLNSLRFASKVNSTK 696

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 72/155 (46%), Gaps = 20/155 (12%)

Query: 36  NITVAVRCRGRNEREISMKSSV-VVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R    RE +  + + V    D  G++ I +   G  G   Q+    +  D++
Sbjct: 354 NIRVFCRVRPPLPRENATSNHLKVREFNDDAGNQVIEVAKNG-YGSGPQI----FKFDRI 408

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F    +   +F E+ G L Q  + GYN  +  YG T +GKTYTM          L+   G
Sbjct: 409 FNEKETNYDVFQEI-GQLVQSSLDGYNVCIFAYGQTGSGKTYTM----------LNPTDG 457

Query: 155 IIPRVLLKLFDT---LELQQNDYVVKCSFIELYNE 186
           IIP  +  +F+    L+ +   Y V C F+E+YNE
Sbjct: 458 IIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNE 492

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 107/191 (56%), Gaps = 21/191 (10%)

Query: 304 RSSMA-P-----NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRS 357
           RSS+A P     +D   G+ +  L E    +  E LN ++ G KHR+ +ST  N  SSRS
Sbjct: 213 RSSIAVPELKIRDDPNYGVRVIGLTEKRCQSHEELLNWIKLGDKHRKTSSTDFNTRSSRS 272

Query: 358 HTIFTITLYKK--HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 415
           H I  I L        E+   S ++L DLAGSE   R  A ++R +E   IN+SLL LG 
Sbjct: 273 HAIILIRLISSDLSSGEVV-TSTLSLCDLAGSE---RVTAQHERRQEGSFINKSLLALGT 328

Query: 416 VINAL---VDKS------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 466
           VI+ L   V+ S       HIP+R+SKLTR+LQ +L GN+    I TI  +   + E+ +
Sbjct: 329 VISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTICTIDTSVDATNESVN 388

Query: 467 TLEYASKAKNI 477
           TL +AS+AKN+
Sbjct: 389 TLRFASRAKNV 399

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 53/103 (51%), Gaps = 12/103 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           YT D VF P AS   ++     PL      G+N TV  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 149 LSDAAGIIP----RVLLKLFDTLELQQNDYVVKCSFIELYNEE 187
           +   AG+IP     +  K+FD+   +   Y    S++E+YNE+
Sbjct: 156 VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEK 198

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 67/144 (46%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 393
           +L+K  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 577 ILKKANKLRSTASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINIS 636

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 637 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLM 696

Query: 451 IATISPAKVTSEETCSTLEYASKA 474
              ISP+     ET ++L +ASK 
Sbjct: 697 FVNISPSSSHINETLNSLRFASKV 720

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 50/158 (31%), Positives = 73/158 (46%), Gaps = 17/158 (10%)

Query: 33  EELNITVAVRCRGRNEREISMKS-SVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E    S + ++NV +   +    I +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPALETLEDSDTSLINVNEFDDN--CGIQSMEVTKIHNTAQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    +   +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQKDTNADVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNE 186
             GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/149 (44%), Positives = 88/149 (59%), Gaps = 6/149 (4%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELFRISKMNLVDLAGSENINR 392
           LL++  K R  A+T  N+ SSRSH++F I L  Y  +  E  +   +NLVDLAGSE IN 
Sbjct: 554 LLKRAAKLRSTAATGSNERSSRSHSVFIIKLRGYNSNTGEECQ-GTLNLVDLAGSERINA 612

Query: 393 SGALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTA 449
           S     R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT 
Sbjct: 613 SQVTGDRLRETQNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTL 672

Query: 450 LIATISPAKVTSEETCSTLEYASKAKNIK 478
           +   ISP      ET ++L +ASK  + +
Sbjct: 673 MFVNISPCLDHFNETLNSLRFASKVNSTR 701

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 73/155 (47%), Gaps = 23/155 (14%)

Query: 36  NITVAVRCRGRNEREISMKSSVVVNV-PDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   + E S    V +N+  D  G++  S+N T D+          +  DK+
Sbjct: 367 NIRVFCRIRPLLQGEGSESCHVHINLFNDDEGTQ--SMNITRDS------KKHEFKFDKI 418

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F P  S D IF+E+   L Q  + GYN  +  YG T +GKTYTM          L    G
Sbjct: 419 FDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM----------LHPQNG 467

Query: 155 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNE 186
           +IP  L  +F  + L +    +Y +   FIE+YNE
Sbjct: 468 MIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNE 502

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/182 (36%), Positives = 103/182 (56%), Gaps = 6/182 (3%)

Query: 302 GQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIF 361
            Q+  +  +   +   I N+ +  +T+  +  ++L++  + R  A T+ N+ SSRSH++F
Sbjct: 527 SQKHEIRHDHDNHATSITNVTKMKMTSQEQVDSMLKRASRMRSTACTRSNERSSRSHSVF 586

Query: 362 TITLYKKHQDELFRIS--KMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINA 419
            + +   H D+   +S  K+NL+DLAGSE IN S     R +E  +IN+SL  LG VI A
Sbjct: 587 MVHI-NGHNDQTGEVSHGKLNLIDLAGSERINSSLVTGDRLRETQNINKSLSCLGDVIYA 645

Query: 420 LVDKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 476
           L        HIPFR SKLT LLQ SL G++KT +   I   +  + ET ++L +ASK  +
Sbjct: 646 LNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKHTNETLNSLRFASKVNS 705

Query: 477 IK 478
            K
Sbjct: 706 TK 707

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DK+F P  +   +F E+   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 417 FHFDKIFEPHNTNADVFQEIC-QLVQCSLDGYNVCIFAYGQTGSGKTYTM---------- 465

Query: 149 LSDAAGIIPRVLLKLFDTLE-LQQND--YVVKCSFIELYNE 186
           L+   G+IP  L  +F   E L ++   Y + C +IE+YNE
Sbjct: 466 LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNE 506

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score =  105 bits (261), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/144 (45%), Positives = 86/144 (59%), Gaps = 4/144 (2%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFR-ISKMNLVDLAGSENINRS 393
           +L++  K R  AST  N+ SSRSH+IF I L   +     +    +NLVDLAGSE IN S
Sbjct: 576 VLKRANKLRSTASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINIS 635

Query: 394 GALNQRAKEAGSINQSLLTLGRVINALVDKSG---HIPFRESKLTRLLQDSLGGNTKTAL 450
             +  R +E  +IN+SL  LG VI+AL        HIPFR SKLT LLQ SL G++KT +
Sbjct: 636 QVVGDRLRETQNINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLM 695

Query: 451 IATISPAKVTSEETCSTLEYASKA 474
              ISP+     ET ++L +ASK 
Sbjct: 696 FVNISPSSSHINETLNSLRFASKV 719

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/158 (30%), Positives = 75/158 (47%), Gaps = 17/158 (10%)

Query: 33  EELNITVAVRCRGRNERE-ISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTV 91
           +EL   + V CR R   E +    + ++NV +   ++   + +   T I        +  
Sbjct: 381 QELRGNIRVYCRIRPPLESLENLDTSLINVNEFDDNR--GVQSMEVTKIQNTPQVHEFKF 438

Query: 92  DKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSD 151
           DK+F    + + +F EV G L Q  + GYN  +  YG T +GKT+TM          L+ 
Sbjct: 439 DKIFDQRNTNEDVFKEV-GQLVQSSLDGYNVCIFAYGQTGSGKTFTM----------LNP 487

Query: 152 AAGIIPRVLLKLFDT---LELQQNDYVVKCSFIELYNE 186
             GIIP  +  +F+    L+ +  DY V C FIE+YNE
Sbjct: 488 GDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNE 525

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score =  105 bits (261), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 99/196 (50%), Gaps = 31/196 (15%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E    ++ E +N + KG K R+ A T  N  SSRSH I  I L    
Sbjct: 275 DDSKYGVRVIGLTEKRCESSEELMNWIIKGDKIRKTAETDFNARSSRSHAIVLIRLTTSD 334

Query: 370 QDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 424
             +   IS  ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 335 MKDGTSISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSTESNKNR 391

Query: 425 -----------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 461
                                  GHIP+R+SKLTRLLQ +L G++    I TI     +S
Sbjct: 392 SPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRLLQPALSGDSIVTTICTIDTKNESS 451

Query: 462 EETCSTLEYASKAKNI 477
            ET +TL +AS+AKNI
Sbjct: 452 AETLNTLRFASRAKNI 467

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 81/181 (44%), Gaps = 32/181 (17%)

Query: 12  RSSNSISKNGNSQVGCHTVPNEELNITVAVRCRG-RNEREISMKSSVVVNVPDITGSKEI 70
           R +NS + N  S+   +T       ITVA+R +   N  ++S  S +V      T  K I
Sbjct: 81  RRTNSQTYNTKSEHSTYTG-----TITVAIRPKPTSNPSDVSTSSWLV------TDEKTI 129

Query: 71  SINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMT 130
           + +  G+           +  D VF    S   I+  +  P+     +G+N T+  YGMT
Sbjct: 130 AHDDVGE-----------FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMT 178

Query: 131 STGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNE 186
            +GKTYTM G       E     G+IP  +  LF  +  +  D    + +  S++E+YNE
Sbjct: 179 GSGKTYTMMGCP-----EREQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNE 233

Query: 187 E 187
           +
Sbjct: 234 K 234

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 128/250 (51%), Gaps = 36/250 (14%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E ++++  E +  +  G  +R+   T  N  SSRSH +  I ++   
Sbjct: 230 DDLKYGVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--C 287

Query: 370 QDELFR---ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS-- 424
            DE+     +S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S  
Sbjct: 288 TDEITGEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSG 344

Query: 425 -----GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK- 478
                GHIP+R+SKLTR+LQ +L G++  A I T+     TS E+ +T+ +AS+AKNI  
Sbjct: 345 LSTNVGHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNISL 404

Query: 479 -----------NKPQLGSFIMKDILVKNITME---------LAKIKSDLLSTKSKEGIYM 518
                      +K QL   + K +  + IT++          + I SD    +  E + M
Sbjct: 405 AVKRNEADSNVSKSQLIQTLRKQVREQQITIDNLTRGKGFIGSGISSDTSLLRENELLKM 464

Query: 519 SQDHYKNLNS 528
             +HY+ L +
Sbjct: 465 KVEHYERLET 474

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 57/100 (57%), Gaps = 10/100 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF P  + D +++ +A P+     +G+NCT+  YGMT +GKTYTM+G +      
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGSK------ 159

Query: 149 LSDAAGIIPRVLLKLFDTLE--LQQNDYVVKCSFIELYNE 186
                GIIP  +  +FD +   L +  + V+ S++E+YNE
Sbjct: 160 --SGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNE 197

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 69/183 (37%), Positives = 104/183 (56%), Gaps = 8/183 (4%)

Query: 302 GQRSSMAPNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIF 361
           G R  +  +D +    ++NL+   +T+      +L+  +K R  AST  N+ SSRSH+IF
Sbjct: 490 GPRHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNERSSRSHSIF 549

Query: 362 TITLYKKHQ---DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN 418
            I ++  ++   +E  R   +NL+DLAGSE ++ S   ++R KE   IN+SL  LG V+N
Sbjct: 550 IIKIHGINEGLGEE--RNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSLSFLGNVMN 607

Query: 419 ALVDKSG---HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 475
           +L        HI FR+SKLT LLQ SL GN+KT ++  IS +     ET  +L +A K  
Sbjct: 608 SLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKSLNFAKKVN 667

Query: 476 NIK 478
           + K
Sbjct: 668 STK 670

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 53/103 (51%), Gaps = 14/103 (13%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           +Y+ DKVF    +   IF EV+  L Q  + G+N  +  YG T +GKT+TM         
Sbjct: 382 KYSFDKVFSQTDTNQEIFKEVS-ELIQSSLDGFNVCIFAYGQTGSGKTFTM--------- 431

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQND---YVVKCSFIELYNEE 187
            L+   GIIP     +FD ++    +   Y V C F+E+YN+E
Sbjct: 432 -LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDE 473

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 111/228 (48%), Gaps = 36/228 (15%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ I  L E     + E +  ++ G  +R+ + T+ N  SSRSH +  + L   +
Sbjct: 261 DDLEYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHAVILVRLVTHN 320

Query: 370 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 424
             D     S + L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 321 VIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVISKLSAESLSNS 377

Query: 425 --------------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEET 464
                                HIP+R+SKLTRLLQ +L GN+    I TI P   T  ET
Sbjct: 378 KHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTIDPRMETYAET 437

Query: 465 CSTLEYASKAKNI-------KNKPQLG-SFIMKDILVKNITMELAKIK 504
            +TL +AS+AKN+       KN   +  S + KD ++K +T  L K K
Sbjct: 438 INTLRFASRAKNVSLRFNIKKNLSTISKSEVEKDKIIKELTFRLEKQK 485

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 81  TAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTG 140
           T   N   Y  D VF P      I+   A PL      G+N T+  YGMT +GKTYTM G
Sbjct: 125 TINTNNDEYKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMG 184

Query: 141 DEKLYNGELSDAAGIIPRVLLKLFDTLELQQND--YVVKCSFIELYNEE 187
           D +       +  GI+P  +  LF+ +   +ND  Y V  S++E+YNE+
Sbjct: 185 DNE-------NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEK 226

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score =  102 bits (254), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 12/151 (7%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK------KHQDELFRISKMNLVDLAGSE 388
           +L+   K + +A+T  N+ SSRSH++FTI ++       +  D +     +NLVDLAGSE
Sbjct: 541 VLRTANKTKSIAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV-----LNLVDLAGSE 595

Query: 389 NINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS-GHIPFRESKLTRLLQDSLGGNTK 447
            I+ S     R +E  +IN+SL  LG VI AL  K   HIPFR SKLT LLQ SL G++K
Sbjct: 596 RIDTSNVTGDRLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSK 655

Query: 448 TALIATISPAKVTSEETCSTLEYASKAKNIK 478
           T +   +SP+    +ET ++L +ASK  + K
Sbjct: 656 TLMFVNVSPSSNHVKETLNSLRFASKVNSTK 686

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 74/156 (47%), Gaps = 23/156 (14%)

Query: 36  NITVAVRCRGRNEREISMKSSV-VVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKV 94
           NI V  R R   E E+   S + V N  +  GS+ I I+              R+  DKV
Sbjct: 358 NIRVYCRIRPPLENEVQDISHIHVSNFDNRNGSQAIEISNEDRNS--------RFLFDKV 409

Query: 95  FGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAG 154
           F   AS   +F+EV G L Q  + GYN  +  YG T +GKTYTM          ++D  G
Sbjct: 410 FSSNASNRDVFEEV-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM----------MNDPDG 458

Query: 155 IIPRVLLKLFDTLELQQN---DYVVKCSFIELYNEE 187
           +IP  L  +FD   L +    DY  +  FIE+YNE+
Sbjct: 459 VIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNEQ 494

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score =  100 bits (250), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 161/318 (50%), Gaps = 38/318 (11%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D  +G+ +  L E  + ++ + L  +  G  +R+   T  N  SSRSH I T+ L    
Sbjct: 272 DDSKHGVRVMGLTEQRVYSSEDVLKWISLGDTNRRTGETDYNTRSSRSHAIVTLNLACT- 330

Query: 370 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS- 424
             +L       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   S 
Sbjct: 331 --DLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSASSM 385

Query: 425 --------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKN 476
                    HIP+R+SKLTR+LQ +L G +    I TI        ET +T+ +AS+AKN
Sbjct: 386 HTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTRLDAMSETVNTIRFASRAKN 445

Query: 477 I-----KNKPQLGSFIMKDILVKNITMELAKIKSDLLSTK-SKEGIYMSQDHYKNLNSDL 530
           +     +N+ +L     KD L+ N+  +L + +  +   K ++E    + D Y  L  + 
Sbjct: 446 VSMTVKRNEAELAH--EKDALIHNLRRQLDEQQELIWELKRNQEKCEQTPDLYL-LRKES 502

Query: 531 ESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQIES-LKTTIDHLRAQL--- 586
           ++ K ++Q C+R    L  K+   V+D  +  E ++     + + L++ I  L++QL   
Sbjct: 503 DALKRKLQLCER----LLDKDEAAVQDD-QLVEIVEMLPPAVGALLESKIQGLQSQLRSH 557

Query: 587 -DKQHKTEIEISDFNNKL 603
            D   + E ++SD +++L
Sbjct: 558 RDYSSQLERQLSDLDSRL 575

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 11/114 (9%)

Query: 77  DTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTY 136
           D    A  +   +  D VF P ++   ++ ++  P+     +GYN  +  YGMT +GKT+
Sbjct: 127 DEQTIAHNDVGEFKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTF 186

Query: 137 TMTGDEKLYNGELSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEE 187
           TM+G          + AG+I   +  +F  +    L    + V  S++E+YNE+
Sbjct: 187 TMSGT--------PEEAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEK 232

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score =  100 bits (249), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 72/167 (43%), Positives = 97/167 (58%), Gaps = 14/167 (8%)

Query: 325 HITN-------AMEGLN-LLQKGLKHRQVASTKMNDFSSRSHTIFTITL--YKKHQDELF 374
           HITN       + E +N +L++ LK R  A+T  N  SSRSH++F I L  Y     E  
Sbjct: 532 HITNITVCKLTSREMVNRMLRRALKMRSTAATVANSRSSRSHSVFIIKLDGYNTISGEK- 590

Query: 375 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL--VDKSG-HIPFRE 431
               +NLVDLAGSE I+      +R +E  +IN+SL  LG VI+AL   D S  HIPFR 
Sbjct: 591 STGTLNLVDLAGSERIHSLQPQAERLRETQNINKSLSCLGDVIHALGSADASKRHIPFRN 650

Query: 432 SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
           SKLT LLQ SL G++KT +   +SP   +  ET ++L +A+K  + K
Sbjct: 651 SKLTYLLQYSLMGDSKTLMFVNVSPCANSMLETLNSLRFAAKVNSTK 697

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 76/159 (47%), Gaps = 23/159 (14%)

Query: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAK--RYT 90
           +EL   + V CR R   E    SS  + +   +       + TG   IT + ++K  ++T
Sbjct: 358 QELRGNIRVFCRLRPALENENYSSSSIEIEKFS-------DETGMQSITIKRDSKQHKFT 410

Query: 91  VDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELS 150
            D+ F    +   +F E+ G L Q  + GYN  +  YG T +GKT+TM          L+
Sbjct: 411 FDRCFSAQETNGDVFSEI-GQLIQSSLDGYNVCIFAYGQTGSGKTFTM----------LN 459

Query: 151 DAAGIIPRVLLKLFDTLE-LQQNDYV--VKCSFIELYNE 186
              GIIP  L  +F  +E L++  +V  +   F+E+YNE
Sbjct: 460 PNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNE 498

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score =  100 bits (248), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 101/353 (28%), Positives = 168/353 (47%), Gaps = 43/353 (12%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITL-YKK 368
           +D   G+ +  L E  +  + + +  +  G  +R+   T  N  SSRSH I  I L    
Sbjct: 267 DDSKYGVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTD 326

Query: 369 HQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-------- 420
            +  L   S ++L DLAGSE   R+ A  +R KE   IN+SLL LG VI+ L        
Sbjct: 327 LKSGLETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNM 383

Query: 421 -VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI-- 477
            V    HIP+R+SKLTR+LQ +L G+     I T+     +S ET +T+ +AS+AKNI  
Sbjct: 384 GVGGGHHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNISL 443

Query: 478 ---KNKPQLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK 534
              +N+  + +   KD +++N+  +L +    +   KS  G   + D   + ++     +
Sbjct: 444 VVKRNEMDISN--EKDHIIENLRRQLEQQNETIAVLKSNNGTCRTTDAGASEDALSLQSE 501

Query: 535 NEVQECKRE-IESLTSKNALLVKDK----------------LKSKETIQSQNCQIESLKT 577
           N+V + + E  E L  K++++++D+                L+SK  IQ    Q+   K 
Sbjct: 502 NKVLKLRLEHCEKLLDKDSMILQDQELVEIVDMLPPDVSTVLESK--IQGIESQLREHKA 559

Query: 578 TIDHLRAQLDK-QHKTEIEISDFNNKLQKLTEVMQMALHDYKKRELDLNQKFE 629
              HL  QL   QH  ++     +++     +V  M LH+ +   ++L +  E
Sbjct: 560 YAAHLEHQLQNLQH--QVTGQSISSRFAAEVDVDAM-LHEQEAELMELRKSLE 609

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           ++ D VF P      +++E A P+ +   +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSGT------- 199

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEE 187
            S+  G+IP  +  +F  +    L    + VK S++E+YNE+
Sbjct: 200 -SNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEK 240

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 101/194 (52%), Gaps = 29/194 (14%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L +     + E L+ + KG K+R+ + T+ N  SSRSH I  I L  K 
Sbjct: 263 DDSECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKD 322

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVIN---------- 418
            +     I  ++L DLAGSE   R    N+R KE   IN+SLL LG VI+          
Sbjct: 323 IRTGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSH 379

Query: 419 ----------ALVDKSG-----HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 463
                     +L   +G     HIP+R+SKLTRLLQ +L G++    + TI  A  +S E
Sbjct: 380 HTGRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSE 439

Query: 464 TCSTLEYASKAKNI 477
           T +TL +AS++KN+
Sbjct: 440 TLNTLRFASRSKNV 453

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 63/128 (49%), Gaps = 23/128 (17%)

Query: 64  ITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCT 123
           I G K IS N  GD           +T D VF  G S   I+ +   PL    I+GYN T
Sbjct: 119 IHGDKVISHNDIGD-----------FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNAT 167

Query: 124 VLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQN----DYVVKCS 179
           +  YGMT +GKT+TM+G E        +  G+IP  +  LF +L  + N       V  S
Sbjct: 168 IFAYGMTGSGKTFTMSGTE--------EEKGLIPLSVSYLFSSLLEKTNTENEKSEVWVS 219

Query: 180 FIELYNEE 187
           ++E+YNE+
Sbjct: 220 YLEIYNEK 227

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 107/371 (28%), Positives = 175/371 (47%), Gaps = 56/371 (15%)

Query: 304 RSSMAP------NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRS 357
           RSS  P      +D   G+ I  L E    ++ E    +Q G K+R+ + T  N  SSRS
Sbjct: 233 RSSGGPVELRIRDDLKYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETIYNTRSSRS 292

Query: 358 HTIFTITLYKKHQDELFRISK-MNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRV 416
           H I  + L          +S  ++L DLAGSE   ++ +  +R KE   IN+SLL LG V
Sbjct: 293 HAIVLVRLNNTDLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINKSLLALGTV 349

Query: 417 INAL------------------VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAK 458
           I+ L                   + + HIP+R+SKLTR+LQ +L GN+    I TI    
Sbjct: 350 ISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITTICTIDTRN 409

Query: 459 VTSEETCSTLEYASKAKN----IKNKPQL--GSFIMKDILVKNITMELAKIKSDLLSTKS 512
             + ET +T+ +AS+AKN    +  +P +  GS+  KD  ++N+T +L K    ++  K 
Sbjct: 410 EAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQHQLVMRLKQ 469

Query: 513 KEGIYMSQ---DHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQN 569
           +  +  S    D   + NS L   +N V +CK           L   +KL  K+TI+ ++
Sbjct: 470 RTSMTSSSHNDDSTVDPNSTLLKAENRVLKCK-----------LSNCEKLLDKDTIELED 518

Query: 570 CQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEV---MQMALHDYKKRELDLNQ 626
            ++ ++   ID L   +D     E +     ++L++  E    ++  L ++ +RE    +
Sbjct: 519 SEMVAI---IDML--PIDVGSVLETKFQGLESQLRQYKEYTKQLEFKLMNFDRRENVSAE 573

Query: 627 KFEMHITKEIK 637
            F  H+   I+
Sbjct: 574 PFTAHVNSVIQ 584

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 58/106 (54%), Gaps = 14/106 (13%)

Query: 86  AKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLY 145
           A  +T D+VF    +   I++  + P+    ++G+N TV  YGMT +GKT+TMTG E   
Sbjct: 109 AGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTGTE--- 165

Query: 146 NGELSDAAGIIPRVLLKLFDTLELQQ-----NDYVVKCSFIELYNE 186
                D AG+IP  +  LF  + L+      + Y V  S++E+YNE
Sbjct: 166 -----DEAGLIPLSVTYLFSKI-LEHSMRGTSKYEVVVSYLEIYNE 205

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 100/188 (53%), Gaps = 23/188 (12%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   GI +  L E   ++  + +  ++ G K+++++ T+ N  SSRSH+I  + L    
Sbjct: 243 DDAQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSRSSRSHSILLVRLIATD 302

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 424
            +  +   S ++L DLAGSE   ++ +  +R KE   IN+SLL LG VI  L  +S    
Sbjct: 303 LETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLALGTVIAKLSSESNQHR 359

Query: 425 ---------------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 469
                           HIP+R+SKLTR+LQ +L GN+    I T+      S ET +TL 
Sbjct: 360 NADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICTVDIRSDASSETLNTLR 419

Query: 470 YASKAKNI 477
           +AS+AKN+
Sbjct: 420 FASRAKNV 427

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 12/110 (10%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   + +D++F    S   I+ E+  PL      GYN T+  YGMT +GKT+TM+G 
Sbjct: 102 AHDDVGEFRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGT 161

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLE----LQQNDYVVKCSFIELYNEE 187
           +        +  G+IP  +  LF+T+     L +  Y +  S++E+YNE+
Sbjct: 162 Q--------EDTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEK 203

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 111/211 (52%), Gaps = 27/211 (12%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 367
           +D   G+ + +L E  +++  + +  +  G ++R+   T  N  SSRSH I  + L +  
Sbjct: 269 DDSKYGVKVVDLTEQLVSSHEDVMKWIATGDRNRKTGETDFNTRSSRSHAIVLLRLTRYD 328

Query: 368 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALV--- 421
            K   E    S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 329 LKTGSEA--TSTLSLCDLAGSER-----AVTQIVRRKEGAFINKSLLALGTVIAKLSMLG 381

Query: 422 ---------DKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 472
                      +GHIP+R+SKLTR+LQ +L G++    I TI     +S ET +T+ +AS
Sbjct: 382 SQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTIDSKAESSTETTNTVRFAS 441

Query: 473 KAKNIK---NKPQLGSFIMKDILVKNITMEL 500
           +AKNI     K ++ S   KD +++N+  +L
Sbjct: 442 RAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 12/103 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF  G     ++  +  P+     +GYN T+  YGMT +GKT+TM+G+++     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNEE 187
                G+IP+ +  +FD +  + +     Y VK S++E+YNE+
Sbjct: 201 ---EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEK 240

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 98/188 (52%), Gaps = 26/188 (13%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D  +G+ +  L E  + ++ + L  ++ G  +R+   T  N  SSRSH I TI   K  
Sbjct: 269 DDARHGVRVVGLTEQQVHSSEDVLRKIELGNSNRRTGETDYNTRSSRSHAIVTI---KVT 325

Query: 370 QDELFR----ISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSG 425
             EL       S ++L DLAGSE   R+   ++R KE   IN+SLL LG VI+ L   SG
Sbjct: 326 CTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFINKSLLALGTVISKLSAVSG 382

Query: 426 ----------------HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLE 469
                           H+P+R+SKLTR+LQ +L G++    I TI        ET +T+ 
Sbjct: 383 ASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTTICTIDTKPDAMSETVNTIR 442

Query: 470 YASKAKNI 477
           +AS+AKN+
Sbjct: 443 FASRAKNV 450

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 11/102 (10%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF P  +   +++E+  P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSGTR------ 193

Query: 149 LSDAAGIIPRVLLKLFDTL---ELQQNDYVVKCSFIELYNEE 187
             D AG+I   + ++F  +    +    Y V+ S++E+YNE+
Sbjct: 194 --DEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEK 233

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 98/200 (49%), Gaps = 35/200 (17%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L   +
Sbjct: 297 DDSQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTN 356

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 423
            ++   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VKNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSV 413

Query: 424 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 457
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 458 KVTSEETCSTLEYASKAKNI 477
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 12/102 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNE 186
           L    G+IP  +  LF + +E   N    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNE 256

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/215 (33%), Positives = 110/215 (51%), Gaps = 31/215 (14%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK-- 367
           +D   G+ + +L E  + +  E +  +  G K+R+   T  N  SSRSH I  + L +  
Sbjct: 270 DDSKYGVKVVDLTEQQVESHGEVIKWIAAGDKNRKTGETDFNSRSSRSHAIVLLRLTRCE 329

Query: 368 -KHQDELFRISKMNLVDLAGSENINRSGALNQ--RAKEAGSINQSLLTLGRVINALVDK- 423
            K   E+   S ++L DLAGSE      A+ Q  R KE   IN+SLL LG VI  L    
Sbjct: 330 LKTGTEV--TSTLSLCDLAGSER-----AVTQLVRRKEGAFINKSLLALGTVIAKLSANS 382

Query: 424 ---------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 468
                           GHIP+R+SKLTR+LQ +L G++    I TI     ++ ET +T+
Sbjct: 383 AGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITTICTIDSKSESNSETTNTV 442

Query: 469 EYASKAKNIK---NKPQLGSFIMKDILVKNITMEL 500
            +AS+AKNI     K ++ +   KD +++N+  +L
Sbjct: 443 RFASRAKNISLNVRKNEMDTSNEKDSIIQNLRKQL 477

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 55/104 (52%), Gaps = 13/104 (12%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++  +  P+     +GYN T+  YGMT +GKT+TM+G ++     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 149 LSDAAGIIPRVLLKLFD-----TLELQQNDYVVKCSFIELYNEE 187
                G+IP  +  +FD     T +  ++ Y VK S++E+YNE+
Sbjct: 200 ---DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEK 240

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 97/206 (47%), Gaps = 41/206 (19%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E    ++ + L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 423
            +D   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTNSV 413

Query: 424 --------------------------------SGHIPFRESKLTRLLQDSLGGNTKTALI 451
                                           S HIP+R+SKLTRLLQ +L G++    I
Sbjct: 414 GSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQPALSGDSIVTTI 473

Query: 452 ATISPAKVTSEETCSTLEYASKAKNI 477
            T+      + ET +TL +AS+AKN+
Sbjct: 474 CTVDTRNDAAAETMNTLRFASRAKNV 499

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (55%), Gaps = 12/102 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   ++++ + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNE 186
           L    G+IP  +  LF + +E   N    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNE 256

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 95/200 (47%), Gaps = 35/200 (17%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E    +  E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDSKYGVKVIGLTERRCESTEELLRWIGIGDKSRKIGETDYNTRSSRSHAIVLIRLTSTD 356

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDK---- 423
             +   R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L  DK    
Sbjct: 357 VNNGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKTTSV 413

Query: 424 --------------------------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPA 457
                                     S HIP+R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 DSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 458 KVTSEETCSTLEYASKAKNI 477
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETMNTLRFASRAKNV 493

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++    P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLFDTLELQQND----YVVKCSFIELYNE 186
           L    G+IP  +  LF  +  Q  D    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNE 256

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 106/199 (53%), Gaps = 28/199 (14%)

Query: 316 IYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DELF 374
           I I+NL+  ++T+ +E L+  +KG   R +AS       SRS  I  IT+ ++    E+F
Sbjct: 189 ISIKNLRCVYVTSLLEALSYCEKG---RSLAS-------SRSSVIIRITVEQRDNVKEVF 238

Query: 375 RISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD----------KS 424
           +     LVDL  S+ I++   L    +    INQS++TL  V  +L            +S
Sbjct: 239 KTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNGRPRS 298

Query: 425 G--HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 478
           G  +IP++ES LT+LLQ+++GGN KT L+   S AK   EET +TL + +  K +K    
Sbjct: 299 GNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQDEEETLNTLNFGANMKLVKNLFQ 358

Query: 479 -NKPQLGSFIMKDILVKNI 496
            NK    S  M D+L+K+ 
Sbjct: 359 QNKAGTNSKAMLDLLMKDF 377

 Score = 58.9 bits (141), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 48/105 (45%), Gaps = 11/105 (10%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  N K + VD++F PGA        + G        GYN  ++ YG T +GKT TM G 
Sbjct: 64  AGQNLKLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFNGYNVAIMAYGQTDSGKTSTMFG- 122

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIEL 183
              YN       G+I  V  ++F T+E       DY +  S IE+
Sbjct: 123 ---YN----KGDGVINGVCKQIFTTVETGSENNIDYSISLSIIEV 160

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 14/151 (9%)

Query: 333 LNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRISK-MNLVDLAGSENIN 391
           L L+ +G ++R+V ST+ N  SSRSH +  + +     D +   ++ + L DLAGSE   
Sbjct: 241 LELVAQGNRNRRVRSTQHNTGSSRSHAVLRLRI----TDSMGSKARVLTLCDLAGSER-- 294

Query: 392 RSGALNQRA--KEAGSINQSLLTLG---RVINALVDKSGHIPFRESKLTRLLQDSLGGNT 446
              +++ R    E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN 
Sbjct: 295 --ASVHDRGLRAEGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNG 352

Query: 447 KTALIATISPAKVTSEETCSTLEYASKAKNI 477
              ++ T+S +    E++  TL +A +A  +
Sbjct: 353 LVTMVCTVSLSGTDYEQSLGTLRFARRASGV 383

 Score = 39.3 bits (90), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 40/87 (45%), Gaps = 18/87 (20%)

Query: 104 IFDEVAGPLFQ----DFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRV 159
           IF     PL      D I G   T++ YG T +GKTYTM G         + A G I  V
Sbjct: 122 IFVRDCKPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---------TKAEGGI--V 167

Query: 160 LLKLFDTLELQQNDYVVKCSFIELYNE 186
            L + D L     +  +  S++E+YNE
Sbjct: 168 QLSIRDLLTQLSKNCQITISYLEIYNE 194

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/184 (34%), Positives = 92/184 (50%), Gaps = 19/184 (10%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  + E     A E +  +  G   R+   T  N  SSRSH I  + L   +
Sbjct: 237 DDPVLGVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTN 296

Query: 370 Q-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS---- 424
             +     + ++L DLAGSE   ++    +R KE   IN+SLL LG VI+ L  +S    
Sbjct: 297 LLNGTTHFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHD 353

Query: 425 -----------GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASK 473
                       HIP+R+SKLTRLLQ +L  ++    I TI P K    ET +TL +AS+
Sbjct: 354 SSRPSSGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASR 413

Query: 474 AKNI 477
           AKN+
Sbjct: 414 AKNV 417

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141
           A  +   +  D VFGP A+ + +F E+ G L +    G N T+L YG T +GKTYTM G 
Sbjct: 120 AHWDQGDFQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVG- 178

Query: 142 EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEE 187
              +N  +    G    V  ++ +  + +Q    V  S++E+YNE+
Sbjct: 179 ---HNDGIVKMCGDC--VFTRMLNAADERQVKRSVTVSYLEIYNEK 219

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/144 (39%), Positives = 83/144 (57%), Gaps = 5/144 (3%)

Query: 335 LLQKGLKHRQVASTKMNDFSSRSHTIFT--ITLYKKHQDELFRISKMNLVDLAGSENINR 392
           L++ G   R   ST MN+ SSRSH++F   IT + +   E     ++NLVDLAGSE + +
Sbjct: 527 LIRNGNNTRNTKSTHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQ 585

Query: 393 SGALNQRA--KEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTAL 450
              +  +   KE  SIN+SL  L  VI+++  +  +IPFR SKLT LL++SL   +KT +
Sbjct: 586 QEQITSQETLKETTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLM 645

Query: 451 IATISPAKVTSEETCSTLEYASKA 474
              ISP   +  ET ++L  A K 
Sbjct: 646 YVNISPNINSIRETINSLRLARKV 669

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 50/101 (49%), Gaps = 14/101 (13%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +T DK+FG       +FD++   L Q  + GYN  +  YG T +GKTYTM          
Sbjct: 384 FTFDKIFGMQDDNYEVFDDIKN-LVQSSLDGYNVCIFTYGQTGSGKTYTM---------- 432

Query: 149 LSDAAGIIPRV---LLKLFDTLELQQNDYVVKCSFIELYNE 186
           L++  GII +    ++     L     +Y ++  FIE+YNE
Sbjct: 433 LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNE 473

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 95/200 (47%), Gaps = 35/200 (17%)

Query: 310 NDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKH 369
           +D   G+ +  L E    ++ E L  +  G K R++  T  N  SSRSH I  I L    
Sbjct: 297 DDTQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTD 356

Query: 370 -QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL----VDKS 424
            +    R S ++L DLAGSE   R+    +R KE   IN+SLL LG VI+ L    ++ +
Sbjct: 357 LESGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPT 413

Query: 425 GH----IP-----------------------FRESKLTRLLQDSLGGNTKTALIATISPA 457
           G      P                       +R+SKLTRLLQ +L G++    I T+   
Sbjct: 414 GSNIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTR 473

Query: 458 KVTSEETCSTLEYASKAKNI 477
              + ET +TL +AS+AKN+
Sbjct: 474 NDAAAETINTLRFASRAKNV 493

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 12/102 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  D VF    +   +++  + P+    + G+N T+  YGMT +GKT+TM+G+E+    E
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----E 218

Query: 149 LSDAAGIIPRVLLKLF-DTLELQQND---YVVKCSFIELYNE 186
           L    G+IP  +  LF + +EL  N    + V  S++E+YNE
Sbjct: 219 L----GLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNE 256

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 108/214 (50%), Gaps = 20/214 (9%)

Query: 310 NDQT---NGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLY 366
           ND T   NG  ++NL+   +    E   L+   L +++    + N+   RSHTI  +++ 
Sbjct: 184 NDSTYAMNGFQVENLRTTQVLTLEELKILINICLLNQK---ERHNNLIQRSHTIMEVSIE 240

Query: 367 KKHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALV--DK 423
           K+++ DE   +S + +VDLAGS+ I ++ +     ++A  IN  + ++  VIN LV  ++
Sbjct: 241 KRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQIKSVNDVINGLVVMNR 300

Query: 424 SGHI-----------PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYAS 472
            G I           P++ S LTRLL D LGGN KT  + T S  K    ET STL++  
Sbjct: 301 EGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSLKKNDWNETLSTLKFGY 360

Query: 473 KAKNIKNKPQLGSFIMKDILVKNITMELAKIKSD 506
             K+    P++  F +      +I +   K+K D
Sbjct: 361 NCKSANTNPRINRFGLNSKATMDIFLTDMKLKED 394

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (51%), Gaps = 37/135 (27%)

Query: 71  SINTTGDTGITA----QMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFI--------K 118
           SIN T DT +T     Q+   +Y  DKVF   AS D       G   Q+FI        +
Sbjct: 52  SINFT-DTQLTGFSKDQVVNTQYKFDKVF---ASND------TGVEHQEFIESNLESLLQ 101

Query: 119 GYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL--ELQQND--- 173
           GYN +++ YG + TGK++ + G+++          G+I ++L KLF+ +  E+  N+   
Sbjct: 102 GYNTSIVTYGQSGTGKSFELYGEQQ---------DGLIFQLLTKLFNRIDEEMGNNNKNI 152

Query: 174 -YVVKCSFIELYNEE 187
            Y VK SF+E+Y E+
Sbjct: 153 HYTVKFSFLEVYQEK 167

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/182 (32%), Positives = 85/182 (46%), Gaps = 24/182 (13%)

Query: 15  NSISK-NGNSQVGCHTVPNEE-LNITVAVRC---RGRNEREISMKSSVVVNVPDITGSKE 69
           N ISK    S V   T+ N E  +I V +R    +G    E + K+S   N      S  
Sbjct: 4   NLISKEQAASSVPLPTIDNSEPCHIDVLLRAIPEKGLPNDESTFKASSSDNTVLFRTSNG 63

Query: 70  ISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 129
              NTTGDT  T Q        DKVF   A+Q  + D +  P   D + GYN T+L YG 
Sbjct: 64  PLQNTTGDTHSTFQF-------DKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGP 116

Query: 130 TSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQQ----NDYVVKCSFIELYN 185
           + +GK+Y++ G +        D  GI+P +   LF TLE ++    N++ V     E+Y 
Sbjct: 117 SFSGKSYSLIGPQ--------DGGGILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYM 168

Query: 186 EE 187
           E+
Sbjct: 169 EK 170

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 77/139 (55%), Gaps = 17/139 (12%)

Query: 355 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 411
           SRSH +F + + ++++  ++ + S + L+DL G+E  ++     L+Q + +   +NQS+ 
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKK--LNQSIE 291

Query: 412 TLGRVINAL---------VDKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 461
            L   + +L           K+ H   +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 292 ALKNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 351

Query: 462 EETCSTLEYASKAKNIKNK 480
             T STL++    + I N+
Sbjct: 352 --TLSTLKFGDSIRQINNR 368

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 77/162 (47%), Gaps = 29/162 (17%)

Query: 33  EELNITVAVRCRGR----NEREISMKSSVVVN-VPDITGSKEISINTTGDTGITAQMNAK 87
           +EL   + V CR R    NE+E S  SS+ ++   D  G++ I+I          +    
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDS--SSISIDGFSDENGTQCITIKR--------EAKYH 406

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++T D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 407 KFTFDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM--------- 456

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNE 186
            L+   GIIP  L  +F  +E  +     Y +   FIE+YNE
Sbjct: 457 -LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITL 365
           +I N+    +TN     ++L + +K R  A+T  N  SSRSH++F I L
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 71.6 bits (174), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 106/215 (49%), Gaps = 16/215 (7%)

Query: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQ-DEL 373
           G+ + NL++ H+ +  E L    + +    V ++K ++   R++TIF I + K  + DE 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAM---SVLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 374 FRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKS--------- 424
              S + LVDLAGS+ I+R  +    +++   IN S+ ++  +I +L   S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 425 ---GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKP 481
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 482 QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGI 516
           Q+  F + +    +I +E  K+K +    +  E +
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESV 419

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 49/97 (50%), Gaps = 12/97 (12%)

Query: 94  VFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAA 153
           +F   ++ DLI + +   +  + ++GYN  ++ YG   +GKTY+      LY  ++ D+ 
Sbjct: 89  IFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYS------LYGNDVDDSF 142

Query: 154 GIIPRVLLKLFDTLELQQND------YVVKCSFIELY 184
           G+   +   LF  +     D      ++VK SF+E++
Sbjct: 143 GLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVW 179

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 71.2 bits (173), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 77/162 (47%), Gaps = 29/162 (17%)

Query: 33  EELNITVAVRCRGR----NEREISMKSSVVVN-VPDITGSKEISINTTGDTGITAQMNAK 87
           +EL   + V CR R    NE+E S  SS+ ++   D  G++ I+I          +    
Sbjct: 357 QELRGNIRVFCRLRPHLDNEKEDS--SSISIDGFSDENGTQCITIKR--------EAKYH 406

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++T D+ FG   S   IF E+ G L Q  + GYN  +  YG T +GKTYTM         
Sbjct: 407 KFTFDRCFGAQESNKDIFHEI-GQLIQSSLDGYNVCIFAYGQTGSGKTYTM--------- 456

Query: 148 ELSDAAGIIPRVLLKLFDTLELQQN---DYVVKCSFIELYNE 186
            L+   GIIP  L  +F  +E  +     Y +   FIE+YNE
Sbjct: 457 -LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNE 497

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%)

Query: 317 YIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITL 365
           +I N+    +TN     ++L + +K R  A+T  N  SSRSH++F I L
Sbjct: 531 HITNITVCKLTNREMVNSILVRAMKMRSTAATSANARSSRSHSVFIIKL 579

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 63/124 (50%), Gaps = 19/124 (15%)

Query: 67  SKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLV 126
           + E S  TTGDT  T       +  DKVF   A+Q+ + D +  P   D + GYN T++ 
Sbjct: 60  TSEPSHETTGDTYST-------FKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIIT 112

Query: 127 YGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIE 182
           YG + +GK+Y++ G +        +  GI+P +   LF+TL    E + N++ V     E
Sbjct: 113 YGPSFSGKSYSLLGSQ--------EGEGILPNICKVLFETLEKNKETKGNNFSVSVLAFE 164

Query: 183 LYNE 186
           ++ E
Sbjct: 165 IFME 168

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 74/137 (54%), Gaps = 13/137 (9%)

Query: 355 SRSHTIFTITLYKKHQD-ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTL 413
           S+SH +F + + +++++ ++ R S + L+DL G+E  ++   +         +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 414 GRVINAL----------VDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEE 463
             ++  L          V  S    +RES+LT +L+DSLGGN KT +I T   + V++  
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 464 TCSTLEYASKAKNIKNK 480
           T STLE+    + I NK
Sbjct: 351 TLSTLEFGECIRQITNK 367

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/220 (30%), Positives = 114/220 (51%), Gaps = 34/220 (15%)

Query: 355 SRSHTIFTITLYKKHQ-DELFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 411
           SRSH +F + + ++++ D++ + S + LVDL G+E  ++     L+Q A     +NQS+ 
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDA--LKKLNQSIE 290

Query: 412 TLGRVINALVDK----------SGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTS 461
            L   + +L  K          S    +RES+LT +L+DSLGGN KT +I T   + V +
Sbjct: 291 ALKNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT 350

Query: 462 EETCSTLEYASKAKNIKN-----------KPQLGSFIMKDILVK--NITMELAKIKSDLL 508
             T STLE+    + I N           K ++  FI +D+ +K  N   ++  +K+++ 
Sbjct: 351 --TLSTLEFGDSIRQINNKVTDNTTGLNLKKKMDLFI-QDMKIKDDNYVAQINILKAEID 407

Query: 509 STKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLT 548
           S KS     + +D  K +   LE+ K E  + K +++S+T
Sbjct: 408 SLKSLHNKSLPEDDEKKM---LENTKKENIKLKLQLDSIT 444

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (52%), Gaps = 12/102 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  DKVF   A+Q+ +   +  P+  D + GYN TV+ YG + +GK+Y++ G +      
Sbjct: 75  FQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSK------ 128

Query: 149 LSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNE 186
             ++ GI+P +   LFDTL    E + + + V     E+Y E
Sbjct: 129 --ESEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYME 168

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 58/118 (49%), Gaps = 19/118 (16%)

Query: 73  NTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTST 132
           N TG    T Q        DKVF   A+Q  + D +  P  +D + GYN T+L YG + +
Sbjct: 66  NATGSPHSTFQF-------DKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFS 118

Query: 133 GKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNE 186
           GK+Y++ G +  YN       G++P +   LF+TL    E +  ++ V     E+Y E
Sbjct: 119 GKSYSLLGSQ--YN------EGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYME 168

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 113/219 (51%), Gaps = 32/219 (14%)

Query: 355 SRSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSENINR--SGALNQRAKEAGSINQSLL 411
           S+SH +F + + ++++ E + + S + L+DL G+E   +     L+Q A +   +NQS+ 
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKK--LNQSIE 290

Query: 412 TLGRVI---------NALVDKSGHIP-FRESKLTRLLQDSLGGNTKTALIATISPAKVTS 461
            L  ++         +A   K+ H   +RES+LT +L+DSLGGN K  +I T   + V +
Sbjct: 291 ALKNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT 350

Query: 462 EETCSTLEYASKAKNIKNKPQLGS----------FIMKDILVK--NITMELAKIKSDLLS 509
             T STLE+    + I NK    +            ++D+ +K  N   ++  +KS+L S
Sbjct: 351 --TISTLEFGDNIRQIINKVMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQINILKSELDS 408

Query: 510 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLT 548
            K       S++  K   ++LE+Y+ E  + K +++S+T
Sbjct: 409 LKDLSNESSSREDMK---TELENYEKENVKLKLQLDSIT 444

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 125/252 (49%), Gaps = 31/252 (12%)

Query: 312 QTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQD 371
             +G +I++L + H+T+ +E  + L+ G K+     + ++   S+    F +    + +D
Sbjct: 193 HVHGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKSQIFVRFEVQCIDR-KD 247

Query: 372 ELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK----SGHI 427
           ++ R S +  +DL GS+ + +  A    + +    NQ +  L  +I  L ++    S H 
Sbjct: 248 DVTRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQNLIKTLPEEQSTNSSH- 306

Query: 428 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFI 487
            F++S L ++L D LGG+TK  L+  I       E+    ++  +KAK IKN P +    
Sbjct: 307 -FKDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLGAKAKLIKNYPTMNKIG 362

Query: 488 MK-----DILVKNITME----LAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQ 538
           +      D+LV+++ ++    LAKI  +LL T+ K    +  ++    NS   S +N +Q
Sbjct: 363 LNAKRKMDLLVQDMNVKEQNYLAKI--NLLQTEIKT---LKTENDSTTNSTSNSLENALQ 417

Query: 539 E---CKREIESL 547
           E    K ++ESL
Sbjct: 418 ENSKLKLQLESL 429

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 32/61 (52%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           Y  D +F   + +   +D +   L  D  KGYN T++ YG TS+GK++ + GD    N  
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 149 L 149
           L
Sbjct: 146 L 146

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/176 (28%), Positives = 89/176 (50%), Gaps = 20/176 (11%)

Query: 307 MAPNDQTN--GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTIT 364
           + PN + N   + I+NL++ ++ +  E  + L +G  +R      M   +SRS+ +  I 
Sbjct: 226 IRPNFKKNNSSLEIENLRQVYVESFEELNSYLIEGRSNRN-----MKHLTSRSNIVIKIN 280

Query: 365 LYKKH-QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDK 423
           L +   +D+L + S + L+D+A S+ I+++ +L   AKEA  +N  + +    IN L + 
Sbjct: 281 LEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPMESFTSYINLLAE- 339

Query: 424 SGHIPFRE-----------SKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 468
           +G  P+ +           S L  ++   +GGN KT  I+TISP      ET  TL
Sbjct: 340 TGTSPYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLANQNETFITL 395

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 43/82 (52%), Gaps = 11/82 (13%)

Query: 65  TGSKEI-SINTTGDTGITAQMNAKRYTVDKVFGPGASQ-DLIFDEVAGPLFQDFIKGYNC 122
           TG++ I +  TTG+T          + VDKVF     Q DL+  ++      +   G+N 
Sbjct: 35  TGTRIIFTSETTGNT---------EFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNS 85

Query: 123 TVLVYGMTSTGKTYTMTGDEKL 144
           +++ +G + TGK++TM G+  L
Sbjct: 86  SIIAFGQSGTGKSFTMFGNNSL 107

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 34/278 (12%)

Query: 308 APNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 367
           + + +T+ + ++ L+   + +  E L  + +G  H +   +  +   SRS     IT+ +
Sbjct: 179 SSDTKTHTLSVKGLRTVSVNSVYELLAYINEG--HLRRCHSDSHYRKSRSSAFLNITVEQ 236

Query: 368 KHQ-DELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD---- 422
           +++ +E  + S + L+DLA S+ ++++   +    E  S N S+  L +V+  L +    
Sbjct: 237 RNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNLHQVVYGLSELESP 296

Query: 423 ----KSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK 478
                S     R S+L + LQ ++GG++KT  +   S  K   E T  TL   S+ ++I 
Sbjct: 297 SSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTVITLSLGSRLRSIH 356

Query: 479 NKP-----QLGSFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESY 533
           N P      L S  + D+ +KN++      + D   T+ K   Y+ +D    L   ++  
Sbjct: 357 NFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK---YL-EDEVSKLGGTIQQN 407

Query: 534 KNEVQECKREIESLTSKNALLVKDKL----KSKETIQS 567
           KN+V   K    SLT KN  L+ D+L    KS++T +S
Sbjct: 408 KNQVSTNK----SLTEKNMKLM-DQLELYRKSQQTQKS 440

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 52/103 (50%), Gaps = 12/103 (11%)

Query: 88  RYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNG 147
           ++  +KV+  G  Q  + +++ G    + + G+N +++ +G   +GKTYTM G++     
Sbjct: 67  KFRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGNDH---- 122

Query: 148 ELSDAAGIIPRVLLKLFDTL----ELQQNDYVVKCSFIELYNE 186
                 GI+ R+   +FD L    E   N+  +  +F EL+ E
Sbjct: 123 ----EEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAE 161

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 76/309 (24%), Positives = 140/309 (45%), Gaps = 62/309 (20%)

Query: 314 NGI----YIQNLQEFHITNAMEGLNLLQKGLK-HRQVASTKMNDFSSRSHTIFTITLYKK 368
           NGI    +++NL    I      L+ LQK  K   Q +S  +N  +++     +I + K 
Sbjct: 198 NGIKGDKHVKNLSHIQIA----SLDDLQKWFKIGCQRSSAIINAGTAKEKRSNSIIISKI 253

Query: 369 H------QDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD 422
           H      +D+L+++S ++ +DL G +   +   +     E   +N  + +   +I  L D
Sbjct: 254 HLEQVNPKDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSD 312

Query: 423 KSGHIPF-----RESKLTRLLQDSLGGNTKTALIATI-SPAKVTSEETCSTLEYASKAKN 476
               +P+     ++S L ++LQD +GGN+KT  I    SP+ +  EE    L++A   K+
Sbjct: 313 PKS-LPYTSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKS 371

Query: 477 IKNKPQLGSF---IMKDILV---------KNITMELAKIKSDLLSTKSKEGIYMSQDHYK 524
           IKN   +  F   + K +L+         +N   ++  ++S+ L+ K+K    ++ DH++
Sbjct: 372 IKNPLIMNVFGLNLQKQMLLFIKSSKLREENCQTKINYLQSE-LALKNKLLEPVATDHHE 430

Query: 525 NLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRA 584
                 E+Y +E   C                     KETI     +IESL+  ++H+  
Sbjct: 431 ------ENYNDE-SSC-------------------SDKETIMKLKLKIESLEQVLEHIST 464

Query: 585 QLDKQHKTE 593
             + + KTE
Sbjct: 465 SENPKSKTE 473

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/82 (19%), Positives = 43/82 (52%), Gaps = 3/82 (3%)

Query: 57  VVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDF 116
           VV+N+  +  +++ +     +   T +++++ +  D +F   + Q+   + +     +D 
Sbjct: 37  VVLNLSSLKANQQDAFICDSNDKNTLKLDSQDFKFDNIFPTNSEQN---EMLTVSTIKDL 93

Query: 117 IKGYNCTVLVYGMTSTGKTYTM 138
             GYN + + YG +++GK+ T+
Sbjct: 94  FDGYNQSFITYGKSNSGKSDTL 115

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 69/134 (51%), Gaps = 13/134 (9%)

Query: 356 RSHTIFTITLYKKHQDE-LFRISKMNLVDLAGSE--------NINRSGALNQRAKEAGSI 406
           RS TI  I L +  +DE L   S +  VDLAGS+         I R  A ++  +   S+
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAA-SKYNRVMDSL 323

Query: 407 NQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCS 466
           N  + TL    +  ++KS    +R S LTR+L D L GN KT LI + S  K    ET S
Sbjct: 324 NSMVYTLANSESISINKS---IYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFS 380

Query: 467 TLEYASKAKNIKNK 480
           TL ++S A ++ N+
Sbjct: 381 TLGFSSYASSMSNQ 394

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 2/71 (2%)

Query: 70  ISINTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGM 129
           I++N++ + G     N  R+  DK+F P    D I   ++     D  KGYN T + YG 
Sbjct: 41  ITLNSSVNQGSLGGSNQYRF--DKIFEPEKPDDEINSTLSFACINDLFKGYNSTYISYGQ 98

Query: 130 TSTGKTYTMTG 140
           T TGKTYT+ G
Sbjct: 99  TGTGKTYTLYG 109

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (51%), Gaps = 8/102 (7%)

Query: 87  KRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYN 146
           + +++DKVF P ASQ  +   + GP+  +   G N  +   G + TGKT+TM G + +  
Sbjct: 42  RTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGKTHTMLGQQGV-- 99

Query: 147 GELSDAAGIIPRVLLKLFDTLELQQNDYV-VKCSFIELYNEE 187
                + G++ R+L K+F  +   +   V    S +EL N++
Sbjct: 100 -----SQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDK 136

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 90/203 (44%), Gaps = 37/203 (18%)

Query: 315 GIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELF 374
           G+Y Q     +I +  E   +++    +++ +  KM+   S SH +   ++     ++L 
Sbjct: 205 GLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSV-----EQLD 259

Query: 375 RI------SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVD--KSGH 426
           R+      S +   DL GS    +        +    +N S+  L  V+N+++   +  H
Sbjct: 260 RVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNSVLQNQQKNH 319

Query: 427 ------------------IPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTL 468
                             +P+++S+LT L+Q++LGGN++T ++      K   EET +TL
Sbjct: 320 LYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKSHHEETIATL 379

Query: 469 EYASKAKNIKNKPQLGSFIMKDI 491
            +  + +NI N      F+  D+
Sbjct: 380 RFGVQLQNILN------FVRADV 396

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 89  YTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGE 148
           +  +KV+  G     I   ++  + +D   GY+ +++ YG   +GK++T+ G+E      
Sbjct: 87  FNFEKVYDVGVPLVDIHKSLSESVLKDIYDGYDVSIISYGEAGSGKSFTLFGNE------ 140

Query: 149 LSDAAGII 156
             D+ GII
Sbjct: 141 --DSDGII 146

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 137/302 (45%), Gaps = 35/302 (11%)

Query: 312 QTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDF--SSRSHTIFTITLYKKH 369
           Q +  Y ++L    +T+  E +N +     +R   S    ++   S+SH I  I + +++
Sbjct: 174 QDDEYYFKDLHVAFVTSRDELINYIMDAESNRFSGSCLHTNYVQRSKSHLITKINVEQRN 233

Query: 370 QDE-LFRISKMNLVDLAGSENINRSG--ALNQRAKEAGSINQSLLTLGRVINALVDKS-- 424
            +E + +   ++  DLA  + I++    +L   + E   +N    TL   I ++ + S  
Sbjct: 234 LNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLESTTLKNSIISMSELSEN 293

Query: 425 --GHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIK---- 478
               IP++ S LT+LL     GN KT +I T S  K    ET  TL+   K ++I     
Sbjct: 294 PNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLETLKMGLKLESISSNVH 353

Query: 479 -NKPQLGSFIMKDILVKN--------------ITMELAKIKSDLLSTKSKEGIY---MSQ 520
            NK  L S    D++V++              +  EL  +++      S+   +   M++
Sbjct: 354 MNKHALNSKKKLDLIVEDMKSKEANYMNRIRLLETELNDLRASYGEAISETSSFKEEMNK 413

Query: 521 DHYKN--LNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTT 578
           +  KN  L  +LE +K  +Q+ K E +S  SK   L  D+   ++ I+ ++  +  LK T
Sbjct: 414 ERAKNVKLKEELEVFKKLLQK-KGEAQSTHSKEMPLTDDEEIMQQLIE-KSASVAELKAT 471

Query: 579 ID 580
           +D
Sbjct: 472 LD 473

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 42/85 (49%), Gaps = 8/85 (9%)

Query: 104 IFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKL 163
           +++ + G L  +  +GY+  V+ YG   TGK+    G +  Y G      G++   +  L
Sbjct: 75  LYNGIKGDLINNIFEGYHTGVITYGSAGTGKSSIFYGTDSTYEG------GVVLMFVQDL 128

Query: 164 FDTLELQQND--YVVKCSFIELYNE 186
           +D ++   ND  + V  S IE++ E
Sbjct: 129 YDKIDSIGNDTHFTVSLSTIEIHLE 153

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 54/117 (46%), Gaps = 6/117 (5%)

Query: 72  INTTGDTGITAQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTS 131
           + T  DT +  ++  + ++  KV    A++   F E+A  +  D + G NC V  YG   
Sbjct: 75  VQTVNDTVV--KLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGL 132

Query: 132 TGKTYTMTGDEKLYNGELSDA---AGIIPRVLLKLFDTLELQQ-NDYVVKCSFIELY 184
              +  M G +   + E  D+   +G++ +    +F+ ++    ++Y V  S  E+Y
Sbjct: 133 AADSLVMFGPQSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVY 189

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 36.6 bits (83), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 65/153 (42%), Gaps = 30/153 (19%)

Query: 338 KGLKHRQVAS-TKMNDF--------SSRSHTIFTITL--YKKHQDELFRISKMNLVDLAG 386
           KGLK   V+S  ++ D+        +S  HT   I+L     H+D  FR   +  VDL  
Sbjct: 166 KGLKEVFVSSRCELQDYLNAACDLQNSTFHTFVKISLQLVNCHEDS-FRKCCIEFVDLCA 224

Query: 387 SENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHIPFRESKLTRLLQDSLGGNT 446
            E++                 Q + +L  V++   D    I   +S+  +LL +S+GGN 
Sbjct: 225 QEDVL----------------QLVCSLVAVLSN--DNDKKIGKEKSQFCKLLSNSIGGNR 266

Query: 447 KTALIATISPAKVTSEETCSTLEYASKAKNIKN 479
           KT  I   S  +   + +  TLE+  K   + N
Sbjct: 267 KTTFILACSTLEQNEKISLETLEFGLKVSQVVN 299

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 14/64 (21%)

Query: 111 PLFQDFI----KGYNCTVLVYGMTSTGKTYTMTGDEKLYNGELSDAAGIIPRVLLKLFDT 166
           PL  D I    +G +C+++ YG ++TGKT+ +               GIIP  + +L+  
Sbjct: 67  PLVIDNINELTRGVDCSMVTYGQSATGKTHVL----------FDQVRGIIPLFIEQLYIY 116

Query: 167 LELQ 170
           LE Q
Sbjct: 117 LEAQ 120

>NDAI0B05540 Chr2 (1355086..1356843) [1758 bp, 585 aa] {ON}
           Anc_5.416 YDR358W
          Length = 585

 Score = 36.2 bits (82), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 16/105 (15%)

Query: 833 EFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQ-------VEESENAISLLKNNTKFND 885
           + +N M +T     ++ D S+ ++ E  S +KG        +EE  +  +L+++  KFND
Sbjct: 248 DLFNEMMST----SASPDVSNETIEELFSALKGAQPKFQKIIEEEHDDDALVQDLLKFND 303

Query: 886 QFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYNTIENIMKNYG 930
              QL+ K+++LK  I NS  ++  H      I NT  +   N G
Sbjct: 304 TVNQLLEKYSLLK--IGNSSAASQIHPVA---ISNTASDQQTNSG 343

>KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa]
           {ON} Anc_3.93 YOL098C
          Length = 1030

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 20/81 (24%)

Query: 530 LESYKNEVQECKRE----IESLTSKN------------ALLVKDKLKS-KETIQS---QN 569
           LE+Y N + E KRE    ++S+T++N             L V+D LK   + I+    +N
Sbjct: 671 LENYLNSIVELKREGDVMLQSITNRNLFTERSIQKSADPLFVEDTLKQILDDIKDGKFEN 730

Query: 570 CQIESLKTTIDHLRAQLDKQH 590
           C +  L+T   HLR Q DK H
Sbjct: 731 CILPKLETMRSHLRRQFDKFH 751

>TBLA0B02370 Chr2 (552419..554335) [1917 bp, 638 aa] {ON} Anc_3.106
           YOL091W
          Length = 638

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 85/169 (50%), Gaps = 13/169 (7%)

Query: 467 TLEYASKAKNIKNKPQLGSFIMK-DILVKNITMELAKIKSDLLSTKS-KEGIYMSQDHYK 524
           T+EY ++ KN  N  QL   + K    ++++ ME+ K   + L  KS +E  +   D  K
Sbjct: 317 TIEYYNRIKN--NNLQLTQTLDKRKRYLEDLQMEIKKYAKEELKLKSLEEKSFKLTDENK 374

Query: 525 NLNSDLESYKNEVQECKREIESLTSKNALL------VKDKLKSKETIQSQN-CQIESLKT 577
            L  DL+  KN  ++ +     + +K  LL      +K+K  S +  + QN C +E  ++
Sbjct: 375 TLREDLKKLKNIHKDIQNSYTDIVTKYQLLEEKNFNIKNKYASLQEKERQNECNVEKCRS 434

Query: 578 TIDHLRAQLDKQHKTEIEISDFNN-KLQKLTEVMQMALHDYKKRELDLN 625
           +++ +R  +    K+ IEI+  +N KL K  ++ +    D K+  LD+N
Sbjct: 435 SVNSIRINISHIDKS-IEITKRSNMKLVKDKKIERKKFLDIKRELLDMN 482

>Kwal_55.19733 s55 (99488..101518) [2031 bp, 676 aa] {ON} YIL144W
           (TID3) - Product of gene unknown [contig 159] FULL
          Length = 676

 Score = 34.3 bits (77), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 45/83 (54%), Gaps = 2/83 (2%)

Query: 822 DLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESENA-ISLLKNN 880
           DLI D D ++    + +      +K  +DT+SN+M++++S +K Q  E+E+A +SLL   
Sbjct: 399 DLIKDKD-IDMAEVDRLNTEREGLKKALDTTSNNMDQAVSRLKAQKIETESAYMSLLDVG 457

Query: 881 TKFNDQFEQLINKHNMLKDNIKN 903
            ++    E LI     L  ++ N
Sbjct: 458 KQYESSVENLIAARAQLGHHLDN 480

>SAKL0G02024g Chr7 (169807..172356) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P32380 Saccharomyces cerevisiae
           YDR356W SPC110 Inner plaque spindle pole body (SPB)
           component ortholog of human kendrin involved in
           connecting nuclear microtubules to SPB interacts with
           Tub4p-complex and calmodulin phosphorylated by Mps1p in
           cell cycle-dependent manner
          Length = 849

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 87/366 (23%), Positives = 167/366 (45%), Gaps = 62/366 (16%)

Query: 509 STKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKD---KLKSKET- 564
           ST +KE +   QD  + LN    S + E +  K++I +  S++ LL ++   KL  KE  
Sbjct: 445 STSNKEALGSLQDELEKLNDSKRSLERENERLKQQIVNQASRSPLLKENANKKLLEKEKE 504

Query: 565 IQSQNCQIESLKTTIDHLRAQL-DKQHKTEIEISDFNNKLQKL-TEVMQMALHDYKKREL 622
           I+     I  ++  + H + Q+ + + +   E+++F  KLQ L TE +       ++R+L
Sbjct: 505 IRLLQSTIHDIEEEVSHYKRQIQEAKREHSREVAEFEIKLQSLETEPL------IERRKL 558

Query: 623 DLNQKFEMHITKEIKKLKSTLFLQLNTMQQESILQETNIQPNLDMIKNEVLTLMRTMQE- 681
           +          KEI    S L L+L + Q+            L + +N+   L R  Q+ 
Sbjct: 559 E----------KEI----SMLQLELQSAQETK-------NRELALWENKCEALKRENQQL 597

Query: 682 -KAELMYKDCVKKILNESPKFFNVVI--------EKIDIIRV---------DFQKFYKNI 723
            K E  + + + +I+ E  K  N ++        EK+ + R          D+++  K +
Sbjct: 598 SKQEEGHSNNLNRIIAERQKDLNDLVQRCSDLSMEKLQLNRELNELKSSNDDYKQELKKV 657

Query: 724 AENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFVENFKKVLNDH 783
              L  I++E   +K+ +K+   + +++EL  + ++  Y N+++R    +   K +  ++
Sbjct: 658 TSRLDFITKEFVKLKESIKDRATETSNKELSEKWLEK-YHNMKQR---LLAELKSLQTEN 713

Query: 784 LDENKKLIMQNL-----TTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSM 838
           L   KKL+ +N+     TT  S   ++  DL +  R+K+ N     ND   +N  + N +
Sbjct: 714 LSLEKKLLDRNVSSSRPTTTNSNGENRTQDLLDYYRLKYHNEIKQNNDLKVVNG-YLNRV 772

Query: 839 AATLSQ 844
               SQ
Sbjct: 773 LKASSQ 778

>KLLA0D19580g Chr4 (1650584..1652848) [2265 bp, 754 aa] {ON} weakly
           similar to uniprot|Q07732 Saccharomyces cerevisiae
           YDL239C ADY3 Protein required for spore wall formation
           thought to mediate assembly of a Don1p- containing
           structure at the leading edge of the prospore membrane
           via interaction with spindle pole body components
           potentially phosphorylated by Cdc28p
          Length = 754

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 81/155 (52%), Gaps = 15/155 (9%)

Query: 450 LIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFIMKDILVKNITMELAKIKSDLLS 509
           LI ++  AK+ +++T    E+ +K +N+ ++      + K+   K+ T+ + K+K++L S
Sbjct: 267 LINSVDEAKIRAQKTEK--EFQTKIQNLTDE-----LLKKE---KSHTVTVKKLKAELKS 316

Query: 510 TKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESLTSKNALLVKDKLKSKETIQSQ- 568
           TK  +   + +   + L  D+E   N + +  +  +S    N L    KLKS +  Q Q 
Sbjct: 317 TKELQAGLVEKASMQKLQEDMEERLNSLSDVVKSRDSTI--NDLTA--KLKSADAEQEQL 372

Query: 569 NCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKL 603
           + Q+   KT ++ L ++L+ +   E E+SD  +KL
Sbjct: 373 SLQLLESKTLVEQLNSKLESKLTVEAEVSDLKSKL 407

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 51/87 (58%), Gaps = 1/87 (1%)

Query: 558  KLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEIEISDFNNKLQKLTEVMQMALHDY 617
            KL++   +++ N +I++LKTTI+ L+  L+K H++   +      L + +  ++  L+D 
Sbjct: 1005 KLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLNDI 1064

Query: 618  KKRELDLNQKFEMHITKEIKKLKSTLF 644
             + ++ + + FEM +  E++KL S  F
Sbjct: 1065 NE-DIAIFKSFEMEMKNELEKLNSLSF 1090

>YHR108W Chr8 (328303..330060) [1758 bp, 585 aa] {ON}  GGA2Protein
           that interacts with and regulates Arf1p and Arf2p in a
           GTP-dependent manner to facilitate traffic through the
           late Golgi; binds phosphatidylinositol 4-phosphate,
           which plays a role in TGN localization; has homology to
           gamma-adaptin
          Length = 585

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)

Query: 867 VEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH-SHIT 913
           +EE +   +L+++  KFND   QL+ K N+LK+   N+ +  H SH++
Sbjct: 289 IEEEQEDDALVQDLLKFNDTVNQLLEKFNLLKNGDSNAASQIHPSHVS 336

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 18/135 (13%)

Query: 323 EFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKKHQDELFRI------ 376
           E  I +A+E   LL    K+  V S  +N     S T   + L +  Q   F        
Sbjct: 367 EIDIDDAIE---LLGSTFKNLSVRSYAVNRLKKASDTELELYLLQLVQAVCFENISTFSD 423

Query: 377 ---SKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINAL-VDKSGHI--PFR 430
              S+  +VD+ G++++ +S  +  +  E   +N SLLTLG+ IN L +D+   +  P  
Sbjct: 424 KTNSEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLA 480

Query: 431 ESKLTRLLQDSLGGN 445
           E  + R L++S  GN
Sbjct: 481 EFLIRRALKNSRLGN 495

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 16/124 (12%)

Query: 477 IKNKPQLGSFIMKDILVKNITM-ELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYK- 534
           ++NK Q   FI   +   N ++ EL K  +  L  +    + +SQD  + L  DLE  + 
Sbjct: 638 VENKKQNNPFITNPLGTINSSIIELNKANTSQLPIEGTRSVILSQDTVEQLQQDLEELRI 697

Query: 535 ----------NEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRA 584
                     N++++ K EI++L +K+  +V+D  KS  T+   N + + L+   D LR+
Sbjct: 698 MEESNETVSDNKLKQLKMEIDNLRNKD--VVEDTTKS--TLDDLNEKFKRLEQGKDALRS 753

Query: 585 QLDK 588
           ++ K
Sbjct: 754 KMSK 757

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] {ON}
            similar to uniprot|P25386 Saccharomyces cerevisiae
            YDL058W USO1 involved intracellular protein transport
            coiled-coil protein necessary for protein transport from
            ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 54/106 (50%), Gaps = 10/106 (9%)

Query: 535  NEVQECKREIESLTSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLDKQHKTEI 594
            +E QE   ++ SL S    L K   + ++     N ++E LK T+ HL+ Q+D+   +  
Sbjct: 974  SEKQELLEQVSSLNSSYESLSK---RHQDETSDLNVEVEKLKETVSHLKVQVDELKTSRD 1030

Query: 595  EISDFNNKLQKLTEVMQMALH-------DYKKRELDLNQKFEMHIT 633
            +I++  N LQ+  ++ +  +        + +KR ++L Q F++  T
Sbjct: 1031 QITENANNLQEQCKIFEGQIENQEAEKKEAEKRYMELKQNFQVSTT 1076

>Suva_15.304 Chr15 (530683..532446) [1764 bp, 587 aa] {ON} YHR108W
           (REAL)
          Length = 587

 Score = 32.7 bits (73), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 867 VEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTH-SHIT 913
           +EE +   +L+++  KFND   QL+ K N+LK    N+ +  H SH++
Sbjct: 289 IEEEQEDDALVQDILKFNDTVNQLLEKFNLLKSGESNAASQIHPSHVS 336

>TBLA0H01130 Chr8 (253122..253152,253271..255507) [2268 bp, 755 aa]
           {ON} Anc_8.351 YDR164C
          Length = 755

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 32/156 (20%), Positives = 70/156 (44%), Gaps = 25/156 (16%)

Query: 776 FKKVLNDHLDENKKLIMQNLTT-ATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNEF 834
           F+  ++D+  +N+    Q+    AT  + D+ +DLF P          +++D        
Sbjct: 214 FQDAIDDYARKNQDFPPQSTRPRATLIITDRTLDLFSP----------ILHDFT------ 257

Query: 835 YNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESENAISLLKNNTKFNDQFEQLINKH 894
           Y SMA  L    ST++  ++    S    KG +EE  + +  L ++     +++ +++ H
Sbjct: 258 YQSMAYDLV---STINLRNDLYTYSAESEKGDLEEKSSKLMDLYDDIWIELKYQHIMDAH 314

Query: 895 NMLKDNI-----KNSITSTHSHITNVDDIYNTIENI 925
             L+  +     KN +    S++ N  D+ + + ++
Sbjct: 315 EYLQGKVKEIIAKNPLLVDRSNVKNTTDLLSVVAHL 350

>ZYRO0F06424g Chr6 complement(532056..533414) [1359 bp, 452 aa] {ON}
           similar to Q12234 YOR216C uniprot|Q12234 Saccharomyces
           cerevisiae RUD3 Golgi matrix protein that is involved in
           the structural organization of the cis-Golgi
          Length = 452

 Score = 32.3 bits (72), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 2/78 (2%)

Query: 861 SVMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNVDDIYN 920
           S++K  ++E E    L +   +FNDQ  Q   + N LK  ++ S  ST SH+  +D +  
Sbjct: 261 SILKDSLKEME--AELERTEQRFNDQLTQRNIEVNSLKAELERSKESTKSHVDTIDTLRG 318

Query: 921 TIENIMKNYGNKENATKD 938
            +E +      KE   K+
Sbjct: 319 EVERMKDAVEQKEKLEKE 336

>SAKL0F11704g Chr6 (912525..914219) [1695 bp, 564 aa] {ON} similar
           to uniprot|P32891 Saccharomyces cerevisiae YDL174C DLD1
           D-lactate dehydrogenase oxidizes D-lactate to pyruvate
           transcription is heme-dependent repressed by glucose and
           derepressed in ethanol or lactate located in the
           mitochondrial inner membrane
          Length = 564

 Score = 32.0 bits (71), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 54/114 (47%), Gaps = 5/114 (4%)

Query: 804 DQEMDLFEPKRVKWENSFDLINDCDSMNNEFYNSMAATLSQIKSTVDTSSNSMNES--IS 861
           D++++L+E ++V   ++ +     DS +N +   +A  LSQ    ++ +   MN S  I+
Sbjct: 408 DEKLELWEARKVALWSTINAGKAKDSNSNVWTTDVAVPLSQFAPVIEATKQEMNASGLIT 467

Query: 862 VMKGQVEESENAISLLKNNTKFNDQFEQLINKHNMLKDNIKNSITSTHSHITNV 915
            + G   +  N  + +  N    D  E++++  NM+   I+   T T  H   +
Sbjct: 468 TLVGHAGDG-NFHAFIVYNDDQRDIAEKIVD--NMVHRAIEAEGTCTGEHGVGI 518

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2.649
           YKL012W
          Length = 606

 Score = 32.0 bits (71), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 736 NMKQYLKNHFFKNNHQELLNRH-VDSTYENIEKRTNEFVENFKKVLNDHLDENK 788
           + +Q L+N+ F+NN + + N+H V  T+E++ K   + V+ ++  L D L E K
Sbjct: 327 SWQQLLQNYLFENNKRFVANKHFVVLTHEDVLKEYLDIVDTYETKLRDALKEEK 380

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 135 TYTMTGDEKLYNGELSDAAGIIPRVLLKLFDTLELQ 170
           T T   D++ Y GE +D  GI P+  +K+ +T   Q
Sbjct: 33  TVTNVEDDEWYYGEYADKEGIFPKSFVKILETAPAQ 68

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 99,154,680
Number of extensions: 4510093
Number of successful extensions: 27145
Number of sequences better than 10.0: 1703
Number of HSP's gapped: 27240
Number of HSP's successfully gapped: 2584
Length of query: 1000
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 880
Effective length of database: 39,721,479
Effective search space: 34954901520
Effective search space used: 34954901520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)