Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL059C-A (SOM1)6.12ON74743968e-52
Suva_5.96.12ON73733482e-44
Smik_5.286.12ON74743403e-43
Skud_5.306.12ON74743394e-43
KLLA0D00880g6.12ON71731763e-18
Ecym_30156.12ON70731582e-15
SAKL0E00924g6.12ON97811472e-13
Kpol_1032.36.12ON78811425e-13
KLTH0C11484g6.12ON89731427e-13
ACR014C6.12ON70731409e-13
Kwal_56.223596.12ON91731392e-12
TPHA0M002206.12ON78791287e-11
TDEL0G045906.12ON74771271e-10
KNAG0E009306.12ON109641221e-09
ZYRO0F00528g6.12ON77771192e-09
NCAS0F002106.12ON79761052e-07
KAFR0L003506.12ON7163852e-04
TBLA0G009906.12ON7883690.056
TBLA0B090602.437ON33726584.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL059C-A
         (74 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...   157   8e-52
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...   138   2e-44
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...   135   3e-43
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...   135   4e-43
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    72   3e-18
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    65   2e-15
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    61   2e-13
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    59   5e-13
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    59   7e-13
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    59   9e-13
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    58   2e-12
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    54   7e-11
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    54   1e-10
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    52   1e-09
ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...    50   2e-09
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    45   2e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    37   2e-04
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    31   0.056
TBLA0B09060 Chr2 complement(2151349..2152362) [1014 bp, 337 aa] ...    27   4.4  

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score =  157 bits (396), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 74/74 (100%), Positives = 74/74 (100%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK
Sbjct: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60

Query: 61 SATNYEVTDTYTNS 74
          SATNYEVTDTYTNS
Sbjct: 61 SATNYEVTDTYTNS 74

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score =  138 bits (348), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (94%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPTTIR RDQALAPLATLDS+T+C LKELVQWECQFKGA+YVCSPF+RLFEHC AP +
Sbjct: 1  MAPPTTIRARDQALAPLATLDSRTHCHLKELVQWECQFKGADYVCSPFRRLFEHCTAPGE 60

Query: 61 SATNYEVTDTYTN 73
          +ATNYEVTDTYTN
Sbjct: 61 AATNYEVTDTYTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  135 bits (340), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 62/74 (83%), Positives = 67/74 (90%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPTTIR+RDQALAPL  LDSQ +C+LKELVQWECQFKGA+YVCSPFKRLFEHC+   K
Sbjct: 1  MAPPTTIRSRDQALAPLMALDSQASCQLKELVQWECQFKGADYVCSPFKRLFEHCVEHGK 60

Query: 61 SATNYEVTDTYTNS 74
           ATNYEVTDTYTNS
Sbjct: 61 PATNYEVTDTYTNS 74

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score =  135 bits (339), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 63/74 (85%), Positives = 68/74 (91%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPTTIR+RDQALAPLA LDS T C+LKELVQWECQF+ A+YVC PFKRLFE CIAPDK
Sbjct: 1  MAPPTTIRSRDQALAPLAALDSHTRCQLKELVQWECQFREADYVCFPFKRLFERCIAPDK 60

Query: 61 SATNYEVTDTYTNS 74
          SAT+YEVTDTYTNS
Sbjct: 61 SATDYEVTDTYTNS 74

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 72.4 bits (176), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT I   D        L    NC LK LVQ EC F G +YVC+PFKRLFE C+  D 
Sbjct: 1  MAPPTKILGLD---TQQRMLQRGENCSLKSLVQNECAFNGNDYVCTPFKRLFEQCMVKDG 57

Query: 61 SATNYEVTDTYTN 73
             N EVT+  TN
Sbjct: 58 RVLNIEVTNLNTN 70

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 65.5 bits (158), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 37/73 (50%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT I TRD+ + P+  L    +C L  L+Q EC F G  YVC PFKRLFE C   +K
Sbjct: 1  MAPPTPIITRDE-VEPI--LSRTKDCILASLIQNECHFDGHNYVCIPFKRLFEECTL-NK 56

Query: 61 SATNYEVTDTYTN 73
               EVTD  TN
Sbjct: 57 RRVRIEVTDISTN 69

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 61.2 bits (147), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 9/81 (11%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT +  +D+  + L  +  +  C LK L+Q EC F G EY+C PFKRLF+ C+   K
Sbjct: 1  MAPPTPVFGKDELESLLKKV--KPPCTLKSLIQNECTFNGEEYICVPFKRLFKECLLDSK 58

Query: 61 S-------ATNYEVTDTYTNS 74
          +           E+TD +TN 
Sbjct: 59 TKDGRTSRTVRIEITDRHTND 79

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 59.3 bits (142), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 46/81 (56%), Gaps = 12/81 (14%)

Query: 1  MAPPTTIRTRDQALAPLATL----DSQTNCRLKELVQWECQFKG---AEYVCSPFKRLFE 53
          MAPPT I++R++ L     L    + +  C L  + Q++C+F+     EY+C PFKRLFE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 54 HCIAPDKSATNYEVTDTYTNS 74
           C     S    EVTD +TN+
Sbjct: 61 EC-----SGIRIEVTDRFTNN 76

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 59.3 bits (142), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 34/73 (46%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT +  +++         +   C LK LVQ EC+F G EYVC+PFKRLF+ C A  K
Sbjct: 1  MAPPTLVFGKEELKGIWE--KAAEPCFLKALVQNECEFNGHEYVCTPFKRLFKECGA-GK 57

Query: 61 SATNYEVTDTYTN 73
               EVTD  TN
Sbjct: 58 RIVRIEVTDQDTN 70

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 58.5 bits (140), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 40/73 (54%), Gaps = 4/73 (5%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT + TR++    LAT     +C L  L Q EC F G  YVC PF+RLF  C   +K
Sbjct: 1  MAPPTPVLTREEVAPALAT---SRDCVLASLTQNECHFDGRGYVCVPFQRLFRECTL-NK 56

Query: 61 SATNYEVTDTYTN 73
               E+T+  TN
Sbjct: 57 RRVRIEITERNTN 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 58.2 bits (139), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAPPT +  +++ L PL   +    C  K L Q EC F G +YVC PFKR+F+ C    K
Sbjct: 1  MAPPTVVFGKEE-LEPLLR-NVMATCIFKSLTQSECNFDGHQYVCVPFKRVFKECKVDGK 58

Query: 61 SATNYEVTDTYTN 73
          S    EVTD  TN
Sbjct: 59 S-IRIEVTDRNTN 70

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 53.9 bits (128), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 1  MAPPTTIRTRDQALAPL--ATLDSQTNCRLKELVQWECQFKGAE---YVCSPFKRLFEHC 55
          MAP T +  R+   A L  +   ++  C LK L Q+ECQF   E   Y+C PFKRLFE C
Sbjct: 1  MAPATPVVDREAVAATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLFEVC 60

Query: 56 IAPDKSATNYEVTDTYTNS 74
               + T+YE T   TNS
Sbjct: 61 -----AGTSYETTAQPTNS 74

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 53.5 bits (127), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 41/77 (53%), Gaps = 8/77 (10%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAE---YVCSPFKRLFEHCIA 57
          MAPPT +  R++    L  +    NC LK L Q++CQ + A    Y C PFKRLF+ C  
Sbjct: 1  MAPPTPVLAREE----LPEIPQSKNCVLKSLTQFQCQLRPAGSGLYECVPFKRLFQECRD 56

Query: 58 P-DKSATNYEVTDTYTN 73
          P  +  +  EVT   TN
Sbjct: 57 PSGRFKSRIEVTSPLTN 73

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 51.6 bits (122), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFKGAEYVCSPFKRLFEHCIAPDK 60
          MAP   + TR+    P      Q  C LKELVQ+ C+  G ++ C+PF+RLFE C  P +
Sbjct: 1  MAPNVRVLTRNDVPLP----QPQDGCVLKELVQFRCENDGTQWQCAPFRRLFEQC--PSQ 54

Query: 61 SATN 64
            TN
Sbjct: 55 EGTN 58

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score = 50.4 bits (119), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 1  MAPPTTIRTRDQA---LAPLATLDSQTNCRLKELVQWECQFKG-AEYVCSPFKRLFEHCI 56
          MAPPT I T +Q       +  L  +  C LK L Q  C  +   EY+C PFKR+FE C+
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 57 APDKSATNYEVTDTYTN 73
                   EVTD  TN
Sbjct: 61 -----GHALEVTDADTN 72

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 10/76 (13%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTN---------CRLKELVQWECQF-KGAEYVCSPFKR 50
          MAPP  +  +D      A  +++T          CR  +L Q++CQ  +  +Y+C PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 51 LFEHCIAPDKSATNYE 66
          +F+ C       TN +
Sbjct: 61 VFQECQGVRTEVTNVD 76

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 37.4 bits (85), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 1  MAPPTTIRTRDQALAPLATLDSQTNCRLKELVQWECQFK-GAEYVCSPFKRLFEHCIAPD 59
          MAP   IR  D   A    +     C+L  LVQ+ C+++ G    C PFKR+F  C+  D
Sbjct: 1  MAP--MIRVMDGDAAE-REVKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECL--D 55

Query: 60 KSA 62
          KS 
Sbjct: 56 KSG 58

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 31.2 bits (69), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 16/83 (19%)

Query: 1  MAPPTTIRTRDQALAPLATL-------DSQTNCRLKE--LVQWEC-QFKGAEYVCSPFKR 50
          MAPP TI+T+++ L  L  +       D++ + + K+  + Q+EC      +  C PFKR
Sbjct: 1  MAPPVTIQTKEE-LDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKR 59

Query: 51 LFEHCIAPDKSATNYEVTDTYTN 73
          +F+            E+TD  TN
Sbjct: 60 IFQQV-----GEYRREITDETTN 77

>TBLA0B09060 Chr2 complement(2151349..2152362) [1014 bp, 337 aa]
           {ON} Anc_2.437 YMR111C
          Length = 337

 Score = 26.9 bits (58), Expect = 4.4,   Method: Composition-based stats.
 Identities = 11/26 (42%), Positives = 19/26 (73%)

Query: 9   TRDQALAPLATLDSQTNCRLKELVQW 34
           TR+QA+  +A+++S   C L +LVQ+
Sbjct: 290 TREQAIRAVASVESYERCTLPKLVQY 315

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.129    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,706,946
Number of extensions: 235577
Number of successful extensions: 404
Number of sequences better than 10.0: 20
Number of HSP's gapped: 398
Number of HSP's successfully gapped: 20
Length of query: 74
Length of database: 53,481,399
Length adjustment: 46
Effective length of query: 28
Effective length of database: 48,206,763
Effective search space: 1349789364
Effective search space used: 1349789364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)