Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL060C (PRB1)6.14ON63563528280.0
Suva_5.76.14ON66467923840.0
Smik_5.276.14ON60848523250.0
Skud_5.296.14ON60848523110.0
SAKL0E01012g6.14ON54449517260.0
TDEL0G045506.14ON56446016860.0
Kwal_56.223876.14ON54348616450.0
KLTH0C11396g6.14ON55049816160.0
NCAS0F002206.14ON69544316220.0
TBLA0A073006.14ON57347516020.0
KLLA0D00979g6.14ON56148415880.0
NDAI0K028806.14ON70449215850.0
ZYRO0C07942g6.14ON54848314980.0
CAGL0B03619g6.14ON46847214850.0
ACR012C6.14ON54148214810.0
Kpol_1032.56.14ON68048914730.0
KNAG0E009206.14ON53145614310.0
KAFR0L003606.14ON50243814060.0
Kpol_1045.756.14ON47746313780.0
Ecym_30186.14ON57547513820.0
Suva_15.1786.14ON47641512801e-171
Skud_15.1646.14ON48241812541e-167
TPHA0M002306.14ON58544612581e-166
Smik_15.1726.14ON47841812401e-165
YOR003W (YSP3)6.14ON47841812211e-162
CAGL0E02651g6.14ON48541610521e-136
KAFR0B065506.14ON45641810051e-130
NCAS0D026306.14ON4514219131e-116
NDAI0I022806.14ON4824318341e-104
KNAG0F02970singletonON4204117972e-99
CAGL0L13266gsingletonON5794477885e-96
ZYRO0D08822g6.313ON4903804671e-50
NCAS0D043906.313ON4923934556e-49
Suva_3.846.313ON5273254569e-49
Smik_3.1496.313ON4913164531e-48
SAKL0A02002g6.313ON4793904485e-48
Kpol_1028.616.313ON5183214471e-47
YCR045C (RRT12)6.313ON4914094433e-47
TDEL0A072806.313ON4364274393e-47
Skud_3.1246.313ON5403274402e-46
KNAG0I024706.313ON4754064344e-46
Kpol_1018.56.313ON4653204249e-45
KAFR0J024506.313ON4783604241e-44
TBLA0F039706.313ON7343064341e-44
CAGL0L10802g6.313ON5173404223e-44
KLTH0A06094g6.313ON4963164162e-43
NDAI0I005606.313ON4833954091e-42
Ecym_21056.313ON6103224071e-41
TPHA0D037606.313ON6073193964e-40
AAR069W6.313ON7683263961e-39
Kwal_23.61836.313ON4933233801e-38
KLLA0F06028g6.313ON5083213774e-38
Kwal_33.133721.78ON3773103263e-32
KLTH0F02288g1.78ON3803163034e-29
TBLA0A067006.313ON4972593004e-28
Kpol_2000.691.78ON3863122883e-27
ZYRO0F16764g1.78ON3863452574e-23
TPHA0B045201.78ON3883492273e-19
TDEL0C062301.78ON3643342174e-18
TBLA0A054101.78ON3822811991e-15
NDAI0E016308.608ON456101830.21
NCAS0A008802.6ON83366790.64
SAKL0G00440g2.6ON83663790.68
ZYRO0F15598g2.6ON79063780.82
Skud_7.10na 1ON56670780.85
Skud_14.1012.6ON81967771.3
YNL238W (KEX2)2.6ON81464733.0
TBLA0B001302.6ON84259733.1
CAGL0J07546g2.6ON78961733.3
Suva_14.1062.6ON80964733.4
KAFR0A080402.6ON76663715.4
Ecym_15268.17ON64894715.5
Smik_14.972.6ON81464716.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL060C
         (635 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}  PR...  1093   0.0  
Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON} YE...   922   0.0  
Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON} Y...   900   0.0  
Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON} Y...   894   0.0  
SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar ...   669   0.0  
TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {O...   654   0.0  
Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060...   638   0.0  
KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {...   627   0.0  
NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14 ...   629   0.0  
TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa] ...   621   0.0  
KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar ...   616   0.0  
NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {...   615   0.0  
ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {...   581   0.0  
CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} simila...   576   0.0  
ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON} S...   575   0.0  
Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..841...   572   0.0  
KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {O...   555   0.0  
KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14...   546   0.0  
Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa] ...   535   0.0  
Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to ...   536   0.0  
Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003...   497   e-171
Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003...   487   e-167
TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14...   489   e-166
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...   482   e-165
YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putat...   474   e-162
CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} simila...   409   e-136
KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6...   391   e-130
NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14     356   e-116
NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {O...   325   e-104
KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON}              311   2e-99
CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} som...   308   5e-96
ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} simila...   184   1e-50
NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {O...   179   6e-49
Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}...   180   9e-49
Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON...   179   1e-48
SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} simila...   177   5e-48
Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON} (1383...   176   1e-47
YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}  ...   175   3e-47
TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa] ...   173   3e-47
Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON...   174   2e-46
KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {O...   171   4e-46
Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON} (14365.....   167   9e-45
KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {...   167   1e-44
TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {O...   171   1e-44
CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa...   167   3e-44
KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {...   164   2e-43
NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313    162   1e-42
Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar t...   161   1e-41
TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {O...   157   4e-40
AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic ho...   157   1e-39
Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa] ...   150   1e-38
KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some s...   149   4e-38
Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045...   130   3e-32
KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly...   121   4e-29
TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON} Anc_6...   120   4e-28
Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa] ...   115   3e-27
ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]...   103   4e-23
TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa] ...    92   3e-19
TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa] ...    88   4e-18
TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1...    81   1e-15
NDAI0E01630 Chr5 complement(324500..325870) [1371 bp, 456 aa] {O...    37   0.21 
NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6...    35   0.64 
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    35   0.68 
ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]...    35   0.82 
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    35   0.85 
Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238...    34   1.3  
YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}  KEX2Subti...    33   3.0  
TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6 Y...    33   3.1  
CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa] ...    33   3.3  
Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238...    33   3.4  
KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa] ...    32   5.4  
Ecym_1526 Chr1 complement(1083371..1085317) [1947 bp, 648 aa] {O...    32   5.5  
Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W...    32   6.8  

>YEL060C Chr5 complement(40046..41953) [1908 bp, 635 aa] {ON}
           PRB1Vacuolar proteinase B (yscB), a serine protease of
           the subtilisin family; involved in protein degradation
           in the vacuole and required for full protein degradation
           during sporulation; activity inhibited by Pbi2p
          Length = 635

 Score = 1093 bits (2828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/635 (86%), Positives = 550/635 (86%)

Query: 1   MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTXXXXXXXXXX 60
           MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFT          
Sbjct: 1   MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTKDDDEEPSDS 60

Query: 61  XXXXHGKFHKKGRKGQDKESPEFNGKRXXXXXXXXXXXXXXMKPKHESSXXXXXXXXXXX 120
               HGKFHKKGRKGQDKESPEFNGKR              MKPKHESS           
Sbjct: 61  EDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSNDDDNDDKKKK 120

Query: 121 PHHKGGCHENXXXXXXXXXXXXXXXXXXXXTLEKGRHHNRLAPLVSTAQFNPDAISKIIP 180
           PHHKGGCHEN                    TLEKGRHHNRLAPLVSTAQFNPDAISKIIP
Sbjct: 121 PHHKGGCHENKVEEKKMKGKKVKGKKHHEKTLEKGRHHNRLAPLVSTAQFNPDAISKIIP 180

Query: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240
           NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS
Sbjct: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240

Query: 241 FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER 300
           FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER
Sbjct: 241 FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER 300

Query: 301 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 360
           LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH
Sbjct: 301 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 360

Query: 361 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGS 420
           CAGTIASKHYG            LRSNGSGTMSDVVKGVEY              GFKGS
Sbjct: 361 CAGTIASKHYGVAKNANVVAVKVLRSNGSGTMSDVVKGVEYAAKAHQKEAQEKKKGFKGS 420

Query: 421 TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 480
           TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD
Sbjct: 421 TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 480

Query: 481 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD 540
           DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD
Sbjct: 481 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD 540

Query: 541 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSH 600
           SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSH
Sbjct: 541 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSH 600

Query: 601 SSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635
           SSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII
Sbjct: 601 SSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635

>Suva_5.7 Chr5 complement(15849..17843) [1995 bp, 664 aa] {ON}
           YEL060C (REAL)
          Length = 664

 Score =  922 bits (2384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/679 (70%), Positives = 509/679 (74%), Gaps = 59/679 (8%)

Query: 1   MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHERPRKVEFTXXXXXXXXXX 60
           MKL+NTLFTLGALG ISAALVIPNLE+ ADH EL+ KEDHH+ P+  EF           
Sbjct: 1   MKLQNTLFTLGALGGISAALVIPNLEDTADHRELMGKEDHHDGPKHAEFVEDNDRHDERP 60

Query: 61  XXXXHGKFHKKGRKGQDKESPEFNGKRXXXXXXXXXXXXXXMKPKHESSXXXXXXXXXXX 120
                   HKKGRK  +++  E   K               M                  
Sbjct: 61  P-------HKKGRK--ERKDVESKDKDDEDRHARKHRKGEHM------DAKDDSSDDEDK 105

Query: 121 PHHKGGCH--------------------ENXXXXXXXXXXXXXXXXXXXXTLEKGRHHN- 159
           PH KGGCH                    +                      LEKG+ H+ 
Sbjct: 106 PHGKGGCHGKKDMKAKGKKHHEKESVEDKEHHGEESEKGKKAKGKKHHGKELEKGKEHHG 165

Query: 160 ----------------------RLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEID 197
                                 +LAPLVST QFNPDAI+KIIPNRYIIVFK+  P EE  
Sbjct: 166 KKHHGKELEKGKEPHGKDHHRGKLAPLVSTEQFNPDAITKIIPNRYIIVFKKDVPPEEAA 225

Query: 198 FHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQE 257
           FH+E VQQAQLQSVENL+AEDAFFIST+D +LS+SEAGGIQDSFNID+LFSGYIGYFTQE
Sbjct: 226 FHRETVQQAQLQSVENLAAEDAFFISTRDAALSSSEAGGIQDSFNIDSLFSGYIGYFTQE 285

Query: 258 IVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGR 317
           IVDLIRQNPLVDFVE+DS+VEAT+FDTQNSAPWGLAR+SHRERLNLGSFNKYLYDDDAGR
Sbjct: 286 IVDLIRQNPLVDFVEKDSVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLYDDDAGR 345

Query: 318 GVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXX 377
           GVTSYVIDTGVN+NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG      
Sbjct: 346 GVTSYVIDTGVNVNHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNAN 405

Query: 378 XXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLA 437
                 LRSNGSGTMSDV+KGVEY              GFKGSTANMSLGGGKSPALDLA
Sbjct: 406 VVAVKVLRSNGSGTMSDVLKGVEYAAKAHQKQAEEKKKGFKGSTANMSLGGGKSPALDLA 465

Query: 438 VNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAP 497
           VNAAVE GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSN+GKCVDVFAP
Sbjct: 466 VNAAVEAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAP 525

Query: 498 GLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLK 557
           GLNILSTYIGSD+ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLK
Sbjct: 526 GLNILSTYIGSDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLK 585

Query: 558 KKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKKSH-SSGFKQELNMDEFIGS 616
           KKLIHYSTKDILFDIP+DTPN LIYNGGGQDLSAFWNDTKKSH SSGFKQELN+DEFIGS
Sbjct: 586 KKLIHYSTKDILFDIPDDTPNALIYNGGGQDLSAFWNDTKKSHSSSGFKQELNLDEFIGS 645

Query: 617 KTDLIFDQVRDILDKLNII 635
           KTDLIF+QVRD+LDKLNII
Sbjct: 646 KTDLIFEQVRDVLDKLNII 664

>Smik_5.27 Chr5 complement(42408..44234) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  900 bits (2325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/485 (89%), Positives = 449/485 (92%)

Query: 151 TLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQS 210
           TLEKGR +N+LAPLVSTAQFNPDAISKIIPNRYI+VFK+G P+EE++FHKE+V QAQLQS
Sbjct: 124 TLEKGRPNNKLAPLVSTAQFNPDAISKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQS 183

Query: 211 VENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDF 270
           VENLSAEDAFF ST+DT LSTSEAGGIQDSFNIDN+FSGYIGYFTQEI+DLIRQNPLVDF
Sbjct: 184 VENLSAEDAFFTSTRDTYLSTSEAGGIQDSFNIDNIFSGYIGYFTQEIIDLIRQNPLVDF 243

Query: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330
           VERDS+VEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI
Sbjct: 244 VERDSVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 303

Query: 331 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 390
           NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG
Sbjct: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 363

Query: 391 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAV 450
           TMSDVVKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVE GIHFAV
Sbjct: 364 TMSDVVKGVEYAAKAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423

Query: 451 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDD 510
           AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+
Sbjct: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDE 483

Query: 511 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 570
           ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF
Sbjct: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 543

Query: 571 DIPEDTPNVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILD 630
           DIPEDTPN LIYNGGGQDLSAFWNDTKKSH SG K ELNMDEFIGSKTDL+F+QVRD+LD
Sbjct: 544 DIPEDTPNFLIYNGGGQDLSAFWNDTKKSHPSGSKHELNMDEFIGSKTDLLFEQVRDVLD 603

Query: 631 KLNII 635
           KLNII
Sbjct: 604 KLNII 608

>Skud_5.29 Chr5 complement(39160..40986) [1827 bp, 608 aa] {ON}
           YEL060C (REAL)
          Length = 608

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/485 (88%), Positives = 446/485 (91%)

Query: 151 TLEKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQS 210
           TLEK RH+ +LAPLVSTAQF+P A+ KIIPNRYIIVFK+G PQE  DFHKE+V QAQLQS
Sbjct: 124 TLEKARHNEKLAPLVSTAQFDPAAMPKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQS 183

Query: 211 VENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDF 270
           VENLSAEDAFFIST+D+SLSTSE GGIQDSFNIDN+FSGYIGYFTQEI+DLIRQNPLVDF
Sbjct: 184 VENLSAEDAFFISTRDSSLSTSETGGIQDSFNIDNMFSGYIGYFTQEIIDLIRQNPLVDF 243

Query: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330
           VERDS+VEAT+FDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVN+
Sbjct: 244 VERDSVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNV 303

Query: 331 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 390
           NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG
Sbjct: 304 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSG 363

Query: 391 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAV 450
           TMSDVVKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAVE GIHFAV
Sbjct: 364 TMSDVVKGVEYAARAHQKQAQEKKKGFKGSTANMSLGGGKSPALDLAVNAAVEAGIHFAV 423

Query: 451 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDD 510
           AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIGSDD
Sbjct: 424 AAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGSDD 483

Query: 511 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILF 570
           ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFE+GQDSLTPQQLK KLIHYSTKDILF
Sbjct: 484 ATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDSLTPQQLKNKLIHYSTKDILF 543

Query: 571 DIPEDTPNVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILD 630
           D+PEDTPN LIYNGGGQDLSAFWNDTKKSHSS FKQELNMDEFIGSKTDLIF+QVRD+LD
Sbjct: 544 DVPEDTPNALIYNGGGQDLSAFWNDTKKSHSSRFKQELNMDEFIGSKTDLIFEQVRDVLD 603

Query: 631 KLNII 635
           KLNII
Sbjct: 604 KLNII 608

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/43 (81%), Positives = 40/43 (93%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADHHELINKEDHHER 43
          MKLENTL TLGALGSISAALVIPNLE+AADHHEL+ +++H ER
Sbjct: 1  MKLENTLLTLGALGSISAALVIPNLEHAADHHELVVEDNHQER 43

>SAKL0E01012g Chr5 (75498..77132) [1635 bp, 544 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 544

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/495 (67%), Positives = 388/495 (78%), Gaps = 20/495 (4%)

Query: 153 EKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVE 212
           EKG    +LAPLVS+ Q  P   + IIP+RYIIVFK+ A  EEI FHKE + +A  +SV 
Sbjct: 58  EKGEEV-KLAPLVSSPQ--P---ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVA 111

Query: 213 NLSAEDAFFISTKDTS-----LSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPL 267
            L ++D+FF +TK ++      + S  GGIQ+SF+I N+ +GYIGYFT E+VD IR N  
Sbjct: 112 KLDSKDSFFAATKGSADEYGIAAKSSEGGIQESFDIANMLNGYIGYFTDEVVDFIRMNQW 171

Query: 268 VDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 327
           V+F+E+DS+V A+EFDTQN APWGL+RISHRERLNLGSFNKYLYDDDAG+GVTSYVIDTG
Sbjct: 172 VEFIEKDSLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTSYVIDTG 231

Query: 328 VNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSN 387
           +N+NHKDF  RA+WGKT+P NDED DGNGHGTHCAGTIAS+HYG            LRSN
Sbjct: 232 INVNHKDFNGRAVWGKTVPQNDEDADGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSN 291

Query: 388 GSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIH 447
           GSGTMSDVVKGVE+              GFKGSTANMSLGGGKSPALDLAVNAAV+ GIH
Sbjct: 292 GSGTMSDVVKGVEFAAQSHQEASKKNKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGIH 351

Query: 448 FAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 507
           FAVAAGNENQDACNTSPA+A+ AITVGASTLSDDRAYFSNWGKCVD+FAPGLN+LSTYIG
Sbjct: 352 FAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVLSTYIG 411

Query: 508 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 567
           S+ ATATLSGTSMASPHVAGLLTYFLSLQP SDSEFF+     +TP QLKKKLI YSTKD
Sbjct: 412 SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQ--ASGITPAQLKKKLIAYSTKD 469

Query: 568 ILFDIPEDTPNVLIYNGGGQDLSAFWNDT----KKSHSSGFKQELNMDEFIGS---KTDL 620
           +L+++PEDTPN LIYNGGGQDLS FW  +    K+  S    ++  + E I S   KTDL
Sbjct: 470 VLYELPEDTPNYLIYNGGGQDLSDFWGKSEEQVKEEGSIQDFKDFKLSELIESFDTKTDL 529

Query: 621 IFDQVRDILDKLNII 635
           +F++VR + DKLNII
Sbjct: 530 LFEEVRSVFDKLNII 544

>TDEL0G04550 Chr7 complement(829468..831162) [1695 bp, 564 aa] {ON}
           Anc_6.14 YOR003W
          Length = 564

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/460 (68%), Positives = 369/460 (80%), Gaps = 9/460 (1%)

Query: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238
            P+RYI+V K  +P EEI  H E + Q+QLQSV  L+ +D FF     ++      GGIQ
Sbjct: 111 FPHRYIVVLKHSSP-EEIALHMEAITQSQLQSVGELAQDDPFF-----SAQGVRTTGGIQ 164

Query: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298
           DSF++  L +GY+GYFT  +V+LIR++P+VDFVE DS V A+EFDTQN APWGL+RISHR
Sbjct: 165 DSFDVAGLLNGYVGYFTDAVVELIRKSPMVDFVEMDSPVHASEFDTQNGAPWGLSRISHR 224

Query: 299 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358
           ERLNLGSFNKYL+DD+AG+GVTSYVIDTG+N+ H+DFE RA WGKTIP NDEDLDGNGHG
Sbjct: 225 ERLNLGSFNKYLFDDEAGKGVTSYVIDTGINVKHQDFEGRAHWGKTIPTNDEDLDGNGHG 284

Query: 359 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFK 418
           THCAGTIASKHYG            LRSNGSG+MSDV+KGVE+              GFK
Sbjct: 285 THCAGTIASKHYGVAKGADVVAVKVLRSNGSGSMSDVIKGVEFAAQSHQKAVKDKKKGFK 344

Query: 419 GSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTL 478
           GSTANMSLGGGKSPALDLAVNAAV+ GIHFAVAAGNENQDACNTSPA+A++A+TVGASTL
Sbjct: 345 GSTANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTL 404

Query: 479 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPG 538
           SDDRAYFSN+GKCVD+FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 
Sbjct: 405 SDDRAYFSNYGKCVDIFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPD 464

Query: 539 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDTKK 598
           SDS+FF+ G   +TP+QLKKKLI YSTKDIL+D+PEDTPN LIYNGGG  L  FW+   K
Sbjct: 465 SDSDFFDAGSQGVTPEQLKKKLIAYSTKDILYDLPEDTPNALIYNGGGHGLKGFWDGHDK 524

Query: 599 SHSSGFKQELNMDEF---IGSKTDLIFDQVRDILDKLNII 635
             ++   Q+ ++ E    +G+KTD +FDQVRD+LD+LNII
Sbjct: 525 QEANTRFQDTDLQELSDNLGAKTDALFDQVRDVLDRLNII 564

>Kwal_56.22387 s56 (107327..108958) [1632 bp, 543 aa] {ON} YEL060C
           (PRB1) - vacuolar protease B [contig 185] FULL
          Length = 543

 Score =  638 bits (1645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/486 (66%), Positives = 371/486 (76%), Gaps = 20/486 (4%)

Query: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220
           L+PLV TA+   DAI    P+RYI+VFK     EE+DFH E V +A  QSV  L A DAF
Sbjct: 67  LSPLV-TARNMYDAI----PHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAF 121

Query: 221 FISTKDTSL---STSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277
           F +T D  +   +TS  GGI DSF+++ +  GYIGYFTQEIVD IR NPLV FVE+DS+V
Sbjct: 122 FEATMDEEMGIMATSREGGILDSFDVNGMLRGYIGYFTQEIVDFIRMNPLVAFVEQDSMV 181

Query: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337
            A EFDTQN APWGL+RISHRE+LNLGSFNKYLYDD AG+GVTSYVIDTG+NI+HKDFE 
Sbjct: 182 YANEFDTQNGAPWGLSRISHREKLNLGSFNKYLYDDAAGKGVTSYVIDTGINIDHKDFEG 241

Query: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 397
           RA WGKT+P ND D DGNGHGTHCAGTIASKHYG            LRSNGSG+MSDVVK
Sbjct: 242 RAAWGKTVPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVVK 301

Query: 398 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457
           GVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+ GIHFAVAAGNENQ
Sbjct: 302 GVEFAAKSHQDAVKKNKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGIHFAVAAGNENQ 361

Query: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSG 517
           DACN+SPA+A+ AITVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYIGS+ ATATLSG
Sbjct: 362 DACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYIGSETATATLSG 421

Query: 518 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 577
           TSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK+ L D+PEDT 
Sbjct: 422 TSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTKNALGDLPEDTV 480

Query: 578 NVLIYNGGGQDLSAFW--------NDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDIL 629
           N LIYNGGGQDL  FW         D K + +S F+  ++  E    KTD +++++R+I 
Sbjct: 481 NYLIYNGGGQDLDDFWVKDLEEKVADAKDNTASEFESIIDALE---EKTDGLYEEIREIF 537

Query: 630 DKLNII 635
           + LNII
Sbjct: 538 EGLNII 543

>KLTH0C11396g Chr3 complement(936878..938530) [1653 bp, 550 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 550

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/498 (63%), Positives = 367/498 (73%), Gaps = 34/498 (6%)

Query: 160 RLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDA 219
            L+PLVS++          IP+RYI+VFK+    EE+DFHK+ V +A LQSV  L +   
Sbjct: 65  ELSPLVSSS-----GKYLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHE 119

Query: 220 FFIST------KDTSL-------STSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNP 266
           FF ST      +D  L       + +  GGIQDSF++  L +GYIGYFT EIVD IR NP
Sbjct: 120 FFTSTENFVEDRDFELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYFTDEIVDFIRMNP 179

Query: 267 LVDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDT 326
           LVDFVE+DS+V A EF TQN APWGL+RISHRE+LNLGSFNKYLYDDDAG+GVTSYVIDT
Sbjct: 180 LVDFVEQDSVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLYDDDAGKGVTSYVIDT 239

Query: 327 GVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 386
           GVN++HKDFE RA WGKTIP ND D DGNGHGTHCAGTIASKHYG            LRS
Sbjct: 240 GVNVDHKDFEGRASWGKTIPTNDLDQDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRS 299

Query: 387 NGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGI 446
           NGSG+MSDVVKGVE+              GFKGSTANMSLGGGKSPALD+AVNAAV+ GI
Sbjct: 300 NGSGSMSDVVKGVEFAAKSHQDAVKENKKGFKGSTANMSLGGGKSPALDMAVNAAVKAGI 359

Query: 447 HFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYI 506
           HFAVAAGNENQDACN+SPASA+ A+TVGASTL+DDRAYFSNWGKCVD+FAPGLN+LSTYI
Sbjct: 360 HFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVLSTYI 419

Query: 507 GSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTK 566
           GSD ATATLSGTSMASPHVAGLLTYFLSLQP SDSE+F      +TP QLKKKLI YSTK
Sbjct: 420 GSDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFH-AAGGITPSQLKKKLIAYSTK 478

Query: 567 DILFDIPEDTPNVLIYNGGGQDLSAFW---------NDTKKSHSSGFKQELNMDEFIGSK 617
           ++L DIP+DT N LI+NGGG+ L  FW          DT  S    F   L        K
Sbjct: 479 NVLGDIPDDTVNYLIFNGGGEGLDDFWGKESVVDEVEDTISSEIESFIDALE------EK 532

Query: 618 TDLIFDQVRDILDKLNII 635
           TD++++++R++ D +NII
Sbjct: 533 TDVLYEEIREVFDHMNII 550

>NCAS0F00220 Chr6 (32791..34878) [2088 bp, 695 aa] {ON} Anc_6.14
           YEL060C
          Length = 695

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/443 (69%), Positives = 355/443 (80%), Gaps = 5/443 (1%)

Query: 163 PLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFI 222
           P+VS A  N +A S IIPNRYI+VFK+    EE+DFHKE + Q QL+S   L  +D FF 
Sbjct: 83  PVVSGASANSNANSNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFS 142

Query: 223 STKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEF 282
           ++     S ++ GGI  +FNI NL +GY+GYFT E+++LIR NPLV++VE+DS+V+ATEF
Sbjct: 143 ASAIEDESINQ-GGILTTFNISNLLNGYVGYFTDEVLELIRMNPLVEYVEKDSLVQATEF 201

Query: 283 DTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWG 342
           D QN+APWGLARISHRERLNLGSFNKYLYDDDAG+GVT YVIDTG+N  H DF KRA+WG
Sbjct: 202 DNQNNAPWGLARISHRERLNLGSFNKYLYDDDAGKGVTCYVIDTGINTEHNDFNKRAVWG 261

Query: 343 KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYX 402
           KTIPLND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MSDV+KGVE+ 
Sbjct: 262 KTIPLNDKDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMSDVIKGVEFA 321

Query: 403 XXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNT 462
                        GFKGSTANMSLGGGKSP LDLAVNAAV+ GIHFAVAAGNENQDACNT
Sbjct: 322 AESHIKAAKEKKKGFKGSTANMSLGGGKSPTLDLAVNAAVDAGIHFAVAAGNENQDACNT 381

Query: 463 SPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMAS 522
           SPASA++AITVGASTLSDDRAYFSNWGKCVD+FAPGLNILSTYIG DDATATLSGTSMAS
Sbjct: 382 SPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNILSTYIGDDDATATLSGTSMAS 441

Query: 523 PHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIY 582
           PHVAGLLTYFLSLQPGSDSEFF+  +  LTP Q+KKKLI+YS+KD+LFD+PE TPN LI+
Sbjct: 442 PHVAGLLTYFLSLQPGSDSEFFDPTE--LTPAQMKKKLINYSSKDVLFDLPEGTPNKLIF 499

Query: 583 NGGGQDLSAFWNDTKKSHSSGFK 605
           NG G +L   WN  KKS     K
Sbjct: 500 NGAGGNLDDLWN--KKSQEEDIK 520

>TBLA0A07300 Chr1 complement(1815683..1817404) [1722 bp, 573 aa]
           {ON} Anc_6.14 YOR003W
          Length = 573

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/475 (65%), Positives = 357/475 (75%), Gaps = 12/475 (2%)

Query: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220
           +APL S +  +P     IIP+RYII FK+    EEIDFH++++ + Q QS+  L  +  +
Sbjct: 111 IAPLYSQS-LHP---QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPY 166

Query: 221 FISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEAT 280
           F S +   L       I DSFNI++L  GYIGYFT +++D IR NPLV FVE+DS V   
Sbjct: 167 FNSVEGLDLQQP----IIDSFNINSLLQGYIGYFTDDVIDFIRLNPLVQFVEQDSTVNIN 222

Query: 281 EFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAI 340
           EFDTQN APWGLARISHRERLNLGSFNKYL+DD AG GVT+YVIDTGVN+ H DFE RA 
Sbjct: 223 EFDTQNGAPWGLARISHRERLNLGSFNKYLFDDKAGEGVTAYVIDTGVNVEHNDFEGRAS 282

Query: 341 WGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVE 400
           WGKTIP NDEDLDGNGHGTHCAGTIASKHYG            LRSNGSG+MSDV+KGVE
Sbjct: 283 WGKTIPNNDEDLDGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSMSDVLKGVE 342

Query: 401 YXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDAC 460
           Y              GFKGSTANMSLGGGKSP+LDLAVNAAV+ GIHFAVAAGNENQDAC
Sbjct: 343 YATASHLADVKNKKSGFKGSTANMSLGGGKSPSLDLAVNAAVKAGIHFAVAAGNENQDAC 402

Query: 461 NTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 520
           NTSPASA  AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM
Sbjct: 403 NTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSM 462

Query: 521 ASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVL 580
           ASPHVAGLL+YFLSLQP  DSEF    +  +TP QLKK+LI Y TKDIL DIPE TPNVL
Sbjct: 463 ASPHVAGLLSYFLSLQPEQDSEFATSRKGGITPAQLKKRLISYGTKDILLDIPELTPNVL 522

Query: 581 IYNGGGQDLSAFWNDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635
           ++NG GQDLS FWN +K +     +   N+D  +G   D+++DQ   I  K+N++
Sbjct: 523 VFNGAGQDLSDFWNISKPADLESNEVYKNLD-LVG---DVLYDQFTGIFKKMNLL 573

>KLLA0D00979g Chr4 (86703..88388) [1686 bp, 561 aa] {ON} similar to
           uniprot|P09232 Saccharomyces cerevisiae YEL060C PRB1
           Vacuolar proteinase B (yscB) a serine protease of the
           subtilisin family involved in protein degradation in the
           vacuole and required for full protein degradation during
           sporulation
          Length = 561

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/484 (63%), Positives = 362/484 (74%), Gaps = 15/484 (3%)

Query: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220
           LAPL +      + I+  IPNRYIIVFK+ A  +E+ FH+E V     +++ +L+  D F
Sbjct: 84  LAPLSTV-----NDIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPF 138

Query: 221 FISTKDT-----SLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDS 275
           F +T          + S  GGIQDSF+I    SGY+GYFT+E++D IR++PLV+FVE DS
Sbjct: 139 FTATSGEHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYFTKEVIDFIRRSPLVEFVEEDS 198

Query: 276 IVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 335
           +V +  F+TQNSAPWGLARISHRE+LNLGSFNKYLYDDDAG+GVT+YV+DTGVN+NHKDF
Sbjct: 199 MVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLYDDDAGKGVTAYVVDTGVNVNHKDF 258

Query: 336 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 395
           + RA+WGKTIP +D D+DGNGHGTHCAGTI S HYG            LRSNGSGTMSDV
Sbjct: 259 DGRAVWGKTIPKDDPDVDGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTMSDV 318

Query: 396 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNE 455
           VKGVEY              GFKGSTANMSLGGGKSPALDLAVNAAV+ G+HFAVAAGNE
Sbjct: 319 VKGVEYVAEAHKKAVEEQKKGFKGSTANMSLGGGKSPALDLAVNAAVKAGVHFAVAAGNE 378

Query: 456 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATL 515
           NQDACNTSPA+A+ AITVGASTLSD+RAYFSNWGKCVD+F PGLNILSTYIGSD ATATL
Sbjct: 379 NQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNILSTYIGSDTATATL 438

Query: 516 SGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPED 575
           SGTSMA+PHV GLLTYFLSLQP +DSE+F      +TP QLKKKLI +STK++L D+PED
Sbjct: 439 SGTSMATPHVVGLLTYFLSLQPDADSEYFH-AAGGITPSQLKKKLIDFSTKNVLSDLPED 497

Query: 576 TPNVLIYNGGGQDLSAFW-NDTKKSHSSGFKQELNMDEFIG---SKTDLIFDQVRDILDK 631
           T N LIYNGGGQDL   W  D           E +++  I    SKTD IFD VR +LD+
Sbjct: 498 TVNYLIYNGGGQDLDDLWGKDYSIGKEPSANPEFSLESLINSLDSKTDAIFDDVRQLLDQ 557

Query: 632 LNII 635
            NII
Sbjct: 558 FNII 561

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 1  MKLENTLFTLGALGSISAALVIPNLENAADH 31
          MK ENTL T+ AL +++ ALVIP +     H
Sbjct: 1  MKFENTLLTITALSTVATALVIPEVNRENKH 31

>NDAI0K02880 Chr11 complement(651446..653560) [2115 bp, 704 aa] {ON}
           Anc_6.14
          Length = 704

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 367/492 (74%), Gaps = 18/492 (3%)

Query: 160 RLAPLVSTAQFNPDAIS------KIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVEN 213
           +LAPL+ T  F  D  +      +I+PN+YIIVFK     +EI +HKE + + Q QS   
Sbjct: 215 KLAPLI-TPTFGDDIHTQGFKHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASR 273

Query: 214 LSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVER 273
           L     FF ST +    +   GGI  SFNI+N+ SGY GYFTQE++DLIR NPLV +VER
Sbjct: 274 LPPHHHFFHSTSEEEEESFRNGGIISSFNINNILSGYSGYFTQEVIDLIRLNPLVKYVER 333

Query: 274 DSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHK 333
           DSIV+ TEF+TQN+APWGL+RISHRERLNLGSFNKYLYDDDAG+GVT +VIDTG+N+NH 
Sbjct: 334 DSIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLYDDDAGKGVTCFVIDTGINVNHV 393

Query: 334 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 393
           DF KRAIWGKTIP ND+D+DGNGHGTHCAGTIAS HYG            LRSNGSG+MS
Sbjct: 394 DFGKRAIWGKTIPSNDQDIDGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSMS 453

Query: 394 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAG 453
           DV+KGVE+               +KGSTANMSLGGGKSP LDLAVNAAVE GIHF+VAAG
Sbjct: 454 DVIKGVEFAAETHLNNEKNKKD-YKGSTANMSLGGGKSPTLDLAVNAAVEAGIHFSVAAG 512

Query: 454 NENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDAT 512
           NENQDACN+SPASA+ AITVGASTLSDDRAYFSNWG+CVDVFAPGLNILSTY+G  +D T
Sbjct: 513 NENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNILSTYVGDGNDNT 572

Query: 513 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD-SLTPQQLKKKLIHYSTKDILFD 571
           ATLSGTSMASPHVAGLLTYFLSLQP S S FF    D  +TP+QLKKKLI YST DIL+D
Sbjct: 573 ATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKLIAYSTSDILYD 632

Query: 572 IPEDTPNVLIYNGGGQDLSAFWNDTKKSHS---SGFKQELNMDEFIGS-----KTDLIFD 623
           +P+ TPN LIYNG G D+S  WN   +  +      + ++N +  + S     KTDL FD
Sbjct: 633 LPDGTPNKLIYNGAGGDISDLWNGKVQEQAHEEPAHEDKINFENLVDSDSMSGKTDLFFD 692

Query: 624 QVRDILDKLNII 635
           Q+R++ +K+NII
Sbjct: 693 QIRNVFEKMNII 704

>ZYRO0C07942g Chr3 complement(605044..606690) [1647 bp, 548 aa] {ON}
           similar to uniprot|P09232 Saccharomyces cerevisiae
           YEL060C PRB1 Vacuolar proteinase B (yscB) a serine
           protease of the subtilisin family involved in protein
           degradation in the vacuole and required for full protein
           degradation during sporulation
          Length = 548

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/483 (60%), Positives = 354/483 (73%), Gaps = 12/483 (2%)

Query: 158 HNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAE 217
            +R APLV      P+    ++ NRYII+FK+G   +EI FH+E ++Q  LQ V  L  E
Sbjct: 73  QDRFAPLVV-----PEDTLGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEE 127

Query: 218 DAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277
            +FF   +   +  S  GGI  +F+I+ +  GY GYF  +++D+IR +PL++ VE+DS+V
Sbjct: 128 HSFFEGIRLDGVYDSPLGGIDHTFDINGMLMGYSGYFPSKVLDVIRMSPLIEMVEQDSVV 187

Query: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337
              + DT+N APWGLARISHRERLNLGS+NKYLYD+  G GVTSYVIDTGVN++H  F  
Sbjct: 188 YTQKADTENGAPWGLARISHRERLNLGSYNKYLYDEQGGSGVTSYVIDTGVNVHHNQFGG 247

Query: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 397
           RA WGKTIP  D D DGNGHGTHCAGTI S  YG            LRSNGSG+MSDV+K
Sbjct: 248 RAKWGKTIPAGDLDEDGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSMSDVLK 307

Query: 398 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457
           GVE+              GFKGSTANMSLGGGKSP+LD AVNAAV  G++FAVAAGNE+Q
Sbjct: 308 GVEWAAQDHQNAVKQKKPGFKGSTANMSLGGGKSPSLDQAVNAAVAAGLNFAVAAGNEDQ 367

Query: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSG 517
           DACNTSPASA   ITVGASTLSDDRAYFSN+GKCVDVFAPGLNILSTYIGSD +TATLSG
Sbjct: 368 DACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNILSTYIGSDSSTATLSG 427

Query: 518 TSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTP 577
           TSMASPHVAGLL YFLSLQPGSDSE F+ G  S++P QLKKKL+ +STKD+L DIP  TP
Sbjct: 428 TSMASPHVAGLLAYFLSLQPGSDSE-FDAGS-SISPDQLKKKLLAFSTKDVLSDIPSGTP 485

Query: 578 NVLIYNGGGQDLSAFWNDTKKSHSSGFKQELNMD-----EFIGSKTDLIFDQVRDILDKL 632
           N+LIYNGGG DLS FW   + +    F ++++++     + +GSKTD +F Q+R ++D+L
Sbjct: 486 NLLIYNGGGGDLSGFWGSKEVAQELEFNEKVDLELHDLVDELGSKTDAVFGQIRGLMDRL 545

Query: 633 NII 635
           +II
Sbjct: 546 DII 548

>CAGL0B03619g Chr2 (361572..362978) [1407 bp, 468 aa] {ON} similar
           to uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
           protease B or uniprot|P25036 Saccharomyces cerevisiae
           YOR003w YSP3
          Length = 468

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/472 (61%), Positives = 350/472 (74%), Gaps = 18/472 (3%)

Query: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237
           ++P++YI+V K+G   E +     +V  A   ++ +L  E  FF       L     GGI
Sbjct: 1   MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNAEGLPR---GGI 57

Query: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297
           +D FNI++LF G IGYF + +V L+ ++ +V+FVERDS+V A+ FDTQN+APWGLARISH
Sbjct: 58  KDLFNINDLFQGLIGYFPEPVVKLLEKSDIVEFVERDSVVHASNFDTQNNAPWGLARISH 117

Query: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357
           R+RLNLG+FNKYLYD+  G GVT+YVIDTG+N+ H +F+ RA WGKTIPLND D+DGNGH
Sbjct: 118 RDRLNLGNFNKYLYDNAGGEGVTAYVIDTGINVKHVEFDGRAQWGKTIPLNDLDIDGNGH 177

Query: 358 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 417
           GTHCAGTIASKHYG            L+S+GSGTMSDV+KGVEY               F
Sbjct: 178 GTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTMSDVIKGVEYAAQAHLKESKNNKK-F 236

Query: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477
           KGSTANMSLGGGKSPALD+AVNAAV  GIHFAVAAGNENQDACNTSPASA+KAITVGAST
Sbjct: 237 KGSTANMSLGGGKSPALDMAVNAAVSAGIHFAVAAGNENQDACNTSPASAEKAITVGAST 296

Query: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQ 536
           LSDDRAYFSNWGKCVD+FAPGLNILSTYIG ++  TA+LSGTSMASPHVAGLLTYFLSLQ
Sbjct: 297 LSDDRAYFSNWGKCVDIFAPGLNILSTYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQ 356

Query: 537 PGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPE-DTPNVLIYNGGGQDLSAFWND 595
           P SDSEF++  +  +TP QLKKKLI YSTK++L D+P+ D+PN+LIYNG G DL  FWN 
Sbjct: 357 PDSDSEFYDASKHGVTPAQLKKKLIAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNS 416

Query: 596 TKKSHSSG------FKQELNMD---EFIGSK---TDLIFDQVRDILDKLNII 635
           T     S          EL +D   + +G +   TD +F QVR++LDK+NII
Sbjct: 417 TSADEQSAEHPEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII 468

>ACR012C Chr3 complement(378750..380375) [1626 bp, 541 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL060C
           (PRB1) and YOR003W (YSP3)
          Length = 541

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/482 (59%), Positives = 346/482 (71%), Gaps = 18/482 (3%)

Query: 170 FNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTS- 228
           F  D +++ IP++YI+VF+ G   EE  FH E V+ A  +SV  L  + AFF ST+  + 
Sbjct: 62  FRVDDVTRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRGENN 121

Query: 229 ----LSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDT 284
                +T   GGI+  F +     GY+GYFT+++V L+R NP V FVE DS+V A++F T
Sbjct: 122 EFGIAATRAEGGIEGEFALGEQLRGYVGYFTEDMVGLLRSNPHVHFVEEDSMVFASDFTT 181

Query: 285 QNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKT 344
           QN APWGLAR+SHRE+LN GSFNKYLYDD++G GVTSYVIDTG+NI+H DFE RA+WGKT
Sbjct: 182 QNGAPWGLARVSHREKLNSGSFNKYLYDDNSGEGVTSYVIDTGINIDHVDFEDRALWGKT 241

Query: 345 IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXX 404
           IP ND D DGNGHGTHCAGTIASK YG            LRSNG+G+MSDV++GVEY   
Sbjct: 242 IPNNDADYDGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSMSDVLRGVEYAVK 301

Query: 405 XXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSP 464
                      GFKGSTANMSLGGG+S ALDLAV+AAV+ GIHFAVAAGNENQDACNTSP
Sbjct: 302 AHRKAAEKADKGFKGSTANMSLGGGRSQALDLAVDAAVDAGIHFAVAAGNENQDACNTSP 361

Query: 465 ASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPH 524
           A++ KAITVGASTL+DDRAYFSNWG+CVD+FAPG+NILSTYIGSD A ATLSGTSMASPH
Sbjct: 362 AASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNILSTYIGSDTAVATLSGTSMASPH 421

Query: 525 VAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNG 584
           VAGLLTYFLSLQP  DSEF    + +++P+ LKKK+I + TKD L  +P  T NVLIYNG
Sbjct: 422 VAGLLTYFLSLQPDGDSEF--RNKQTISPEVLKKKVIDFGTKDALSSLPARTANVLIYNG 479

Query: 585 GGQDLSAFWNDTKKSHSSGFKQELNMDEFIG-----------SKTDLIFDQVRDILDKLN 633
           GG DLS FW +  K  S       + +E +G           S TD +F   R ILD++N
Sbjct: 480 GGADLSDFWGNKPKKVSGPKFTYADDEEAMGSDLDRLIHELESSTDAMFSGFRTILDRMN 539

Query: 634 II 635
           II
Sbjct: 540 II 541

>Kpol_1032.5 s1032 (6368..8410) [2043 bp, 680 aa] {ON} (6368..8410)
           [2043 nt, 681 aa]
          Length = 680

 Score =  572 bits (1473), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/489 (59%), Positives = 361/489 (73%), Gaps = 24/489 (4%)

Query: 153 EKGRHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVE 212
           EK     + APL S    N    + +IPN+YIIVFK+    +++  HK+ + +AQ Q   
Sbjct: 208 EKSGEKVKYAPLHSME--NTKYENLVIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQ--- 262

Query: 213 NLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVE 272
                   + S  D + S+S  GGI+++FN+ NLF GYIG+F +++V  IR +P+VDFVE
Sbjct: 263 --------YASVSDET-SSSILGGIEEAFNVANLFHGYIGHFNEQLVQFIRLSPIVDFVE 313

Query: 273 RDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINH 332
           +DSIV A E DTQN+APWGLARISHR+ LNLGS+NKYLYDD AG GVT+YVIDTG+NI H
Sbjct: 314 QDSIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLYDDVAGEGVTAYVIDTGINIKH 373

Query: 333 KDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 392
           K+F  RA+WGKTIP ND+D+DGNGHGTHCAGTIASK+YG            LRS+GSGTM
Sbjct: 374 KEFGGRAVWGKTIPENDQDVDGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTM 433

Query: 393 SDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAA 452
           SDV+KGVEY              GFKGSTANMSLGGGKS +LDLAV+AAV+ GIHFAVAA
Sbjct: 434 SDVLKGVEYAAFSHQKALREKKKGFKGSTANMSLGGGKSRSLDLAVDAAVKSGIHFAVAA 493

Query: 453 GNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDAT 512
           GNENQDACN+SPA+++ AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD+AT
Sbjct: 494 GNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDEAT 553

Query: 513 ATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDI 572
           ATLSGTSMASPHVAGLL+YFLS+QP +DSEFF  G +S++P QLKKKLI YSTK++  D+
Sbjct: 554 ATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNSISPAQLKKKLIAYSTKNLFQDL 613

Query: 573 PEDTPNVLIYNGGGQDLSAFWNDTKKSHSSG----FKQELNMDEFIGSK---TDLIFDQV 625
           PE TPN+L+YN  G ++S FW    KS SS       +E  +++ + S     D   + +
Sbjct: 614 PEKTPNLLVYN-AGHNISDFWK--PKSESSAEPNERAKEFELEDLVDSAQWIADTWLNGI 670

Query: 626 RDILDKLNI 634
           + + +++++
Sbjct: 671 QQVFERMDL 679

>KNAG0E00920 Chr5 complement(174432..176027) [1596 bp, 531 aa] {ON}
           Anc_6.14 YOR003W
          Length = 531

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/456 (60%), Positives = 333/456 (73%), Gaps = 21/456 (4%)

Query: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240
           N+YII+FK G   E+I  HK+ +QQ  L+              T D S +      + DS
Sbjct: 96  NKYIILFKEGVTAEQISAHKQLLQQVLLE--------------TSDVS-AQGIVADVLDS 140

Query: 241 FNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRER 300
           F+++ + SGY+   +  +++L+R++P V  VE+DS V   EFDTQN+APWGLARISHR+ 
Sbjct: 141 FDLEGVLSGYVAELSPMVLELVRRSPFVQLVEQDSEVHTNEFDTQNNAPWGLARISHRDP 200

Query: 301 LNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTH 360
           L+LGSFNKYLYDD AG GV SY+IDTG+N+ HK+FE RA WGKTIP ND D DGNGHGTH
Sbjct: 201 LSLGSFNKYLYDDAAGEGVDSYIIDTGINVKHKEFEGRAQWGKTIPDNDFDEDGNGHGTH 260

Query: 361 CAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGS 420
           CAGTIASKHYG            LRSNGSG+MSDV+ GVE+               FKGS
Sbjct: 261 CAGTIASKHYGVAKRANVIAVKVLRSNGSGSMSDVIMGVEFAAKQHASKAKSNDKKFKGS 320

Query: 421 TANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSD 480
           TANMSLGGGKSP+LD  V+AAV++G+HF+VAAGNENQDACNTSPA++++AITVGASTLSD
Sbjct: 321 TANMSLGGGKSPSLDRVVDAAVKLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSD 380

Query: 481 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD 540
           DRAYFSNWG CVD+FAPGLNILSTY GSDDATATLSGTSMASPHVAGLLTYFLSLQP   
Sbjct: 381 DRAYFSNWGSCVDIFAPGLNILSTYTGSDDATATLSGTSMASPHVAGLLTYFLSLQPEKS 440

Query: 541 SEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWNDT-KKS 599
           S+F    Q  +TP+QLKKKL+ YSTK +LFD+PEDTPN LIYNGGG DLS FW D  KKS
Sbjct: 441 SQFGTSAQ--ITPEQLKKKLLDYSTKGVLFDLPEDTPNALIYNGGGADLSDFWGDKGKKS 498

Query: 600 HSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635
           H   F  E +    + + +D +F+QVR +  KLNI 
Sbjct: 499 HKPLFAHEYDN---VWASSDAMFEQVRAMFGKLNIF 531

>KAFR0L00360 Chr12 (64781..66289) [1509 bp, 502 aa] {ON} Anc_6.14
           YOR003W
          Length = 502

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/438 (63%), Positives = 327/438 (74%), Gaps = 15/438 (3%)

Query: 161 LAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAF 220
           LAP+      N DA   IIP+RYIIVFK G  +E+I FHKE +    LQ     S +   
Sbjct: 46  LAPV-----HNADA-ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTE 99

Query: 221 FISTKDTSLSTS---EAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIV 277
           ++ T D ++  S     GGI   F+I +L SGYI Y + E++  IR NPL+ F+E D++V
Sbjct: 100 YLQT-DINVPESMRQSLGGIVSDFDISSLLSGYIAYLSDELLHFIRLNPLIAFIEHDTMV 158

Query: 278 EATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337
             T+F+TQN+APWGLARISHRE LNL +FNKYLYDDDAG+ V +YVIDTGV++NH +F  
Sbjct: 159 HTTDFNTQNNAPWGLARISHRESLNLANFNKYLYDDDAGKNVDAYVIDTGVDVNHVEFHS 218

Query: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 397
           RA WGKTIPLND+D+DGNGHGTH AGTI S+HYG            LRSNGSG+MSDVVK
Sbjct: 219 RAHWGKTIPLNDQDIDGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSMSDVVK 278

Query: 398 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQ 457
           GVE+                KGS ANMSLGGGKSPALDLAVNAAV+ GIHFAVAAGNENQ
Sbjct: 279 GVEF-AVSSHLERMKNEKNLKGSVANMSLGGGKSPALDLAVNAAVKAGIHFAVAAGNENQ 337

Query: 458 DACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLS 516
           +ACN+SPASA++A+TVGAST+SD+RAYFSNWG+CVD+FAPGLNILSTYIG+ DD TATLS
Sbjct: 338 NACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNILSTYIGANDDVTATLS 397

Query: 517 GTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDT 576
           GTSMASPHVAGLL Y+LSLQP   SEF      +++  QLKKKLI Y+TKD+L D+PE T
Sbjct: 398 GTSMASPHVAGLLAYYLSLQPEKSSEF---STRAISTSQLKKKLIEYATKDVLEDLPEGT 454

Query: 577 PNVLIYNGGGQDLSAFWN 594
           PNVLIYNGGGQDLS FWN
Sbjct: 455 PNVLIYNGGGQDLSDFWN 472

>Kpol_1045.75 s1045 complement(174970..176403) [1434 bp, 477 aa]
           {ON} complement(174972..176405) [1434 nt, 478 aa]
          Length = 477

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/463 (58%), Positives = 327/463 (70%), Gaps = 22/463 (4%)

Query: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFF-ISTKDTSLSTSEA 234
           S++IP  YI+VF  G  Q EI  H E + Q QLQSV +L  +  FF IST     S    
Sbjct: 32  SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTSSDVNSNGLL 91

Query: 235 GGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLAR 294
           GG++D F I N   GY G FT E+V+ +R +PLV F+ERDS+V  TE  TQ +APWGLAR
Sbjct: 92  GGVRDMFKIGNDLHGYTGMFTDEVVEFLRLSPLVKFIERDSMVHTTEATTQYNAPWGLAR 151

Query: 295 ISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDG 354
           ISHR RLNL +FNKYLYDD  G+GV +YVIDTG+NI + DF  RA WGKTIP  + ++DG
Sbjct: 152 ISHRSRLNLSTFNKYLYDDLGGKGVKAYVIDTGINITNVDFGGRAYWGKTIPAGEANVDG 211

Query: 355 NGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXX 414
           NGHGTH AGTIAS HYG            LRSNG+G+MSDV+KGVEY             
Sbjct: 212 NGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSMSDVLKGVEYVVGAHQRDVGTA- 270

Query: 415 XGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVG 474
            GFKGS ANMSLGGGKS +LDLAVNAAV  G+HFAVAAGNENQDACNTSPA+A++AITVG
Sbjct: 271 -GFKGSVANMSLGGGKSRSLDLAVNAAVGAGVHFAVAAGNENQDACNTSPAAAERAITVG 329

Query: 475 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 534
           ASTLSD RAYFSNWG+CV +FAPGLNILSTYIGS DATATLSGTSMASPH+AGL+ YFLS
Sbjct: 330 ASTLSDSRAYFSNWGQCVSIFAPGLNILSTYIGSPDATATLSGTSMASPHIAGLVAYFLS 389

Query: 535 LQPGSDSEFFELGQ-DSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
           LQP   S+F+  GQ  ++TP QLKKK++ + TK+ L D+P +TPNV+ YNG G+ L  FW
Sbjct: 390 LQPAVKSQFYSQGQATAITPDQLKKKIVAFGTKNALRDLPANTPNVIAYNGAGKSLEDFW 449

Query: 594 --NDTKKSHSSGFKQELNMDEFIGSKTDLIFDQVRDILDKLNI 634
             ND  K++ S                 +I +Q++ IL+K+NI
Sbjct: 450 NANDYVKNYQS----------------LVITEQLQFILNKMNI 476

>Ecym_3018 Chr3 (33738..35465) [1728 bp, 575 aa] {ON} similar to
           Ashbya gossypii ACR012C
          Length = 575

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/475 (57%), Positives = 341/475 (71%), Gaps = 20/475 (4%)

Query: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTK----DTSLST 231
           S+ IP+RYI++FK G    ++  H++ V  A ++++  L    +FF +T+    +   + 
Sbjct: 106 SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEGMHHEGISAR 165

Query: 232 SEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWG 291
           S  GGI++ F I     GY GYFT  ++DLIR++ LV  +E+DSIV A++F+TQ  APWG
Sbjct: 166 SVEGGIEEMFEIAGSLRGYFGYFTDGMLDLIRESGLVKLIEQDSIVHASDFETQTGAPWG 225

Query: 292 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 351
           LAR+SHRERLNLGSFNKYLYDD+AG+GVT+YVIDTG+NI+H +FE RA WGKTIP ND D
Sbjct: 226 LARVSHRERLNLGSFNKYLYDDNAGKGVTAYVIDTGINIDHVEFEGRAQWGKTIPSNDAD 285

Query: 352 LDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXX 411
            DGNGHGTHCAGTIASK YG            LR+NG+GTMSDV++GVEY          
Sbjct: 286 YDGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTMSDVLRGVEYVVAEHRKASG 345

Query: 412 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAI 471
                FKGSTANMSLGGGKS AL+LAV+AAV  GIHFAVAAGNENQDACNTSPAS+ K I
Sbjct: 346 DPN--FKGSTANMSLGGGKSAALELAVDAAVAAGIHFAVAAGNENQDACNTSPASSKKCI 403

Query: 472 TVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTY 531
           TV ASTLSDDRAYFSNWG CVD+FAPGLNILSTYIGSD A ATLSGTSMASPHVAGLL Y
Sbjct: 404 TVAASTLSDDRAYFSNWGSCVDIFAPGLNILSTYIGSDTAVATLSGTSMASPHVAGLLAY 463

Query: 532 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSA 591
           FLSLQP S SE++     S++P+ LKKK++ Y +K++L ++P  T N LI+NGGG  L +
Sbjct: 464 FLSLQPDSGSEYYT--GSSISPEALKKKIVAYGSKNLLNNVPARTANNLIFNGGGGSLDS 521

Query: 592 FWNDT-------KKSHSSG----FKQELNMDEFIGSKTDLIFDQVRDILDKLNII 635
           FWN         K S S G    F+ E  MD  + S +  +F ++R+ LD+L++I
Sbjct: 522 FWNSKCDGCEQEKVSSSHGKADDFESESLMD-CLHSTSHSLFGEIRNFLDRLDLI 575

>Suva_15.178 Chr15 (305907..307337) [1431 bp, 476 aa] {ON} YOR003W
           (REAL)
          Length = 476

 Score =  497 bits (1280), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 238/415 (57%), Positives = 308/415 (74%), Gaps = 5/415 (1%)

Query: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238
           +P RYII F   +    I+ HK  +Q+ Q +SV  L+ +DAFF+ST  ++ S  + GGI 
Sbjct: 67  LPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVST--SAPSDLQFGGID 124

Query: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298
             F+I+ LF GY GYFT+E++  + Q+P++ F+E++S V+ T    Q  APWGL RISHR
Sbjct: 125 SFFDINGLFRGYTGYFTEEVIKRVLQDPIIKFIEQESTVKVTNSTFQEEAPWGLHRISHR 184

Query: 299 ERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358
           E+   G   +YLY+D AGRGVTSYV+DTG++INH+DFE RA+WG  IP NDE  D NGHG
Sbjct: 185 EKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDINHEDFEGRAVWGAVIPDNDEASDLNGHG 244

Query: 359 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFK 418
           THCAG I S+H+G            LRSNG GT+SDV+KG+EY               FK
Sbjct: 245 THCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTVSDVIKGIEYVVKDHIDSSKKGGPKFK 304

Query: 419 GSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTL 478
           GSTAN+SLG  KSPA+++AVNAAVE G+HFA+AAGNE++DAC +SPA A+K+ITVGAST 
Sbjct: 305 GSTANLSLGSSKSPAMEMAVNAAVESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTF 364

Query: 479 SDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPG 538
           SDDRA+FS+WG CVDVFAPG+NILSTYIGS +A+ +LSGTSMA+PHVAG+L+YFLSLQP 
Sbjct: 365 SDDRAFFSDWGTCVDVFAPGVNILSTYIGSRNASLSLSGTSMAAPHVAGILSYFLSLQPS 424

Query: 539 SDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
           SDSEFF+    +++PQQLK+K+I++ST+ +L D+ EDTPN LIYNGGG+ L  FW
Sbjct: 425 SDSEFFD---STVSPQQLKEKIINFSTQGVLGDVGEDTPNRLIYNGGGRKLDNFW 476

>Skud_15.164 Chr15 (291471..292919) [1449 bp, 482 aa] {ON} YOR003W
           (REAL)
          Length = 482

 Score =  487 bits (1254), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 299/418 (71%), Gaps = 3/418 (0%)

Query: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235
           SK +P RYIIVF        I+ H + +Q+AQ  SV  ++ +D+F  +   ++    + G
Sbjct: 66  SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSASASPNPQFG 125

Query: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295
           GI  SF+I+ LF GY GYFT E+++++ Q+PLV F+E +S V  +    Q  APWGL RI
Sbjct: 126 GIDISFDINGLFRGYTGYFTDEVIEIVFQDPLVKFIEHESTVRISNSSRQEDAPWGLHRI 185

Query: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355
           SHRER   G   +YLY+D AG GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 186 SHRERAKYGQDLEYLYEDAAGTGVTSYVLDTGIDTEHEDFEGRAKWGAVIPENDEASDLN 245

Query: 356 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 415
           GHGTHCAG I S+H+G            LRSNG GT+SDV+KG+EY              
Sbjct: 246 GHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTVSDVIKGIEYVAKNHIASSKKRGS 305

Query: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475
            FKGSTAN+SLG  KSPA+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 306 KFKGSTANLSLGSSKSPAMEMAVNAAVDCGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 365

Query: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+Y LSL
Sbjct: 366 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGILSYLLSL 425

Query: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
           QP  DSEFF    D+++PQQLK+K++ +ST+ +L D+ E+TPN L+YNGGG+ L  FW
Sbjct: 426 QPAQDSEFF---YDTVSPQQLKEKILKFSTRGVLGDVNEETPNRLVYNGGGKKLDEFW 480

>TPHA0M00230 Chr13 (45121..46878) [1758 bp, 585 aa] {ON} Anc_6.14
           YOR003W
          Length = 585

 Score =  489 bits (1258), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 255/446 (57%), Positives = 318/446 (71%), Gaps = 15/446 (3%)

Query: 181 NRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDS 240
           +RYIIVFK+G  +E++D H +      + ++    +E+    +    S        + D+
Sbjct: 134 DRYIIVFKKGVFKEQVDQHLK-----MMSALFRRLSEEQRPAAAPGASALRDGFDRVMDT 188

Query: 241 FNIDNLFSGYIGYF-TQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHRE 299
           F +   FSGYI    + +IVD IR NPLVD+VE+DS+V + + +TQN+APWGLARISHRE
Sbjct: 189 FEVAGAFSGYIATVASPKIVDFIRLNPLVDYVEKDSVVHSLD-ETQNNAPWGLARISHRE 247

Query: 300 RLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHG 358
            LNLG+FNKYLY  + AG+GVT+YV+DTG++++H +F +RA WGKTIP+ND D+DGNGHG
Sbjct: 248 GLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHLEFGERAKWGKTIPINDYDIDGNGHG 307

Query: 359 THCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXX----XXXXXX 414
           THCAGTI S+HYG            LRS+GSGTMSDV+KGVE+                 
Sbjct: 308 THCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTMSDVLKGVEWVALEHTKHLEESRKDKN 367

Query: 415 XGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVG 474
             +KG+TANMSLGGGKSPALD AVNAAV+ G+HFAVAAGNENQDACN+SPA+A+ AITVG
Sbjct: 368 SNYKGATANMSLGGGKSPALDQAVNAAVKAGVHFAVAAGNENQDACNSSPAAAENAITVG 427

Query: 475 ASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLS 534
           ASTLSDDRAYFSN+GKCVD+FAPGLNILSTYIG++DATATLSGTSMASPHVAGLLTY LS
Sbjct: 428 ASTLSDDRAYFSNYGKCVDIFAPGLNILSTYIGTNDATATLSGTSMASPHVAGLLTYLLS 487

Query: 535 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWN 594
           LQP   SEF+ +    LTP Q+KKK+I Y+TK+ L D+P DTPN LIYNGG    + FW 
Sbjct: 488 LQPDKGSEFY-VPNSELTPLQMKKKIIDYATKNALADLPADTPNKLIYNGGFNS-TDFWA 545

Query: 595 DTKKSHSSGFK-QELNMDEFIGSKTD 619
                 S   K    ++  F+ S  D
Sbjct: 546 SAAAPQSHKVKTNRYSLGSFLDSIQD 571

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score =  482 bits (1240), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 299/418 (71%), Gaps = 3/418 (0%)

Query: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235
           +++IP RYI+VF      + I+ H++ VQ+A   SV  L+ +D F      +     + G
Sbjct: 64  TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSSSIAPDLQLG 123

Query: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295
           GI  SF+I+ LF GY GYFT EI++L+ Q+PL+ F+E++S V  +    Q  APWGL RI
Sbjct: 124 GIDSSFDINGLFRGYAGYFTDEILNLVSQDPLIKFIEQESTVRLSNTSMQKDAPWGLHRI 183

Query: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355
           SHRE+   G   +YLY+D AGRGVTSYV+DTG++  H+DFE RA+WG  IP NDE  D N
Sbjct: 184 SHREKAKYGQDLEYLYEDAAGRGVTSYVLDTGIDTEHEDFEGRAVWGAVIPGNDEASDLN 243

Query: 356 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 415
           GHGTHCAG I SKHYG            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTVSDVIKGIEYVAREHIESSRKKSK 303

Query: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475
            FKGSTAN+SLG  KS A+++AV+AAV+ G+HFA+AAGNEN+DAC +SPA A K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVDAAVDSGVHFAIAAGNENEDACLSSPAGAQKSITVGA 363

Query: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMA+PHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMAAPHVAGMLSYFLSL 423

Query: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
           QP  DSE+F+   ++L+PQ+LK+K++ +ST  +L DI ++TPN LIYNGGG+ L   W
Sbjct: 424 QPAPDSEYFD---NALSPQELKEKVLKFSTHGVLGDIGDNTPNRLIYNGGGKILDDLW 478

>YOR003W Chr15 (331455..332891) [1437 bp, 478 aa] {ON}  YSP3Putative
           precursor to the subtilisin-like protease III
          Length = 478

 Score =  474 bits (1221), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 231/418 (55%), Positives = 299/418 (71%), Gaps = 3/418 (0%)

Query: 176 SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAG 235
           ++ +P RY+IVF      ++I  H + VQ+    SV  L+  DAF+     +  S S+ G
Sbjct: 64  TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISSSVSSKSQFG 123

Query: 236 GIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARI 295
           GI + F+I+ LF GY GYFT EI+ +I Q+P++ FVE+++ V+ +    Q  APWGL R+
Sbjct: 124 GIDNFFDINGLFRGYTGYFTDEIIKIISQDPIIKFVEQETTVKISNSSLQEEAPWGLHRV 183

Query: 296 SHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGN 355
           SHRE+   G   +YLY+D AG+GVTSYV+DTG++  H+DFE RA WG  IP NDE  D N
Sbjct: 184 SHREKPKYGQDLEYLYEDAAGKGVTSYVLDTGIDTEHEDFEGRAEWGAVIPANDEASDLN 243

Query: 356 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 415
           GHGTHCAG I SKH+G            LRSNG GT+SDV+KG+EY              
Sbjct: 244 GHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTVSDVIKGIEYVTKEHIESSKKKNK 303

Query: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475
            FKGSTAN+SLG  KS A+++AVNAAV+ G+HFA+AAGNE++DAC +SPA A+K+ITVGA
Sbjct: 304 EFKGSTANLSLGSSKSLAMEMAVNAAVDSGVHFAIAAGNEDEDACLSSPAGAEKSITVGA 363

Query: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535
           ST SDDRA+FSNWG CVDVFAPG+NI+STYIGS +AT +LSGTSMASPHVAG+L+YFLSL
Sbjct: 364 STFSDDRAFFSNWGTCVDVFAPGINIMSTYIGSRNATLSLSGTSMASPHVAGILSYFLSL 423

Query: 536 QPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
           QP  DSEFF    D+ +PQ+LK+K++ +ST+ +L DI +DTPN LIYNGGG+ L  FW
Sbjct: 424 QPAPDSEFF---NDAPSPQELKEKVLKFSTQGVLGDIGDDTPNKLIYNGGGKKLDGFW 478

>CAGL0E02651g Chr5 (251868..253325) [1458 bp, 485 aa] {ON} similar
           to uniprot|P25036 Saccharomyces cerevisiae YOR003w YSP3
           or uniprot|P09232 Saccharomyces cerevisiae YEL060c PRB1
          Length = 485

 Score =  409 bits (1052), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 212/416 (50%), Positives = 276/416 (66%), Gaps = 5/416 (1%)

Query: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237
           IIPNRYI++FK     +EI  H   +++    S+     +  F  +T+   +ST    G+
Sbjct: 73  IIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQYNDIST-RGIGL 129

Query: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297
           Q  F+I    +GYIGYFT+     I  +PLV+ VE DSIV    +  Q   PWGL RIS 
Sbjct: 130 QHEFSIGRSMTGYIGYFTETTAKFIANSPLVELVEHDSIVRINNYKMQEHVPWGLGRISQ 189

Query: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357
           RE+L +     Y YDD  G+   ++VIDTG+ ++H+DFE RA WGKTI  ND D D NGH
Sbjct: 190 REKLPILGKRFYHYDDRGGKDTVTFVIDTGIYVDHEDFEGRASWGKTIVENDNDYDLNGH 249

Query: 358 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 417
           GTHCAGTIASKHYG            LRS+GSG+MSDV++GVEY                
Sbjct: 250 GTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSMSDVIRGVEY-TVEAYNDLKKTKSNL 308

Query: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477
           KG+  NMSLG  KS AL+ A++AA   GI FAVAAGNE+ DACN+SPASA   ITVG ST
Sbjct: 309 KGAAGNMSLGAWKSYALNRAMDAAAAAGISFAVAAGNESDDACNSSPASAWSPITVGGST 368

Query: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 537
           LSDD A+FSN+G+CVD+FAPG+NI+STYIGS +AT +LSGTSM+SPHVAG+L Y+LSLQP
Sbjct: 369 LSDDVAFFSNYGRCVDIFAPGVNIMSTYIGSKNATESLSGTSMSSPHVAGVLAYYLSLQP 428

Query: 538 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFW 593
              S+F+     +++P+ LKKK+++Y+T   L  +P +T N+L+YNGGG++LS FW
Sbjct: 429 DHKSQFYH-EHSAISPKILKKKVLNYATNGTLSYLPAETVNLLVYNGGGKNLSKFW 483

>KAFR0B06550 Chr2 (1359770..1361140) [1371 bp, 456 aa] {ON} Anc_6.14
           YOR003W
          Length = 456

 Score =  391 bits (1005), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 201/418 (48%), Positives = 265/418 (63%), Gaps = 21/418 (5%)

Query: 178 IIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGI 237
           II ++YI++FK  A   E + H         + ++N     ++    KD   S       
Sbjct: 59  IIKDQYIVIFKNSAMMAEKELH--------FKQLKNFIKTYSYEWDEKDDHKSN------ 104

Query: 238 QDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297
            + F I    SGYI     E + L+RQ+P+V  +E DS V A +   Q   PWGL+RIS 
Sbjct: 105 LNIFKIGTTLSGYILRGPIETLQLLRQDPIVQLIEPDSKVHALKLKIQEDTPWGLSRISQ 164

Query: 298 RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357
           R R+ +G    Y YDD     VT+YV+DTG+ I+H+ F  RA WGKTI  ND D D +GH
Sbjct: 165 RPRVRIGQDQLYYYDDATSGNVTAYVLDTGIMISHEQFNGRARWGKTIVPNDVDEDNSGH 224

Query: 358 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 417
           GTH AG IAS  +G            LRSNG G MSDV+KG+E+                
Sbjct: 225 GTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDMSDVLKGIEFVVDDHSKNKNYS---- 280

Query: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477
           KGS  N+SLG  KSPAL LA++AA+   IHFAVAAGNEN DAC TSPA A +AITVGAS 
Sbjct: 281 KGSVVNLSLGASKSPALVLAIDAAISENIHFAVAAGNENMDACYTSPADARRAITVGASI 340

Query: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQP 537
            SD+RA+FSNWG+CVDVFAPG+N++STYIGSD+AT +LSGTS A+P+ AGL+ Y+LSLQP
Sbjct: 341 FSDERAFFSNWGECVDVFAPGMNVMSTYIGSDNATLSLSGTSAAAPYTAGLIAYYLSLQP 400

Query: 538 GSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWND 595
             DS +F      +TP +LK+K++ + +KD+L+++PE+TPN++IYNG G++LS FW D
Sbjct: 401 DKDSGYF---TGEMTPSKLKEKIVAFGSKDVLYELPENTPNIVIYNGAGRNLSHFWKD 455

>NCAS0D02630 Chr4 (506222..507577) [1356 bp, 451 aa] {ON} Anc_6.14
          Length = 451

 Score =  356 bits (913), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 190/421 (45%), Positives = 254/421 (60%), Gaps = 26/421 (6%)

Query: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238
           IPN+YI++FK     +  D  +E           +L+  +++        L+T     I 
Sbjct: 53  IPNQYIVLFK----SDTTDIQRET----------HLATLNSWL-------LNTDPQYTIL 91

Query: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298
            SF + +   GY     ++++  +  +P++  +E+DS V A     Q  +PWGLARIS R
Sbjct: 92  HSFQLAHDLQGYTSRLPEQLIRSLATDPIIQSIEQDSYVHALGRQKQIDSPWGLARISQR 151

Query: 299 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTI-PLNDEDLDGNG 356
           ERL L     Y YDD  A      Y++DTG+N NH +F+ RA WG    P+     D NG
Sbjct: 152 ERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHNEFQGRAKWGAVFTPMEPNQEDENG 211

Query: 357 HGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXX-XX 415
           HGTHCAG I S  YG            L + G G MS V++G+EY               
Sbjct: 212 HGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEMSAVIRGIEYVTQQHEQDMKKQDQT 271

Query: 416 GFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA 475
           GFKGS  N+SLG GKSPAL   + AAV++G+HFAVAAGNE+ DAC+TSPA +  A+TVGA
Sbjct: 272 GFKGSVINLSLGAGKSPALLRVIEAAVKLGVHFAVAAGNEDDDACSTSPADSPHALTVGA 331

Query: 476 STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGS-DDATATLSGTSMASPHVAGLLTYFLS 534
           S+ SDDR +FSNWG CVDVFAPG+NI+STYIG  ++ T +LSGTSM++P V GL+ YFLS
Sbjct: 332 SSFSDDRVFFSNWGPCVDVFAPGINIMSTYIGPHNNETTSLSGTSMSAPFVTGLIAYFLS 391

Query: 535 LQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQDLSAFWN 594
           LQP + S+F+  G  S TP QLK K+I +ST+ +L +IPE TPN ++YNGGG  L  FWN
Sbjct: 392 LQPDTKSQFYT-GITSPTPYQLKYKIISFSTEGVLHEIPEGTPNRIVYNGGGHSLKDFWN 450

Query: 595 D 595
           +
Sbjct: 451 N 451

>NDAI0I02280 Chr9 complement(519169..520617) [1449 bp, 482 aa] {ON} 
          Length = 482

 Score =  325 bits (834), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 187/431 (43%), Positives = 258/431 (59%), Gaps = 24/431 (5%)

Query: 179 IPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQ 238
           IP++YI++F+      +I   ++ +     +  +  +  D +        +S    G I 
Sbjct: 63  IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNYSKVLSRFQISNDTKGMI- 121

Query: 239 DSFNIDNLFSGYIGYFTQEIVD-LIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH 297
                       I  F +++ + +     ++  +ERDS V   +F TQ  + WGL+RIS 
Sbjct: 122 --------IRAPIDDFLEDVKNNIFNYQKIIKIIERDSYVHMNKFTTQIDSSWGLSRISQ 173

Query: 298 RERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGN 355
           R  L L     Y YDD+ +G+GV  Y++DTG+N NH +FE RA WG ++P+ +  L D N
Sbjct: 174 RNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHIEFEGRASWGVSLPVTEPSLEDSN 233

Query: 356 GHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXX 415
           GHGTHCAG I SK YG            L   G G+MSDV+ G+E+              
Sbjct: 234 GHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSMSDVILGLEFVANSHTNKTNNISS 293

Query: 416 G------FKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADK 469
                  FKGS  N+SLG  KSP+LD+A+ +A ++GIH  VAAGNE++DAC TSPA +  
Sbjct: 294 SSSVHSEFKGSVVNLSLGAPKSPSLDIALESAKKIGIHITVAAGNEDEDACMTSPADSPA 353

Query: 470 AITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGL 528
            ITVGAS+ SDDRA+FSNWG CVDVFAPG+NI STYIG +++ T +LSG+SM+SP V+GL
Sbjct: 354 VITVGASSFSDDRAFFSNWGPCVDVFAPGINIKSTYIGPNNNETLSLSGSSMSSPFVSGL 413

Query: 529 LTYFLSLQPGSDSEFFELGQDSL-TPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQ 587
             Y+LSLQP   S+F     DSL TP QLK+K+I +ST  +L ++P DT N L+YNGGG+
Sbjct: 414 TAYYLSLQPDVSSQF----HDSLMTPDQLKRKIIDFSTNGMLKELPLDTANKLVYNGGGK 469

Query: 588 DLSAFWNDTKK 598
           DLS FWN T+K
Sbjct: 470 DLSGFWNATRK 480

>KNAG0F02970 Chr6 (563666..564928) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score =  311 bits (797), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 171/411 (41%), Positives = 238/411 (57%), Gaps = 32/411 (7%)

Query: 203 VQQAQLQSVENLSAEDAFFISTKDTSLS-------------------TSEAGGIQ----D 239
           V  A +  + +LS E  FF+S K T L+                   +  AG       +
Sbjct: 16  VYGAAVPPLADLSGEHRFFMSGKSTILNEFLVMFKPMVDREEVEVGLSVLAGRFPLAQFE 75

Query: 240 SFNI-DNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISHR 298
            F+I D L    +  F    V  + Q P V+ VE +S V A     Q   PWGL R+S R
Sbjct: 76  QFHIADELIGFTVKNFPFHNVYFLLQIPFVEMVETNSKVYALNVTVQEDVPWGLMRLSQR 135

Query: 299 ERLNLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGH 357
           +R+ +G    Y YD   + + V  Y++DTG+ ++H++FE RA WGKTI  ND D D NGH
Sbjct: 136 DRVRIGDEQVYRYDTRGSAKDVNVYILDTGIQVDHEEFEGRARWGKTIAWNDPDRDDNGH 195

Query: 358 GTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGF 417
           GTHCAG +    YG            L + G G MSDV++G+E+                
Sbjct: 196 GTHCAGIVGGATYGVAKEANLIAVKVLHATGDGEMSDVIRGIEFAVNEHLTRNQDE---V 252

Query: 418 KGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGAST 477
           +GS  N+SLG G+SPAL   V AA+  G+HFAVAAGNE+ +AC +SPA+ D  +TVG ST
Sbjct: 253 RGSIINLSLGAGESPALQRVVTAALNKGVHFAVAAGNEDDNACYSSPANIDGVVTVGGST 312

Query: 478 LSDDRAYFSNWGKCVDVFAPGLNILSTYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQ 536
            SDDRA+FSNWG C+DVFAPG+N+ S+Y+G + + T +LSGTS ++PHVAGL+ Y LSL+
Sbjct: 313 FSDDRAFFSNWGPCIDVFAPGVNVKSSYVGAAKNKTLSLSGTSTSAPHVAGLMAYLLSLE 372

Query: 537 PGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNGGGQ 587
           P + S+F     +   P QLK+KL+  +T+  LF++P+DT N++I+NG  Q
Sbjct: 373 PDTKSQFHTAWSN---PAQLKQKLVSLATEGKLFEVPDDTANLMIFNGVKQ 420

>CAGL0L13266g Chr12 (1418408..1420147) [1740 bp, 579 aa] {ON} some
           similarities with uniprot|P09232 Saccharomyces
           cerevisiae YEL060c or uniprot|P25036 Saccharomyces
           cerevisiae YOR003w YSP3
          Length = 579

 Score =  308 bits (788), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 169/447 (37%), Positives = 257/447 (57%), Gaps = 16/447 (3%)

Query: 156 RHHNRLAPLVSTAQFNPDAISKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLS 215
           R  N  APLV+    N +  + I+P RYI++FK  A   EI  H + V + QL+   +L+
Sbjct: 46  RPGNVKAPLVAPLGENDEIQNNIVPYRYIVMFKNFAYTNEIKLHIQTVAKLQLRGSISLA 105

Query: 216 AEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDS 275
             D FF  T+D   ST E GG+  +F+I + F+GY+GYFT E+V+ IR+  +VD+VE DS
Sbjct: 106 PNDPFFHHTRDKEFSTEELGGVLYTFDIGSGFNGYVGYFTDEVVEFIRKQSIVDYVEMDS 165

Query: 276 IVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 335
           I+   + +T +++ W LARISHR +L L +FN+Y +D + G+ + +Y++DTGV   H  +
Sbjct: 166 ILTIDDKETDSNSHWHLARISHRPKLGLSNFNEYKFDPNGGQNIDAYILDTGVYQTHAYY 225

Query: 336 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 395
            +R I G  I  N+++ D NGHGT  AG +  +  G            L   G GT+S++
Sbjct: 226 IERTIRGIVITPNEDERDMNGHGTEMAGLVGGREVGVARKATLIDVKVLNWQGRGTVSNI 285

Query: 396 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNE 455
           +KG+ +              G  G+    S+ G KS +L+ A +  V  GIH  V AG +
Sbjct: 286 IKGLSF--VNHHHPQRIEKNGVLGAVVLFSISGAKSRSLNTAFDKMVSSGIHVVVGAGTK 343

Query: 456 NQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATAT- 514
             +ACN+SPAS+ K ITV   +++D+     NWG CVD++ PG  + +TY   +    T 
Sbjct: 344 GINACNSSPASSSKPITVAGMSITDEPIDRGNWGSCVDIYGPGDRVRTTYPNLERNQFTN 403

Query: 515 ---LSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQD---SLTPQQLKKKLIHYSTKDI 568
              ++G+S A+  VAGLL YF SLQPG       LG      LTP++LK++LI + TK  
Sbjct: 404 EISVTGSSAAAAQVAGLLAYFASLQPG-------LGTPDVIPLTPEELKERLIDFGTKGK 456

Query: 569 LFDIPEDTPNVLIYNGGGQDLSAFWND 595
           L ++   +PN++ +NG G +L +F+ND
Sbjct: 457 LTNLERMSPNIIAFNGAGGNLDSFFND 483

>ZYRO0D08822g Chr4 (754340..755812) [1473 bp, 490 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 490

 Score =  184 bits (467), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 131/380 (34%), Positives = 175/380 (46%), Gaps = 64/380 (16%)

Query: 247 FSGYIGYFTQEIVDLIRQNPLV-------DFVERDSIVEATEFD---------------- 283
           F G     +Q++V+ IR NPLV        F   D ++   E                  
Sbjct: 61  FRGITVDISQDVVEKIRNNPLVADLVPNIQFKAFDDVLGVQELQQNYHGDNLDDEDGFNP 120

Query: 284 ----TQNSAPWGLARISHRERLNLG---------SFNKYLYDDDAGRGVTSYVIDTGVNI 330
                Q  AP  LAR+S R  L            SFN Y Y    GR + +Y+IDTG+  
Sbjct: 121 FKVKVQGEAPRHLARLSRRAPLPYEFDDELRYEESFNYYYYKWHKGRNINAYIIDTGIYK 180

Query: 331 NHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSG 390
            HKDF  RAI+G+     +   D NGHGTH AG + S ++G            L + G G
Sbjct: 181 EHKDFCGRAIFGRDF-TGEGPGDRNGHGTHVAGIVGSSNFGVAKKVNLIEVKALNNRGQG 239

Query: 391 TMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAV 450
            ++ V+  VE+              G KG  AN+SLG  ++  ++ A+ AA E G+   V
Sbjct: 240 NLTTVISAVEFAVNHCKSS------GKKGCVANLSLGAVRNSVINQAIKAAHEAGLIIVV 293

Query: 451 AAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 509
           AAGN N +AC  SPASA +AITVGA    +D  A FSNWG CVD+FA G+ + S      
Sbjct: 294 AAGNSNINACWNSPASAPEAITVGAFDDRTDTIAKFSNWGPCVDIFASGVKVKSLSAFPP 353

Query: 510 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI- 568
                 SGTSMASP V GL+   L                 + P+ +K KL+  +T D+ 
Sbjct: 354 HKPIAFSGTSMASPSVTGLVAILL--------------DKGVEPENIKAKLVELATHDLL 399

Query: 569 ----LFDIPEDTPNVLIYNG 584
               LF  P  TPN + +NG
Sbjct: 400 QRRTLFFKP-GTPNRIAFNG 418

>NCAS0D04390 Chr4 complement(836796..838274) [1479 bp, 492 aa] {ON}
           Anc_6.313
          Length = 492

 Score =  179 bits (455), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 143/393 (36%), Positives = 196/393 (49%), Gaps = 73/393 (18%)

Query: 237 IQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATE-------------FD 283
           I  +F+I + F G+    T ++++ I++NPLV  V  +  V A E             FD
Sbjct: 58  IGKTFSIGS-FKGFTVDLTDDLLEAIKKNPLVSDVVPNLRVHAFEDVKDEEGDDDGGQFD 116

Query: 284 -----------TQNSAPWGLARISHRERL---------NLGSFNKYLYDDDA-GRGVTSY 322
                       Q  AP  LAR+S R++L          L S  KY YD  + G  V +Y
Sbjct: 117 NKMQKGKCSVKVQYGAPRHLARLSRRKQLPYDFEDKEAYLDSL-KYFYDKRSQGASVNAY 175

Query: 323 VIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXX 381
           +ID+G+ + H++F  RAI G  I L  E   D NGHGTH AG + SK YG          
Sbjct: 176 IIDSGIYLEHEEFNGRAIPG--IDLTGEGSGDYNGHGTHVAGIVGSKSYGVAKKVKLIEI 233

Query: 382 XXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKG-STANMSLGGGKSPALDLAVNA 440
             L   G G+++ V+ G+E+                KG   AN+SLG  ++  L+ A+ A
Sbjct: 234 KVLNRLGQGSLAMVLGGIEFAVKHCQETSK------KGRCVANLSLGSMRTAILNKAIKA 287

Query: 441 AVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFA 496
           A++ G+   VAAGN N +AC  SPASA +AITVGA    DDR    A FSNWG+C+D+FA
Sbjct: 288 AIDAGLVVVVAAGNNNLNACWYSPASAPEAITVGAF---DDRIDAIAKFSNWGQCLDIFA 344

Query: 497 PGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFELGQDSL 551
           PG+ I S  I  D    T SGTSMASP VAGL    L+L  G  +E       E+G D++
Sbjct: 345 PGVVIKSLSIFKDKEDVTYSGTSMASPTVAGLAA--LTLDQGVSAEEVKDYILEMGTDNV 402

Query: 552 TPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNG 584
                      +  + +LF     TPN + +NG
Sbjct: 403 -----------FHRRSLLF--KPGTPNKICFNG 422

>Suva_3.84 Chr3 complement(121533..123116) [1584 bp, 527 aa] {ON}
           YCR045C (REAL)
          Length = 527

 Score =  180 bits (456), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 167/325 (51%), Gaps = 36/325 (11%)

Query: 276 IVEATEFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDT 326
           I EA     Q  AP  LARIS   +L             FN Y  D+  G+GV +Y++DT
Sbjct: 152 IDEAQNVTYQPDAPRHLARISRHHQLPFDLEDKDRYKSWFNYYYEDEYQGQGVNAYIMDT 211

Query: 327 GVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLR 385
           G++  H +FE R I G  + L  E   D NGHGTH AG + S+ +G            L 
Sbjct: 212 GIHAEHPEFEDRVIQG--VDLTKEGFGDENGHGTHVAGLVGSRTFGAAKKVSLVEVKVLG 269

Query: 386 SNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVG 445
            +GSG  S+V+ G+E+                K   AN+SLG  +SP +++AV  A+E G
Sbjct: 270 KDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEG 326

Query: 446 IHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILST 504
           I F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S 
Sbjct: 327 IVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESL 386

Query: 505 YIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYS 564
              +D+ +  LSGTSM++P V G+    LS                + P+ + +++ + S
Sbjct: 387 SHLNDNESLVLSGTSMSTPIVTGVAAVLLS--------------KGIEPELIAQEIEYLS 432

Query: 565 TKDI-----LFDIPEDTPNVLIYNG 584
           T+++     LF  P  TPN ++YNG
Sbjct: 433 TRNVFHRRTLFFKP-STPNQILYNG 456

>Smik_3.149 Chr3 complement(206258..207733) [1476 bp, 491 aa] {ON}
           YCR045C (REAL)
          Length = 491

 Score =  179 bits (453), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 163/316 (51%), Gaps = 36/316 (11%)

Query: 285 QNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNINHKDF 335
           Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++DTG+  +H +F
Sbjct: 125 QSDAPRHLARISRHYQLPFDIEDKERYKSWFNYYYEDDYQGQDVNAYIMDTGIFADHPEF 184

Query: 336 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 394
           E R I G  I L  E   D NGHGTH AG + SK YG            L  +GSG  S+
Sbjct: 185 EDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKVLGKDGSGEASN 242

Query: 395 VVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGN 454
           V+ G+E+                K   AN+SLG  +SP +++AV  A+E GI F  AAGN
Sbjct: 243 VLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGN 299

Query: 455 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 513
            N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I S    + + T 
Sbjct: 300 FNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIESLSHLNFNDTL 359

Query: 514 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI----- 568
            LSGTSM++P V G+    LS                + P+ + ++L + ST+++     
Sbjct: 360 VLSGTSMSTPIVTGVAAVLLS--------------KGIEPEMIAQELEYLSTRNVFHRRT 405

Query: 569 LFDIPEDTPNVLIYNG 584
           LF  P  TPN ++YNG
Sbjct: 406 LFFKPS-TPNQILYNG 420

>SAKL0A02002g Chr1 (176105..177544) [1440 bp, 479 aa] {ON} similar
           to uniprot|P25381 Saccharomyces cerevisiae YCR045C
           Hypothetical ORF
          Length = 479

 Score =  177 bits (448), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 184/390 (47%), Gaps = 49/390 (12%)

Query: 221 FISTK--DTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVD--------- 269
           F+ +K  D SL +  +  I  +F+    F G+   F ++ V+ +++NPLV          
Sbjct: 34  FMESKIGDMSLKSFVSTRISKTFSFGK-FEGFTADFPKDFVEKLKKNPLVADVVPNSVFN 92

Query: 270 -FVERDSIVE--ATEFDTQNSAPWGLARISHRERLNLGS-------FNKYLYDDDAGRGV 319
            F +++ I E  +  +  Q  AP  LAR+S R  L           FN Y      G  V
Sbjct: 93  VFDQKEQIAEEYSRRYKVQEDAPRHLARLSRRGPLPYSEEDGWYQEFNYYYDRKHRGDSV 152

Query: 320 TSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXX 379
            +Y+IDTG+   HKD   RA +G  + + +   D NGHGTH AG + S+ +G        
Sbjct: 153 NAYIIDTGIYKQHKDLGGRAYFGADM-VGEGPGDYNGHGTHVAGIVGSRTFGVAKKVNLV 211

Query: 380 XXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVN 439
               L + G G ++ V+  +E+                    AN+SLG  ++  L+ AV 
Sbjct: 212 EVKALNAKGQGNLTSVISSIEFSVNHCKKSGML-------CVANLSLGSLRNTVLNQAVE 264

Query: 440 AAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPG 498
           AAVE G+   VAAGN N +AC  SPASA  AITVGA    +D  A FSNWG CVDVFA G
Sbjct: 265 AAVESGLVVVVAAGNSNVNACWNSPASAISAITVGAFDDRTDTIAKFSNWGMCVDVFASG 324

Query: 499 LNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKK 558
           + ++S            SGTSMASP VAGL    L                 + P  +K+
Sbjct: 325 VKVMSLSNMPPFKPVAYSGTSMASPSVAGLAAVLL--------------DSGIDPPDIKQ 370

Query: 559 KLIHYSTKDIL----FDIPEDTPNVLIYNG 584
           K+I  +T+++           TPN + +NG
Sbjct: 371 KIIDLATENVFQKRTLVFKPGTPNRIAFNG 400

>Kpol_1028.61 s1028 (138312..139868) [1557 bp, 518 aa] {ON}
           (138312..139868) [1557 nt, 519 aa]
          Length = 518

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 156/321 (48%), Gaps = 40/321 (12%)

Query: 283 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 333
           + Q  AP  L RIS R +L            F  Y Y+D   G  + +Y++DTG+   H 
Sbjct: 152 NVQYGAPRHLGRISSRGQLPFDIRNENEFKEFIHYYYEDQFKGSNIAAYILDTGIYAEHP 211

Query: 334 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 393
           DFE R I G  +   +   D NGHGTH AG + SK +G            L   GSG ++
Sbjct: 212 DFENRVIVGADMT-GEGPGDSNGHGTHVAGILGSKTFGVAKNVTLVEVKVLTGRGSGNLT 270

Query: 394 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAG 453
            V+ G+++                K   ANMSLG  ++  ++ A++ A + G+   VAAG
Sbjct: 271 TVLSGIQFAVDHCRLMRETQG---KQCVANMSLGTVRNNIINAAIHEAFKAGLIMVVAAG 327

Query: 454 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIG 507
           N N  AC TSPASA  AITVGA    DDR    AYFSNWG CVD+FAPG+ I  LS    
Sbjct: 328 NSNVSACWTSPASAKNAITVGA---FDDRTETIAYFSNWGACVDIFAPGVKIRSLSNSPE 384

Query: 508 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 567
           S     T SGTSMASP VAGL    L                 + P  +K KL+H STKD
Sbjct: 385 SHHKHVTHSGTSMASPVVAGLAAILL--------------DKGVEPFDVKDKLLHLSTKD 430

Query: 568 IL----FDIPEDTPNVLIYNG 584
           +           TPN + YNG
Sbjct: 431 VFNKLTLFFKYGTPNKIAYNG 451

>YCR045C Chr3 complement(208135..209610) [1476 bp, 491 aa] {ON}
           RRT12Probable subtilisin-family protease with a role in
           formation of the dityrosine layer of spore walls;
           localizes to the spore wall and also the nuclear
           envelope and ER region in mature spores
          Length = 491

 Score =  175 bits (443), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 137/409 (33%), Positives = 193/409 (47%), Gaps = 66/409 (16%)

Query: 221 FISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEAT 280
           F S  + S        I+  F+I + F G     ++ +V+ ++++PLV  +  +   EA 
Sbjct: 33  FTSNSNRSWRQFIDNKIEKKFSIGS-FRGVTMNLSKNLVNKLKKSPLVADIVPNFRFEAF 91

Query: 281 EFDTQNSA-----------------------------PWGLARISHRERLNL-------- 303
           E D+ NSA                             P  LARIS   +L          
Sbjct: 92  EGDSVNSAESSYTFNATAKYSYEDVEEEQNITYQPDAPRHLARISRHYQLPFDVGDKDRY 151

Query: 304 -GSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHC 361
              FN Y   D  G+ V +Y++DTG+  +H +FE R I G  I L  E   D NGHGTH 
Sbjct: 152 KSWFNYYYEHDYQGQDVNAYIMDTGIFADHPEFEDRVIQG--IDLTKEGFGDQNGHGTHV 209

Query: 362 AGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGST 421
           AG + SK YG            L  +GSG  S+V+ G+E+                K   
Sbjct: 210 AGLVGSKTYGAAKRVNLVEVKVLGKDGSGEASNVLSGLEFIVEHCTKVSRPQG---KKCV 266

Query: 422 ANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSD 480
           AN+SLG  +SP +++AV  A+E GI F  AAGN N DA   SPASA+  ITVGA     D
Sbjct: 267 ANLSLGSFRSPIINMAVEGAIEEGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHID 326

Query: 481 DRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSD 540
             A FSNWG CV++FAPG+ I S    + + T  LSGTSM++P V G+    LS      
Sbjct: 327 TIAKFSNWGPCVNIFAPGVEIESLSHLNYNDTLILSGTSMSTPIVTGVAAILLS------ 380

Query: 541 SEFFELGQDSLTPQQLKKKLIHYSTKDI-----LFDIPEDTPNVLIYNG 584
                     + P+ + +++ + ST+++     LF  P  TPN ++YNG
Sbjct: 381 --------KGIEPEMIAQEIEYLSTRNVFHRRTLFFKP-STPNQILYNG 420

>TDEL0A07280 Chr1 complement(1276408..1277718) [1311 bp, 436 aa]
           {ON} Anc_6.313 YCR045C
          Length = 436

 Score =  173 bits (439), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 137/427 (32%), Positives = 196/427 (45%), Gaps = 80/427 (18%)

Query: 202 NVQQAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDL 261
           N + A+LQS++      +FF    D  +  + + G   + +ID           +++VD 
Sbjct: 37  NFKSARLQSIK------SFF----DCKVRRTFSFGSFRALSID---------VPRDLVDR 77

Query: 262 IRQNPLV-------DFVERDS-IVEATEFDT-----QNSAPWGLARISHRERLNL----- 303
           IR++PLV        FV  D    E   F++     Q  AP  L+R+S R +L       
Sbjct: 78  IRRSPLVAEVVPNIQFVAYDEHDFEGWNFNSRFIRRQRGAPRHLSRLSRRSQLPYDFEEE 137

Query: 304 -----GSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL------ 352
                GSFN Y  +   G G+ +Y+IDTG+   H +F  RA++G       EDL      
Sbjct: 138 DDNYEGSFNYYYDNKHRGDGINAYIIDTGIYKEHAEFGGRAVFG-------EDLTGEGPG 190

Query: 353 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXX 412
           DGNGHGTH AG + S  YG            L + G G ++ V+  +E+           
Sbjct: 191 DGNGHGTHVAGIVGSSKYGVAKDITLVEVKALTAKGQGNLTTVISAMEFAVNHCRSSEG- 249

Query: 413 XXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAIT 472
                KG   N+SLG  ++  ++ AV AA E GI   VAAGN N +AC  SPASA +AIT
Sbjct: 250 -----KGCVINLSLGAIRNSVINQAVKAAHEAGIVVVVAAGNSNINACLNSPASAPEAIT 304

Query: 473 VGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTY 531
           VGA    +D  A FSNWG CVD+FAPG+ + S            SGTSMASP + GL   
Sbjct: 305 VGAFDDRTDSIAKFSNWGSCVDIFAPGVRVKSLASAPHLKPILFSGTSMASPSITGLAAI 364

Query: 532 FLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNVLIYNGGGQ 587
            L               + +   ++K  ++  +T D+           TPN + +NG  +
Sbjct: 365 LL--------------DEGVPYDKIKDYILKMATNDVFQRRTLVFKPGTPNRVAFNGVKK 410

Query: 588 DLSAFWN 594
           +   F N
Sbjct: 411 NDDKFSN 417

>Skud_3.124 Chr3 complement(192464..194086) [1623 bp, 540 aa] {ON}
           YCR045C (REAL)
          Length = 540

 Score =  174 bits (440), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 123/327 (37%), Positives = 165/327 (50%), Gaps = 36/327 (11%)

Query: 274 DSIVEATEFDTQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVI 324
           + I EA     Q+ AP  LARIS   +L             FN Y  DD  G+ V +Y++
Sbjct: 163 EDIDEAQNITYQSDAPRHLARISRHYQLPFDIEDKNRYKSWFNYYYEDDYLGQDVNAYIM 222

Query: 325 DTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXX 383
           DTG+  +H +FE R I G  I L  E   D NGHGTH AG + SK YG            
Sbjct: 223 DTGIFSDHPEFEDRVIQG--IDLTKEGFGDQNGHGTHVAGLVGSKTYGAAKKVNLVEVKV 280

Query: 384 LRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVE 443
           L  +GSG  S+V+ G+E+                K   AN+SLG  +SP +++AV  A+E
Sbjct: 281 LGKDGSGEASNVLSGLEFIVEHCTRVSRPQG---KKCVANLSLGSFRSPIINMAVEGAIE 337

Query: 444 VGIHFAVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNIL 502
            GI F  AAGN N DA   SPASA+  ITVGA     D  A FSNWG CV++FAPG+ I 
Sbjct: 338 EGIVFVAAAGNFNLDAYWASPASAENVITVGAFDDHIDTIAKFSNWGPCVNIFAPGVEIE 397

Query: 503 STYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIH 562
           S    + + T  LSGTSM++P V G+    LS                + P  + +++ +
Sbjct: 398 SLSHLNYEDTLILSGTSMSTPIVTGVAAVLLS--------------KGIEPALIAQEIEY 443

Query: 563 YSTKDI-----LFDIPEDTPNVLIYNG 584
            ST+++     LF  P  T N ++YNG
Sbjct: 444 LSTRNVFHRRTLFFKPS-TANQILYNG 469

>KNAG0I02470 Chr9 complement(479068..480495) [1428 bp, 475 aa] {ON}
           Anc_6.313 YCR045C
          Length = 475

 Score =  171 bits (434), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 136/406 (33%), Positives = 185/406 (45%), Gaps = 54/406 (13%)

Query: 208 LQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPL 267
           L ++ + S  + F  S     L     G I   F I  L  G     + +++D I+++P 
Sbjct: 23  LVTLNDDSRSERFMNSVLSKDLKWFMGGKINKRFQIGEL-KGLTMNLSHDVLDKIKRHPF 81

Query: 268 VDFVERDSIVEATEFDT------------QNSAPWGLARISHRERLNLGSFNK------- 308
           V  V  + +V+A E D             Q  AP  LARIS R +L     NK       
Sbjct: 82  VKEVVPNIMVKAFEGDAVEDESWLPKMKRQRGAPRHLARISRRMQLPYDMNNKTRYRDSF 141

Query: 309 -YLYDDDA-GRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIA 366
            Y YD  A G    +Y++DTGV  +HK+FE R  +G       E  D NGHGTH AG + 
Sbjct: 142 NYYYDRWAQGATTRAYILDTGVMRDHKEFEDRVEFGTDCTGEGEG-DLNGHGTHVAGLVG 200

Query: 367 SKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSL 426
           SK +G            L + G+GT+  ++  +E+                     NMSL
Sbjct: 201 SKTFGVAKHVQLVDVKCLDALGAGTLVSILSALEFAVQDCQEHEDSQ------CVLNMSL 254

Query: 427 GGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR---- 482
           G  KS  L+ A+N   + GI   VAAGN N +AC TSP+SA  AITVGA    DDR    
Sbjct: 255 GSVKSNILNQAINEVEKKGIVVVVAAGNFNMNACWTSPSSATGAITVGA---FDDRFDTI 311

Query: 483 AYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE 542
           A FSNWG CVD+FAPG+N+ S       +    SGTSMASP V G++   L         
Sbjct: 312 AKFSNWGPCVDIFAPGVNVASLVNRDWPSFVKYSGTSMASPIVCGMVALLLD-------- 363

Query: 543 FFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNVLIYNG 584
                 D + P+ ++  L   +T  +           TPN ++YNG
Sbjct: 364 ------DGVPPEDIRDYLQELATDGVFKKRTLVFKPGTPNSVLYNG 403

>Kpol_1018.5 s1018 (14365..15762) [1398 bp, 465 aa] {ON}
           (14365..15762) [1398 nt, 466 aa]
          Length = 465

 Score =  167 bits (424), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 159/320 (49%), Gaps = 47/320 (14%)

Query: 285 QNSAPWGLARISHRERL-----NLGSF-NKYLYDDDA---GRGVTSYVIDTGVNINHKDF 335
           Q  AP  L+R+S R +L     N+  + N + Y  DA   G  V +Y+IDTG+   H +F
Sbjct: 115 QREAPRHLSRLSRRGQLPYDINNIDRYDNAFDYYFDAKYQGSSVNAYIIDTGIYKEHPEF 174

Query: 336 EKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 394
           E R  +   I L  E   D NGHGTH AG + SK +G            L   G G +S 
Sbjct: 175 EGRVKFA--IDLTQEGPGDENGHGTHIAGIVGSKTFGVAKKVNIIDVKALDKKGQGQLST 232

Query: 395 VVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGN 454
           ++K +E+                K   AN+S G  ++  +D A+  A   GI   VAAGN
Sbjct: 233 ILKALEFTIRHCKESVD------KKCVANLSFGAIRTAIIDEAIKEAHNAGIVLVVAAGN 286

Query: 455 ENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNI--LSTYIGS 508
            N DAC  SPAS+   ITVGA    DDR    A FSNWG CVDVFAPG+ +  LS   GS
Sbjct: 287 SNIDACWNSPASSKDVITVGAF---DDRTETIARFSNWGSCVDVFAPGVKVKSLSHINGS 343

Query: 509 DDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDI 568
           D     LSGTSMASP V+G+    L                 L P+ +K K+I  STK+I
Sbjct: 344 D--VLLLSGTSMASPSVSGIAAILL--------------DKGLNPKFVKSKIIESSTKNI 387

Query: 569 L----FDIPEDTPNVLIYNG 584
                  I  +TPN++++NG
Sbjct: 388 FHQGTIMIKPNTPNLIVFNG 407

>KAFR0J02450 Chr10 complement(469452..470888) [1437 bp, 478 aa] {ON}
           Anc_6.313 YCR045C
          Length = 478

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 127/360 (35%), Positives = 176/360 (48%), Gaps = 55/360 (15%)

Query: 256 QEIVDLIRQNPLVDFVERDSIVEATEFD--------------TQNSAPWGLARISHRERL 301
           Q+I++ ++QNPLV  +  + + +A E D               Q+ AP  LARIS R++L
Sbjct: 76  QKIMEKLKQNPLVADIVPNILFKAFENDELNNEQTQEYVSHVVQSEAPRHLARISRRDKL 135

Query: 302 -----NLGS----FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL 352
                N+ S    FN Y   +  G  V +Y++D+GV+ N  DFE R  +G      D + 
Sbjct: 136 PYDFTNVSSYKKSFNYYYGKEHKGADVRAYILDSGVSRNLTDFEGRVEFGFDFT-GDGEG 194

Query: 353 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXX 412
           D NGHGTH AG + SK YG            L   G GT+  V+  +E+           
Sbjct: 195 DSNGHGTHVAGLVGSKTYGVAKGVTMVDVKCLDEIGFGTLITVLSAIEFAVNDCHEHPE- 253

Query: 413 XXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAIT 472
                K   AN+SLG  K+  ++ A+ AA E G+   VAAGN N +AC TSPASA++AIT
Sbjct: 254 -----KRCVANLSLGSFKNAIINKAIQAATEDGVVMVVAAGNFNINACWTSPASAEEAIT 308

Query: 473 VGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGL 528
           VGA    DDR    A FSNWG CVD++APG+ + S          + SGTSMASP V G 
Sbjct: 309 VGA---FDDRIDTIAKFSNWGPCVDIYAPGVAVESLANFPMVKNISYSGTSMASPIVCGQ 365

Query: 529 LTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL----FDIPEDTPNVLIYNG 584
           +   L     +D               +K  LI  +T D+          +TPN +++NG
Sbjct: 366 VAILLDKGIPND--------------DIKSTLIKMATDDVFQKRTLLFKPNTPNRVLFNG 411

>TBLA0F03970 Chr6 complement(985334..987538) [2205 bp, 734 aa] {ON}
           Anc_6.313 YCR045C
          Length = 734

 Score =  171 bits (434), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 116/306 (37%), Positives = 150/306 (49%), Gaps = 48/306 (15%)

Query: 280 TEFDTQNSAPWGLARISHRERL-----NLGSFNK---YLYDD-DAGRGVTSYVIDTGVNI 330
           ++F  Q  AP  LARIS R++L     N   F +   Y YDD D G GV +YVIDTG+  
Sbjct: 282 SKFKVQRGAPRHLARISTRDKLPFNFRNANQFEEQLNYYYDDNDKGEGVLAYVIDTGILK 341

Query: 331 NHKDFEKRAIWGKTIPLNDEDLDG------NGHGTHCAGTIASKHYGXXXXXXXXXXXXL 384
            HKDFE R  +G        DL G      NGHGTH AG I SK YG            +
Sbjct: 342 EHKDFEDRVEFGT-------DLTGEGAGDLNGHGTHVAGLIGSKTYGVDKKVKIIDVKAV 394

Query: 385 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEV 444
              GS  +S +++ +EY                K    NMSLG      ++ AV +A+  
Sbjct: 395 SLTGSTQLSHIIEAIEYTVNDCNSRVDK-----KACVVNMSLGSFYVKVINEAVESAIAE 449

Query: 445 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLN 500
           G+ F VAAGN N DAC +SP S+  AITVGA    DDR    A FSNWG+CVD+FA G+ 
Sbjct: 450 GVVFVVAAGNNNIDACWSSPGSSKNAITVGA---FDDRLDVIAKFSNWGECVDIFASGVE 506

Query: 501 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKL 560
           + S            SGTSMASP V G ++  LS                + P  +++++
Sbjct: 507 VKSLSSQVPYKYIKYSGTSMASPIVCGFVSILLS--------------QGVKPNDVQEEM 552

Query: 561 IHYSTK 566
           +  STK
Sbjct: 553 VKLSTK 558

>CAGL0L10802g Chr12 complement(1159230..1160783) [1554 bp, 517 aa]
           {ON} similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045c
          Length = 517

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 156/340 (45%), Gaps = 52/340 (15%)

Query: 284 TQNSAPWGLARISHRERLNL---------GSFNKYLYDDDAGRGVTSYVIDTGVNINHKD 334
           TQ+ AP  LAR+S R +L             FN Y Y    GR V +YV+D+GV I+H D
Sbjct: 159 TQSEAPRHLARLSRRSQLPYDFNDPTRYESDFNYYYYGWHQGRSVNAYVLDSGVMIDHCD 218

Query: 335 FEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSD 394
           FE RA +G     +    D NGHGTH AG I SK YG            L S GSGT+  
Sbjct: 219 FEGRAYYGADFIRSGNSGDQNGHGTHVAGLIGSKTYGVSKKVNIIDVKVLDSVGSGTLDT 278

Query: 395 VVKGVEYXXXXXXXXXXXXXXGF------------------KGSTANMSLGGGKSPALDL 436
           V+ G+E+              G                   K    N+SLG  +S  ++ 
Sbjct: 279 VMSGLEFVSNHCNYKGKQGKQGKQGKPVWGSEDSHDDDVESKRCVINLSLGTFRSTIINE 338

Query: 437 AVNAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCV 492
           A+   ++ GI   VAAGN N +AC TSPAS    ITVGA    DDR    A FSNWG CV
Sbjct: 339 AIEELIKQGIVVVVAAGNSNMNACWTSPASVADVITVGA---FDDRIDSIAKFSNWGNCV 395

Query: 493 DVFAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLT 552
           D+FAPG+ + S            +GTSMA+P V GL+   L                 + 
Sbjct: 396 DIFAPGVLVKSLSNKFPYYPIEQTGTSMATPIVTGLVALLL--------------DSGIK 441

Query: 553 PQQLKKKLIHYSTKDIL----FDIPEDTPNVLIYNGGGQD 588
           P Q+KK+L   +T +I           TPN + +NG  +D
Sbjct: 442 PTQIKKRLNELATDNIFPRRTLLFKPGTPNRIAFNGVKRD 481

>KLTH0A06094g Chr1 complement(513667..515157) [1491 bp, 496 aa] {ON}
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 496

 Score =  164 bits (416), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 116/316 (36%), Positives = 160/316 (50%), Gaps = 40/316 (12%)

Query: 285 QNSAPWGLARISHR-------ERLNLGSFN-KYLYDDD-AGRGVTSYVIDTGVNINHKDF 335
           Q  AP  LARIS R       E +++ + N  Y YDD+ +G  V +YVIDTG+   H   
Sbjct: 135 QKKAPRHLARISRRTALPYDPENISVPATNFSYYYDDEFSGTCVNAYVIDTGIYKEHPQL 194

Query: 336 EKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDV 395
           E RA +G  + + +   D NGHGTH AG I S+ +G            L + G G ++ V
Sbjct: 195 EGRAKFGADL-VGEGPGDFNGHGTHVAGLIGSRKFGVAKDVSLIEVKALNAKGQGNLTSV 253

Query: 396 VKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNE 455
           +  +E+                +G  AN+SLG  ++  L+ AV AA+E G+   VAAGN 
Sbjct: 254 ISAIEFTVNHCRKSR-------RGCVANLSLGSFRNTVLNQAVEAALEAGVVIVVAAGNS 306

Query: 456 NQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSDDA 511
           N +AC +SPAS+  AITVGA    DDR    A FSNWG CVD+FAPG+ I S        
Sbjct: 307 NANACWSSPASSLSAITVGA---FDDRTDTIARFSNWGNCVDIFAPGVKIESLSNVPPFK 363

Query: 512 TATLSGTSMASPHVAGLLTYFL--SLQP-GSDSEFFELGQDSLTPQQLKKKLIHYSTKDI 568
               SGTSMASP V+G++   L   + P    +E  +L  DS+           +  + +
Sbjct: 364 PVAFSGTSMASPIVSGMVANLLDSGIHPFDIKTELIDLATDSV-----------FHKRTL 412

Query: 569 LFDIPEDTPNVLIYNG 584
           LF     TPN + + G
Sbjct: 413 LFK--PGTPNRVAFTG 426

>NDAI0I00560 Chr9 (114935..116386) [1452 bp, 483 aa] {ON} Anc_6.313
          Length = 483

 Score =  162 bits (409), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 138/395 (34%), Positives = 188/395 (47%), Gaps = 72/395 (18%)

Query: 235 GGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFD----------- 283
           G I  +F+  + F G     T+++V  I++NPLV  V  +  + A ++D           
Sbjct: 54  GKISKTFSFGS-FRGLTVNLTKDVVSAIKENPLVVDVVPNMKIHAFDYDDFENNDGYDDI 112

Query: 284 ---------------TQNSAPWGLARISHRERLNLGSFNKYLYDDD---------AGRGV 319
                           QN AP  LAR+S R  L     +K  Y+D           G  V
Sbjct: 113 KQPEELFDKNSYLVKVQNGAPRHLARLSRRMPLPYDFDDKDAYNDSLSYYYSKWHQGTDV 172

Query: 320 TSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXX 378
            +Y+ID+G++IN ++FE RA  G  + L  E   D NGHGTH AG + SK YG       
Sbjct: 173 NAYIIDSGIDINQEEFEGRATHG--LDLTGEGPGDRNGHGTHVAGLVGSKTYGVAKNVTL 230

Query: 379 XXXXXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAV 438
                L   GSG++  V+  +E+                K   AN+SLG    P L+ A+
Sbjct: 231 VEVKALDRQGSGSLITVISALEFVVNHCGKSKS------KKCVANLSLGAFMMPLLNEAI 284

Query: 439 NAAVEVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDV 494
            A V+ G+   VAAGN N DAC  SPAS   AITVGA    DDR    A FSNWG CVD+
Sbjct: 285 KATVDSGVVVVVAAGNGNIDACWCSPASEKSAITVGAF---DDRIDTIAKFSNWGSCVDI 341

Query: 495 FAPGLNILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSE-----FFELGQD 549
           FAPG+ I S  I  +  +   SGTSMASP VAG+++  + L  G ++E      FEL  D
Sbjct: 342 FAPGVAISSLSIKDNQKSVEFSGTSMASPQVAGIVS--ILLDQGVENEDIRDYLFELATD 399

Query: 550 SLTPQQLKKKLIHYSTKDILFDIPEDTPNVLIYNG 584
            +           +  + +LF  P  TPN + +NG
Sbjct: 400 DV-----------FQKRTLLFK-PR-TPNRITFNG 421

>Ecym_2105 Chr2 (185014..186846) [1833 bp, 610 aa] {ON} similar to
           Ashbya gossypii AAR069W
          Length = 610

 Score =  161 bits (407), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 160/322 (49%), Gaps = 37/322 (11%)

Query: 285 QNSAPWGLARISHRERLNLGS-------FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337
           Q+ AP  LAR   R  L   +       FN Y   +  G  V  Y++D+G++ +H +FE 
Sbjct: 270 QSGAPRHLARNCRRSGLPFDTSGSKDYEFNYYYDAEHLGETVNVYILDSGIHKSHPEFEG 329

Query: 338 RAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVK 397
           RA++G     N+   D NGHGTH AG + SK YG            +  +G G+ S+++ 
Sbjct: 330 RAVFGIDT-TNEGPGDLNGHGTHVAGLVGSKTYGAAKKATIYEVKVMTVDGRGSTSNIIA 388

Query: 398 GVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEVGIHFAVAAGN 454
           GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F VAAGN
Sbjct: 389 GVEFAVKHCQQSG-------KKCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVVAAGN 440

Query: 455 ENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA 513
             + AC  SPA    AITVGA    SD  A FSN+GKCVD+FAPG+ + S      +   
Sbjct: 441 SKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVSSLSNSPYNTVR 500

Query: 514 TLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDILFD-- 571
            L+GTSM++P  AG++   L                 +  + +K++LI  STK +     
Sbjct: 501 VLNGTSMSAPITAGVVAVLL--------------DQGVKHEDVKERLIDLSTKGVFHRRR 546

Query: 572 -IPEDTPNVLIYNGGGQDLSAF 592
            +   TP+  ++NG  Q+   F
Sbjct: 547 LVSSRTPDRTLFNGVPQEDDVF 568

>TPHA0D03760 Chr4 complement(792115..793938) [1824 bp, 607 aa] {ON}
           Anc_6.313 YCR045C
          Length = 607

 Score =  157 bits (396), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 118/319 (36%), Positives = 152/319 (47%), Gaps = 38/319 (11%)

Query: 283 DTQNSAPWGLARISHRERL--------NLGSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 333
           D Q  AP  L ++S R +L            F  Y YD    G     Y+IDTGV   HK
Sbjct: 148 DIQFGAPRHLGKLSSRHQLPYNVKDEKEFKEFIHYYYDRYYQGTNSVVYIIDTGVYKEHK 207

Query: 334 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 393
           +F  R  +G    + +   D NGHGTH AG I SK +G            L   G G ++
Sbjct: 208 EFGNRVHFGGDF-IGEGKGDYNGHGTHVAGLIGSKTFGVAKNVTLFDVKVLDQKGFGNLT 266

Query: 394 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAG 453
            V++G+E+                K    NMSLG  ++P ++ A+  A   GI   VAAG
Sbjct: 267 SVLEGIEFAVNNCKLKQQPMG---KNCVINMSLGTIRNPIINEAIKEAFLSGITPVVAAG 323

Query: 454 NENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIGSD 509
           N N  AC TSPAS++ AITVGA    DDR    A FSNWG+CVD+FAPG+ I S      
Sbjct: 324 NNNFSACWTSPASSNFAITVGA---MDDRTDTIAVFSNWGQCVDIFAPGVRIKSLSNRML 380

Query: 510 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 569
           +     SGTSMASP VAGL+   +      D              ++K+KLI  S+K I 
Sbjct: 381 ENGVIHSGTSMASPIVAGLVAILMEKGYKCD--------------EIKQKLIDDSSKSIF 426

Query: 570 FDI----PEDTPNVLIYNG 584
             +       TPN +IYNG
Sbjct: 427 SKLTLFFKYGTPNRVIYNG 445

>AAR069W Chr1 (460781..463087) [2307 bp, 768 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR045C
          Length = 768

 Score =  157 bits (396), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 159/326 (48%), Gaps = 37/326 (11%)

Query: 281 EFDTQNSAPWGLARISHRERLNLG-------SFNKYLYDDDAGRGVTSYVIDTGVNINHK 333
           ++  Q  AP  LAR   R  L          +FN Y  ++  G GV  YV+D+G+  +H 
Sbjct: 424 QYAIQVDAPRHLARTCRRTGLPFDPSGDKEYTFNYYYDEEHLGEGVNVYVLDSGIYKSHP 483

Query: 334 DFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMS 393
           +F+ RA +G      +   D NGHGTH AG + S+ +G            +  +G G+ S
Sbjct: 484 EFDGRAHFGIDT-TKEGPGDLNGHGTHVAGLVGSRTFGIAKKANIYEIKVMTVDGRGSTS 542

Query: 394 DVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG---GKSPALDLAVNAAVEVGIHFAV 450
           +++ GVE+                K   ANMSLGG   G S ALD AV AA+E G+ F V
Sbjct: 543 NIIAGVEFAVKHCQQSG-------KRCVANMSLGGLSFGHS-ALDSAVEAAIEEGLVFVV 594

Query: 451 AAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSD 509
           AAGN  + AC  SPA    AITVGA    SD  A FSN+GKCVD+FAPG+ + S      
Sbjct: 595 AAGNSKERACWYSPAKVKTAITVGAFDDRSDIIASFSNYGKCVDIFAPGVAVASLSNSPS 654

Query: 510 DATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKDIL 569
           +    L+GTSM++P  AG++   L                 + P ++K  L+  STK + 
Sbjct: 655 NTMRVLNGTSMSAPITAGVVAVLL--------------DQGIEPHEVKDHLLSISTKGLF 700

Query: 570 FD---IPEDTPNVLIYNGGGQDLSAF 592
                +   TP+  ++ G  ++  +F
Sbjct: 701 HKRRLVSSRTPDRALFTGVKREDDSF 726

>Kwal_23.6183 s23 complement(1485143..1486624) [1482 bp, 493 aa]
           {ON} YCR045C - Hypothetical ORF [contig 15] FULL
          Length = 493

 Score =  150 bits (380), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 116/323 (35%), Positives = 160/323 (49%), Gaps = 40/323 (12%)

Query: 278 EATEFDTQNSAPWGLARISHRERLNLGSFN--------KYLYDDD-AGRGVTSYVIDTGV 328
           E  +F  Q +AP  LARIS R  L     N         Y YDD   G  V +YVIDTG+
Sbjct: 126 EFPDFVAQKNAPRHLARISRRSALPYNPENIAPKTSNFSYYYDDSFPGTCVNAYVIDTGI 185

Query: 329 NINHKDFEKRAIWGKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNG 388
              H+ F+ RA +G  + + +   D NGHGTH AG I S+ YG            L + G
Sbjct: 186 FKEHRQFQGRAKFGADL-VGEGPGDLNGHGTHVAGLIGSQKYGVAKDVSLIEVKALNAKG 244

Query: 389 SGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHF 448
            G ++ V+  +E+                +G  AN+SLG  ++  L+ AV AA+E G+  
Sbjct: 245 QGNLTSVISAIEFTVNHCRKSK-------RGCVANLSLGSFRNSVLNQAVEAALEAGVVV 297

Query: 449 AVAAGNENQDACNTSPASADKAITVGA-STLSDDRAYFSNWGKCVDVFAPGLNILSTYIG 507
            VAAGN N +AC +SPAS+  AI+VGA    +D  A FSNWG CVD+FAPG+ I S    
Sbjct: 298 VVAAGNSNANACWSSPASSLSAISVGAFDDRTDTIARFSNWGNCVDLFAPGVKIASLSNI 357

Query: 508 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYST-- 565
               +   SGTSMASP V G++   L                 + P  +K++LI+ +T  
Sbjct: 358 PPFKSVAYSGTSMASPLVTGMVAVLL--------------DSGIHPFDIKEELINTATDS 403

Query: 566 ----KDILFDIPEDTPNVLIYNG 584
               + +LF     TPN + + G
Sbjct: 404 VFHKRALLFK--PGTPNRVAFTG 424

>KLLA0F06028g Chr6 (576687..578213) [1527 bp, 508 aa] {ON} some
           similarities with uniprot|P25036 Saccharomyces
           cerevisiae YOR003W YSP3 subtilisin-like protease III
          Length = 508

 Score =  149 bits (377), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 162/321 (50%), Gaps = 36/321 (11%)

Query: 281 EFDTQNSAPWGLARISHRERLNL------GSFNKYLYDDD-AGRGVTSYVIDTGVNINHK 333
           +F +Q+ AP  LARIS R +L +       S  KY Y ++  G GV  YV+D+GVN +H 
Sbjct: 150 DFISQSRAPRHLARISRRAQLPVIEKDDTSSGLKYHYHEEHQGEGVFVYVLDSGVNHDHP 209

Query: 334 DFEKRAIWG-KTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTM 392
           DFE RA+ G  T      DL   GHGTH AG I SK YG            L S G GT+
Sbjct: 210 DFEGRAMKGIDTTGEGSGDL--VGHGTHVAGLIGSKTYGVAKKVNIVEVKVLDSMGKGTV 267

Query: 393 SDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGG-GKSPALDLAVNAAVEVGIHFAVA 451
           +++++G+EY                +    NMSLG  G    LD AV+A +E G+   VA
Sbjct: 268 TNIIEGLEYVVNQCIGKK-------RKCVINMSLGAPGTHSILDKAVSAVIEEGVVVVVA 320

Query: 452 AGNENQDACNTSPASADKAITVGASTLSDDR----AYFSNWGKCVDVFAPGLNILSTYIG 507
            GN   +AC  SPA   KAITV A    DDR    A FSNWG C+D++APG+N+ S    
Sbjct: 321 GGNSGLNACWYSPAKVRKAITVAA---MDDRTDLMAPFSNWGACIDIWAPGVNVKSLS-N 376

Query: 508 SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKLIHYSTKD 567
               T  LSGTSMASP VAG    +L  Q    +E  ++   + T    KK+ I    + 
Sbjct: 377 KGRGTFVLSGTSMASPIVAGAAAIYLD-QGADPAEVRKILSKTATRGVFKKRAIAVRPR- 434

Query: 568 ILFDIPEDTPNVLIYNGGGQD 588
                   TPN ++Y G  Q+
Sbjct: 435 --------TPNKVLYTGNNQE 447

>Kwal_33.13372 s33 (190864..191997) [1134 bp, 377 aa] {ON} YCR045C -
           Hypothetical ORF [contig 118] FULL
          Length = 377

 Score =  130 bits (326), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 94/310 (30%), Positives = 154/310 (49%), Gaps = 17/310 (5%)

Query: 232 SEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWG 291
           S+ GG+  + ++ N F    G F Q +++ +  +  +  +  D I+   E+  Q  AP  
Sbjct: 41  SDNGGV-GAISLGNSFRAIYGDFPQRLLENLYYDGRITAMSMDHILTPAEYIVQEHAPAH 99

Query: 292 LARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED 351
           LAR+S +  L  GS   Y+Y  + G GV  Y++DTG++  H + E R    K   L    
Sbjct: 100 LARLSQKSTLR-GSDGTYIYHSNGGNGVDVYLLDTGIDDLHPELEGRV--QKIADLTSNP 156

Query: 352 L---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXXXXXXX 408
           +   D +GHGT  AG I S  +G              S G+ T+  V++ +E+       
Sbjct: 157 VSHGDPHGHGTAVAGVIGSATFGSAKKCNLFDVRVADSTGNATLIGVIRALEHASKLASV 216

Query: 409 XXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-EVGIHFAVAAGNENQDACNTSPASA 467
                    + S   +     K+  L+ A+ A + +  +   VA GN NQ+AC++SPASA
Sbjct: 217 TQ-------RPSVVVIPFTMRKNVILNSAIEAVIRDQSLPVVVAGGNFNQNACDSSPASA 269

Query: 468 DKAITVGA--STLSDDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATATLSGTSMASPHV 525
             A+T+G+   T  D  A F+N+G C+D FA G+NI S   G  ++    SGTS+++   
Sbjct: 270 YGALTIGSIDVTKGDSLAPFTNYGDCIDTFAAGVNITSLTTGDYESNTQYSGTSISAGIA 329

Query: 526 AGLLTYFLSL 535
           +G++ Y++SL
Sbjct: 330 SGVVAYYMSL 339

>KLTH0F02288g Chr6 (186895..188037) [1143 bp, 380 aa] {ON} weakly
           similar to uniprot|P25381 Saccharomyces cerevisiae
           YCR045C Hypothetical ORF
          Length = 380

 Score =  121 bits (303), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 92/316 (29%), Positives = 160/316 (50%), Gaps = 21/316 (6%)

Query: 230 STSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAP 289
           + + AGG   +  + N F    G F Q++++   ++  +  +  D  +   E+  Q  AP
Sbjct: 38  AATVAGGGVGAITLGNSFRAIYGEFPQQLLEDFYRSGQIVAMSMDRPLGVAEYMVQQHAP 97

Query: 290 WGLARISHRERLNLGSFN---KYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIP 346
             LAR+S +  L  G+ +    Y+Y  +AG GV  Y++DTG++  H  FE R    K   
Sbjct: 98  NHLARLSQKSSLRGGNGSDNGAYIYHSNAGNGVDVYLLDTGIDGTHPAFEGRV--QKAAD 155

Query: 347 LNDEDL---DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVVKGVEYXX 403
            + + +   D +GHGT  AG I S  +G              S G  ++  V++ +E+  
Sbjct: 156 FSSDPVATGDPHGHGTAVAGVIGSSVFGVAKKCNLFDVRVANSTGHASLIGVLRALEHAS 215

Query: 404 XXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAV-EVGIHFAVAAGNENQDACNT 462
                         + S   + L   ++  L+ AV A V ++ I   VAAGNEN+ AC+ 
Sbjct: 216 KLAAVTK-------RPSLITIPLEMPRNTILNSAVEAVVRDLSIPVVVAAGNENRSACSV 268

Query: 463 SPASADKAITVGASTLS--DDRAYFSNWGKCVDVFAPGLNILSTYIGSDDATA-TLSGTS 519
           SPA A  A+T+G+  ++  D  A F+N+ +CVD+F  G+++ +  +G D ++   LSGTS
Sbjct: 269 SPAGAYGALTIGSIDVARNDALAPFTNFAECVDLFTAGVDVAT--LGLDHSSEHHLSGTS 326

Query: 520 MASPHVAGLLTYFLSL 535
           +++   +GL+ Y++S+
Sbjct: 327 ISAGVASGLVAYYMSI 342

>TBLA0A06700 Chr1 (1634983..1636476) [1494 bp, 497 aa] {ON}
           Anc_6.313 YCR045C
          Length = 497

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/259 (32%), Positives = 121/259 (46%), Gaps = 13/259 (5%)

Query: 281 EFDTQNSAPWGLARISHRERLNLGS---FNKYLYDDDAGRGVTSYVIDTGVNINHKDFEK 337
           ++ TQ +AP  L+R S   +L   S   +N Y   D  G  VT YV+D+G+ ++H +FE 
Sbjct: 141 KYSTQFNAPRHLSRASRITKLPTASNFTYNYYYPRDYQGANVTVYVLDSGIRMDHPEFEG 200

Query: 338 RAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGTMSDVV 396
           R +  +     D  + D  GHGT  AG I SK YG            L + G G +  ++
Sbjct: 201 RIL--EAYDFTDSGVGDNYGHGTSVAGIIGSKTYGVAKNVNLIDIKVLNNKGKGNVFSIL 258

Query: 397 KGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNEN 456
           +G+++                     N SLG      L+ A       GI    AAGN  
Sbjct: 259 QGLQFITKHCEENTNG------NCIINASLGAINIQILNKAFEEVHNAGIPVICAAGNNA 312

Query: 457 QDACNTSPASADKAITVGASTLSDDR-AYFSNWGKCVDVFAPGLNILSTYIGSDDATATL 515
            +AC  +PA +    TVG+    DD  A FSNWG+CVD+ APG+ + +    +   +   
Sbjct: 313 VNACWITPAGSKGVFTVGSFDDRDDTIATFSNWGRCVDMMAPGVYVRTLLYTNQKGSRES 372

Query: 516 SGTSMASPHVAGLLTYFLS 534
           SGTS+++P V GL    LS
Sbjct: 373 SGTSVSTPIVTGLAAILLS 391

>Kpol_2000.69 s2000 complement(151054..152214) [1161 bp, 386 aa]
           {ON} complement(151054..152214) [1161 nt, 387 aa]
          Length = 386

 Score =  115 bits (288), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 93/312 (29%), Positives = 152/312 (48%), Gaps = 24/312 (7%)

Query: 239 DSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSAPWGLARISH- 297
           D   I + F G+ G F  E++  +  +P V  +  D ++   E+  QN AP  LAR+S+ 
Sbjct: 53  DKIVIGSDFHGFSGEFEDEVMSELYGDPRVASISIDRMLYLQEYLRQNDAPEHLARLSNG 112

Query: 298 --RERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL--- 352
               R++  + N +++   AG GV  Y++D+G++  H  F  R I  K I L D  +   
Sbjct: 113 VSNSRVSAKNENAFIFHSHAGIGVDVYIVDSGIDSQHPAFMNRHI-SKLIDLTDNPIPVG 171

Query: 353 DGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRSNGSGT-MSDVVKGVEYXXXXXXXXXX 411
           D +GHGT  AG + S  +G            + +  +G  +S ++K +E+          
Sbjct: 172 DPHGHGTAIAGLVTSDTFGVMKKANLFDVRVVDAESNGVKLSKLLKSLEFIENHSRAT-- 229

Query: 412 XXXXGFKGSTANMSLGGGKSPALDLAVNAAVEVGIHFAVAAGNENQDACNTSPASADKAI 471
                 + S A +     K+  L+ A+  ++   I   V AGN++  ACN SPASA  + 
Sbjct: 230 -----MRPSVAVLPFSMSKNAILNSAIE-SMPNSIAIVVPAGNQHHMACNFSPASARNSQ 283

Query: 472 TVGASTLSDDR-----AYFSNWGKCVDVFAPGLNI--LSTYIGSDD-ATATLSGTSMASP 523
           ++ +    D R     A FSN+G+CVDVF  G+ +  L     SD+   + +SGTSM+  
Sbjct: 284 SILSVGSLDYRSSIEIASFSNYGECVDVFTSGVQMDTLHATTNSDENYISKVSGTSMSCA 343

Query: 524 HVAGLLTYFLSL 535
             AG + Y++SL
Sbjct: 344 IAAGTVGYYMSL 355

>ZYRO0F16764g Chr6 complement(1390437..1391597) [1161 bp, 386 aa]
           {ON} conserved hypothetical protein
          Length = 386

 Score =  103 bits (257), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 95/345 (27%), Positives = 153/345 (44%), Gaps = 31/345 (8%)

Query: 209 QSVENLSAEDAFFISTKDTSLSTSEAGG-IQDSFNIDNLFSGYIGYFTQEIVDLIRQNPL 267
           Q V  L  + A        +LS+ + G  I D F + + F  + G F+  I+  +  +P 
Sbjct: 16  QFVVQLQDKTALNAVLNSYALSSDQQGPEITDIFELGS-FRAFTGDFSGPILQKLYNDPN 74

Query: 268 VDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTG 327
           V  + RD  ++  E   QN+AP  L  +S    L   S   ++Y  + G GV  Y++DTG
Sbjct: 75  VLAISRDGSLKLQEIVLQNNAPSHLVGLSSISPL---SHQPFIYRSNGGNGVDVYLLDTG 131

Query: 328 VNINHKDFEKRAIW------GKTIPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXX 381
           ++I H +  K  I          +P   +  D  GHGT  AG IAS+ +G          
Sbjct: 132 IDIKHPNLSKLNILRMADLTQSPVP---QGTDPQGHGTAMAGIIASETFGVLKKCNLVDV 188

Query: 382 XXLRSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAA 441
               SNG   +S +++ +                        + +  G +P L  A+ A+
Sbjct: 189 RVADSNGDVKLSTILQALTLTQRHIEGTKRPSVVVIP-----LEVEDGNNPILTEAI-AS 242

Query: 442 VEVGIHFAVAAGNENQDACNTSPASAD----KAITVGASTLSDDRAYFSNWGKCVDVFAP 497
            +  +   + AGN  QDA N SPA+ +      I VG+  ++++   F+N+G  VDVF  
Sbjct: 243 FDQSVPIIIPAGNNAQDALNFSPANVNPKPKNIIVVGSVDVNNNPTKFTNYGSNVDVFTV 302

Query: 498 GLNI-------LSTYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535
           G  I       L +   S+  T  +SGTS +S   AG++ Y++SL
Sbjct: 303 GEQITTLQSTDLDSQGLSNSLTRQVSGTSASSAITAGVIGYYMSL 347

>TPHA0B04520 Chr2 complement(1065861..1067027) [1167 bp, 388 aa]
           {ON} Anc_1.78
          Length = 388

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 155/349 (44%), Gaps = 35/349 (10%)

Query: 205 QAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQ 264
           Q  +Q VEN       F+   D  +  S    I+    I N F  + G  ++E V  + +
Sbjct: 23  QYIIQLVENTQVNA--FLKKHDIDVMDSNILPIE----IGNSFIAFSGDLSKEQVSSVFE 76

Query: 265 NPLVDFVERDSIVEATEFDTQNSAPWGLARISHRERLNLGSF----NKYLYDDDAGRGVT 320
           +     +  +  +E   +  Q  AP  L R++ ++ +    +    N+Y++ D +G GV 
Sbjct: 77  DNAAAAISTEKYLELQGYLKQTDAPKHLGRLT-KDSIKSSQYHYANNQYIFSDTSGNGVD 135

Query: 321 SYVIDTGVNINHKDFEKRAIWGKTIPLNDEDL---DGNGHGTHCAGTIASKHYGXXXXXX 377
            Y++DTG++I H  + +  I  K I L    +   D NGHGT  AG I S  +G      
Sbjct: 136 IYIVDTGIDIQHPIYLQNNIH-KLIDLTTSPIPSGDFNGHGTAMAGIINSDPFGVLKSAN 194

Query: 378 XXXXXXLRSNGS-GTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDL 436
                 + +N    TMS V+  +                  + S   +     K+  L+ 
Sbjct: 195 LVDVRVVDANTKHATMSRVLSALSLIEKHEQKT-------MRPSIIVLPFQTEKNTILES 247

Query: 437 AVNAAVEVGIHFAVAAGNENQDACNTSPASADK---AITVGASTLSDDRAY-----FSNW 488
           A+   +   I   + AGN++Q+AC  SP    K    + VG+   S+++ Y     FSN+
Sbjct: 248 AIE-NISKKIPVIIPAGNKHQNACKLSPMGIKKLSNVLVVGSLEYSEEQNYLDIAKFSNY 306

Query: 489 GKCVDVFAPGLNILSTYIGSD---DATATLSGTSMASPHVAGLLTYFLS 534
           G CVD++  G++I +    S+   +    ++GTS +   VAG++ Y++S
Sbjct: 307 GSCVDIYTSGVDISTLKTSSNGGKELIHNVTGTSYSCGIVAGVVGYYMS 355

>TDEL0C06230 Chr3 complement(1135740..1136834) [1095 bp, 364 aa]
           {ON} Anc_1.78
          Length = 364

 Score = 88.2 bits (217), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 146/334 (43%), Gaps = 27/334 (8%)

Query: 211 VENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGYIGYFTQEIVDLIRQNPLVDF 270
           V  L+++ +    ++D S S        +   + + F    G F+ E ++ +  +  V  
Sbjct: 17  VVQLASDTSLVELSRDCSFSIGVGKNFIEMITVGDQFKALAGEFSVEDLEYLYHDERVVA 76

Query: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330
           + RD  ++  E+  Q  +P  L+++S       GSF    +D  +G  V  YV DTG++ 
Sbjct: 77  ISRDRDLKLQEYKVQYGSPRHLSQLSSG-----GSFT---FDPVSGNLVDVYVFDTGIDF 128

Query: 331 NHKDFE-----KRAIWGKT-IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXL 384
            H   +     K A +  + +P      D +GHGT  AG IAS+ +G             
Sbjct: 129 KHPGLQNVNPHKLADFTSSPVP---RGADPHGHGTMMAGLIASETFGVLKSCSLVDVRVA 185

Query: 385 RSNGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAVNAAVEV 444
             +G   +S ++KG+                  + S   + +  GK   +      A+  
Sbjct: 186 DKDGEVKLSTLMKGISASVAHARFTK-------RPSVFVLPMTIGKKNHILDNFLQAIPK 238

Query: 445 GIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL-- 502
            I   + AGN+  DAC+ SP +    + +G+    +  A FSN+G CVDV+  G +IL  
Sbjct: 239 DIAIVLPAGNQQTDACDLSPPNDHNILVIGSLDRDNRLADFSNYGNCVDVYTSGTDILTL 298

Query: 503 -STYIGSDDATATLSGTSMASPHVAGLLTYFLSL 535
            ST  G++    + +GTS +    AG++ Y +S+
Sbjct: 299 RSTDSGNEVLLQSSNGTSASCAIGAGIVGYHMSM 332

>TBLA0A05410 Chr1 (1328472..1329620) [1149 bp, 382 aa] {ON} Anc_1.78
          Length = 382

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 120/281 (42%), Gaps = 32/281 (11%)

Query: 271 VERDSIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLYDDDAGRGVTSYVIDTGVNI 330
           +  D  +E  E   Q  AP  L ++   E  +    N+++YD  AG GV  Y+ DTG+  
Sbjct: 83  ISIDRQLEPQEMIVQKDAPRHLTKLLETEAGD----NEFVYDSTAGNGVDIYIFDTGIAR 138

Query: 331 NHKDFEKRAIWGKT----IPLNDEDLDGNGHGTHCAGTIASKHYGXXXXXXXXXXXXLRS 386
           N        I         P+ D+++    HGT  +G I S  +G               
Sbjct: 139 NSPGLSASRIHDMPGMPGPPIRDQEIL--EHGTAMSGLIGSPAFGVLKKCNLIDVNVGDE 196

Query: 387 NGSGTMSDVVKGVEYXXXXXXXXXXXXXXGFKGSTANMSLGGGKSPALDLAV-NAAVEVG 445
           NG   MS V+KG+                  + S  N S    K+  L+ A  N   +V 
Sbjct: 197 NGKVFMSKVLKGLNLVQQHVKHTN-------RPSVINFSYCTLKNAILNSAFDNFPRDVP 249

Query: 446 IHFAVAAGNENQDACNTSPASADK---AITVGASTLSDD---RAYFSNWGKCVDVFAPGL 499
           I  AVAAGN  Q  C+ SP    +    +  G+  ++DD    + FSN+G CV  +APG 
Sbjct: 250 I--AVAAGNYKQPGCSFSPVGCQRNKSLLAFGSLLMNDDGITLSDFSNYGSCVGSYAPGE 307

Query: 500 NILSTYI------GSDDATATLSGTSMASPHVAGLLTYFLS 534
            +L+  I       S D    +SGTS +S   AG++ Y+++
Sbjct: 308 GLLTFGIPDTSRPNSRDTVIIISGTSGSSALGAGVIGYYMA 348

>NDAI0E01630 Chr5 complement(324500..325870) [1371 bp, 456 aa] {ON}
           Anc_8.608 YOR197W
          Length = 456

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 4/101 (3%)

Query: 192 PQEEIDFHKENVQ-QAQLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFSGY 250
           PQ+   FH  N Q Q   Q  +      A  I       S +  G I D+ NI N  S  
Sbjct: 134 PQQPQSFHLNNQQTQPSFQYSQCTGKRKALIIGINYIGSSNALRGCINDAHNIFNFLSQR 193

Query: 251 IGYFTQEIVDLI--RQNPLVDFVERDSIVEATEFDTQNSAP 289
            GY  Q+IV L   +Q+P V    + +I+ A ++  +++ P
Sbjct: 194 YGYSPQDIVILTDDQQDP-VRQPTKANIIRAMQWLVRDAQP 233

>NCAS0A00880 Chr1 (173726..176227) [2502 bp, 833 aa] {ON} Anc_2.6
           YNL238W
          Length = 833

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 308 KYLYDDDAGRGVTSYVIDTGV---NINHKD-FEKRAIW--GKTIPLNDEDLDGNGHGTHC 361
           +  Y++  G G+ + ++D GV   N N KD F +   W      PL    L  + HGT C
Sbjct: 183 QLWYENVTGTGIVAAIVDDGVDYDNDNIKDNFSREGSWDFNDNGPLPKPKLKDDYHGTRC 242

Query: 362 AGTIAS 367
           AG IA+
Sbjct: 243 AGEIAA 248

>SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar to
           uniprot|P13134 YNL238W Saccharomyces cerevisiae KEX2
           Subtilisin-like protease (proprotein convertase)
          Length = 836

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 364
           Y++  G GV + ++D G++  ++D    F     W      PL    L  + HGT CAG 
Sbjct: 185 YENITGHGVVAAIVDDGLDYENRDLKDNFCAEGSWDFNDNTPLPKPRLRDDYHGTRCAGE 244

Query: 365 IAS 367
           IA+
Sbjct: 245 IAA 247

>ZYRO0F15598g Chr6 complement(1278928..1281300) [2373 bp, 790 aa]
           {ON} similar to uniprot|P13134 YNL238W Saccharomyces
           cerevisiae KEX2 Subtilisin-like protease (proprotein
           convertase)
          Length = 790

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 6/63 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 364
           Y++  G GV + ++D G++   +D    F K   W       L    LD + HGT CAG 
Sbjct: 154 YENITGHGVVAAIVDDGLDYESEDLKDNFCKEGSWDFNDNTKLPKPRLDDDYHGTRCAGE 213

Query: 365 IAS 367
           IA+
Sbjct: 214 IAA 216

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 34.7 bits (78), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 501 ILSTYIGSDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDSLTPQQLKKKL 560
           +L  Y   D +      +S  S      L+Y+ +L+PG  ++F+++ Q SL P +   KL
Sbjct: 24  LLMVYYSVDLSVPVQHSSSDRSNSCDRCLSYYETLEPGWSNDFYDVNQKSLAPAEDVIKL 83

Query: 561 IHYSTKDILF 570
           +   T+ I+F
Sbjct: 84  V---TRIIIF 90

>Skud_14.101 Chr14 (191111..193570) [2460 bp, 819 aa] {ON} YNL238W
           (REAL)
          Length = 819

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 308 KYLYDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHC 361
           K  Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT C
Sbjct: 158 KLWYNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRC 217

Query: 362 AGTIASK 368
           AG IA+K
Sbjct: 218 AGEIAAK 224

>YNL238W Chr14 (202428..204872) [2445 bp, 814 aa] {ON}
           KEX2Subtilisin-like protease (proprotein convertase), a
           calcium-dependent serine protease involved in the
           activation of proproteins of the secretory pathway
          Length = 814

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 364
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 365 IASK 368
           IA+K
Sbjct: 221 IAAK 224

>TBLA0B00130 Chr2 (12377..14905) [2529 bp, 842 aa] {ON} Anc_2.6
           YNL238W
          Length = 842

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 6/59 (10%)

Query: 315 AGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGTIAS 367
            G+ VT  ++D GV+  ++D + +  +  +   ND        L  + HGT CAG IA+
Sbjct: 166 TGKNVTVAIVDDGVDYENEDLKDKFCFEGSWDFNDNTAKPKPRLSDDYHGTRCAGEIAA 224

>CAGL0J07546g Chr10 complement(733686..736055) [2370 bp, 789 aa]
           {ON} similar to uniprot|P13134 Saccharomyces cerevisiae
           YNL238w KEX2 endoproteinase of late golgi compartment
          Length = 789

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 10/61 (16%)

Query: 315 AGRGVTSYVIDTGVNINHKD----FEKRAIW----GKTIPLNDEDLDGNGHGTHCAGTIA 366
            G+GV + +ID GV+    D    F K   W     + +P+    L  + HGT CAG IA
Sbjct: 169 TGKGVVAAIIDDGVDYTSPDLKDNFCKEGSWDFNENQQLPM--PLLSDDNHGTRCAGEIA 226

Query: 367 S 367
           +
Sbjct: 227 A 227

>Suva_14.106 Chr14 (196428..198857) [2430 bp, 809 aa] {ON} YNL238W
           (REAL)
          Length = 809

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 364
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLSDDYHGTRCAGE 220

Query: 365 IASK 368
           IA+K
Sbjct: 221 IAAK 224

>KAFR0A08040 Chr1 complement(1609550..1611850) [2301 bp, 766 aa]
           {ON} Anc_2.6 YNL238W
          Length = 766

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKD----FEKRAIW--GKTIPLNDEDLDGNGHGTHCAGT 364
           Y +  G+GV + V+D G++  + D    F K   W       L    L  + HGT CAG 
Sbjct: 152 YQNITGKGVVAAVVDDGLDYENPDIKDNFCKEGSWDFNANTNLPKPTLADDYHGTRCAGE 211

Query: 365 IAS 367
           IA+
Sbjct: 212 IAA 214

>Ecym_1526 Chr1 complement(1083371..1085317) [1947 bp, 648 aa] {ON}
           similar to Ashbya gossypii ABR228C
          Length = 648

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 40/94 (42%), Gaps = 12/94 (12%)

Query: 207 QLQSVENLSAEDAFFISTKDTSLSTSEAGGIQDSFNIDNLFS------------GYIGYF 254
           QLQ++E+LS       +  +  LS + AG   D FN+D L +            GY  +F
Sbjct: 551 QLQAIESLSDNYKELCAAANIPLSGNAAGHSDDWFNMDGLKTQPKPLPSGFTAKGYFAFF 610

Query: 255 TQEIVDLIRQNPLVDFVERDSIVEATEFDTQNSA 288
              IV L     +  F   +SI +  E   + SA
Sbjct: 611 LTTIVGLFGLYTVTKFGLHESIQDDVELHAKLSA 644

>Smik_14.97 Chr14 (181672..184116) [2445 bp, 814 aa] {ON} YNL238W
           (REAL)
          Length = 814

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 311 YDDDAGRGVTSYVIDTGVNINHKDFEKRAIWGKTIPLNDED------LDGNGHGTHCAGT 364
           Y++  G GV + ++D G++  ++D +       +   ND        L  + HGT CAG 
Sbjct: 161 YNNITGAGVVAAIVDDGLDYENEDLKDNFCAEGSWDFNDNTNLPKPRLLDDYHGTRCAGE 220

Query: 365 IASK 368
           IA+K
Sbjct: 221 IAAK 224

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,626,607
Number of extensions: 2571863
Number of successful extensions: 5030
Number of sequences better than 10.0: 83
Number of HSP's gapped: 4917
Number of HSP's successfully gapped: 87
Length of query: 635
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 519
Effective length of database: 40,180,143
Effective search space: 20853494217
Effective search space used: 20853494217
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)