Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL058W (PCM1)6.11ON55755729970.0
Smik_5.296.11ON55555726740.0
Skud_5.316.11ON55755826290.0
Suva_5.106.11ON55355625300.0
TPHA0M002106.11ON54555515940.0
Kpol_1032.26.11ON53954815330.0
TDEL0G046006.11ON52854915100.0
KAFR0L003406.11ON54055915020.0
TBLA0G009806.11ON55856615010.0
SAKL0E00902g6.11ON54455614990.0
NDAI0K028906.11ON56156814970.0
NCAS0F002006.11ON54955814770.0
ZYRO0F00506g6.11ON55055514620.0
CAGL0B03597g6.11ON54055614570.0
Kwal_56.223556.11ON54154113840.0
Ecym_30146.11ON55153313840.0
KLTH0C11506g6.11ON54455613810.0
ACR015W6.11ON55254613590.0
KLLA0D00858g6.11ON54155513450.0
KNAG0E009406.11ON53855813091e-175
TPHA0I002508.840ON629149930.013
TDEL0B005708.840ON63073920.014
KNAG0J002708.840ON62573910.018
Skud_13.4508.840ON62241910.020
Kpol_1068.88.840ON63231900.030
KLLA0D01573g8.840ON60731880.040
NCAS0C004108.840ON625107880.043
CAGL0M02981g8.840ON61728870.066
YMR278W (PGM3)8.840ON62228860.070
Kwal_27.102588.840ON62031860.071
NDAI0K004108.840ON62662860.074
Suva_13.4668.840ON62228860.081
TBLA0B032508.840ON64328850.10
Smik_13.4918.840ON62228850.11
KAFR0B039208.840ON62464850.12
ZYRO0G14190g8.840ON61028850.12
ABL126W8.840ON62427830.17
KLTH0C03872g8.840ON621100820.23
SAKL0D01474g8.840ON62427820.24
Ecym_46118.840ON63030820.27
TBLA0C015901.456ON40849741.9
CAGL0K06655g6.104ON802153706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL058W
         (557 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...  1159   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)  1034   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)  1017   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   979   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   618   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   595   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   586   0.0  
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   583   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   582   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   582   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   581   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   573   0.0  
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...   567   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   565   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   537   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   537   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   536   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   528   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   522   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   508   e-175
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    40   0.013
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    40   0.014
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    40   0.018
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    40   0.020
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    39   0.030
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    39   0.040
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.043
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.066
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    38   0.070
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    38   0.071
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    38   0.074
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    38   0.081
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    37   0.10 
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    37   0.11 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    37   0.12 
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    37   0.12 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    37   0.17 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    36   0.23 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.24 
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    36   0.27 
TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {O...    33   1.9  
CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} simil...    32   6.3  

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 1159 bits (2997), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/557 (100%), Positives = 557/557 (100%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
           MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV
Sbjct: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120

Query: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180
           EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240
           NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL
Sbjct: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240

Query: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300
           LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD
Sbjct: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300

Query: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA
Sbjct: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK
Sbjct: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420

Query: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480
           LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC
Sbjct: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480

Query: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540
           IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS
Sbjct: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540

Query: 541 KLGQFCDEVVEHVKASA 557
           KLGQFCDEVVEHVKASA
Sbjct: 541 KLGQFCDEVVEHVKASA 557

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 1034 bits (2674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/557 (87%), Positives = 529/557 (94%), Gaps = 2/557 (0%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
           MK+DYEQL +LYD TCRTKNVQ+SYGTAGFRTLAKNLDTVMF+TGILA+LRSLKLQGQYV
Sbjct: 1   MKIDYEQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLAN ASFA+NFEEFR EL +LIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEEFRAELTRLIEH 120

Query: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180
           EKI L+T++VPHIVVGRDSRESSPYLLRCLTS+M SVFHAQVLDLGCVTTPQLHYITDLS
Sbjct: 121 EKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYITDLS 180

Query: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240
           N+R+ EG +A VATEQDYYSFFIGAFNELF+TY++EKRLSVP+LFID ANGIGGPQLKKL
Sbjct: 181 NKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRLSVPRLFIDAANGIGGPQLKKL 240

Query: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300
           L S+DW VP +Q+EVIND+SDVPELLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 241 LTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCSFDGD 300

Query: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           ADRVVFYYVDS S+FHLLDGDKISTLFAKFLSKQLELAHLE+SL+IGVVQTAYANGSST 
Sbjct: 301 ADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANGSSTN 360

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           YI+NTL CPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH+ IKSELS+++
Sbjct: 361 YIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSELSRAR 420

Query: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480
             GD LAL+TL CFS+LINQTVGDA+SDMLAVLATLAI+KM+PMDWD+EYTDLPNKLVKC
Sbjct: 421 --GDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLVKC 478

Query: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540
           IVPDRSIFQT DQERKL NPVGLQ KIDLV+AKYPMGRSFVRASGTEDAVR+YAEC+DSS
Sbjct: 479 IVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQDSS 538

Query: 541 KLGQFCDEVVEHVKASA 557
           +L QFC+E+VE VKASA
Sbjct: 539 QLDQFCNEIVELVKASA 555

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 1017 bits (2629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/558 (87%), Positives = 526/558 (94%), Gaps = 4/558 (0%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
           MK+DYEQL KLYD+TCRTKNVQ+SYGTAGFRTLAK+LDTVMF+TGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYEQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA+WEPYAMQLANAASFAT+FEEF  EL KLIE 
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIEL 120

Query: 121 EKIDLN-TTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179
           EKIDL  + V PHIVVGRDSRESSPYLLRCLTS+MASVFHA+VLDLGCVTTPQLHYITDL
Sbjct: 121 EKIDLGASNVAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYITDL 180

Query: 180 SNRRKLEGDTA-PVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLK 238
           SNRR+ EGD+A   ATEQDYYSFFIGAFNELF TY +EKRLSVPKLFIDTANGIGGPQLK
Sbjct: 181 SNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRLSVPKLFIDTANGIGGPQLK 240

Query: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFD 298
           KLLAS+DW VP++Q+E+IND+SDVP+LLN ECGADYVKTNQRLPKGLSPSSF+SLYCSFD
Sbjct: 241 KLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYCSFD 300

Query: 299 GDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358
           GDADRVVFYYVDS  KFHLLDGDKISTLFAKFLSKQLE+A+LE SLKIGVVQTAYANGSS
Sbjct: 301 GDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYANGSS 360

Query: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418
           TAYIK+TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH+TI+SELSK
Sbjct: 361 TAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESELSK 420

Query: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478
              NG TLAL+TL CF++LINQTVGDA+SDMLAVLATLAILKM+PM+WDEEY DLPNKLV
Sbjct: 421 P--NGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKLV 478

Query: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD 538
           KCIVPDRSIFQTTDQERKL NPVGLQ KID V+AKYPMGRSFVRASGTEDAVRVYAEC+D
Sbjct: 479 KCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQD 538

Query: 539 SSKLGQFCDEVVEHVKAS 556
            SKL QFC+E+V +VKAS
Sbjct: 539 MSKLDQFCNEIVGYVKAS 556

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/556 (83%), Positives = 515/556 (92%), Gaps = 4/556 (0%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
           MK+DY+QL KLY++TC TKN+Q+SYGTAGFRTLAK+LDTVMF+TGILAVLRSLKLQGQYV
Sbjct: 1   MKIDYDQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120
           GVMITASHNPYQDNGVKIVEPDGSMLLA WEPYAMQLANAASFA  F+EF  EL KLIEH
Sbjct: 61  GVMITASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEH 120

Query: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180
           EKIDL+    PH+VVGRDSRESSP+LLRCLTS+MASVFHA V+DLGCVTTPQLHY+T+LS
Sbjct: 121 EKIDLD--AAPHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVTNLS 178

Query: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240
           N+R+ EG +A VATEQDYYSFFI AFNELF T Q+EKRLSVPKLF+DTANGIGGPQLKKL
Sbjct: 179 NKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRLSVPKLFVDTANGIGGPQLKKL 238

Query: 241 LASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGD 300
           LAS+DW VP++++E++ND+SDVP+LLNFECGADYVKTNQRLPKGLSPSS DSLYCSFDGD
Sbjct: 239 LASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCSFDGD 298

Query: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           ADRVVFYYVD  SKFHLLDGDKISTLFAKFLSKQLELA+L  SLKIGVVQTAYANGSST+
Sbjct: 299 ADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANGSSTS 358

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           YIK+TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFS+KFH+TI+SELS+++
Sbjct: 359 YIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESELSRAQ 418

Query: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480
             G  LAL TL+CF+ LINQTVGDAISDMLAVLATL+IL M+P DWD+EYTDLPNKLVKC
Sbjct: 419 --GSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLVKC 476

Query: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540
           IVPDRSIFQTTDQERKL NP GLQ KID V+ KY MGRSFVRASGTEDAVRVYAEC+D +
Sbjct: 477 IVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQDPT 536

Query: 541 KLGQFCDEVVEHVKAS 556
           KL QFC+EVVE+VK+S
Sbjct: 537 KLDQFCNEVVEYVKSS 552

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/555 (57%), Positives = 398/555 (71%), Gaps = 16/555 (2%)

Query: 5   YEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMI 64
           +  L  +++  C T+N ++ YGTAGFR  A  LDTVM +TG+LA LRS+ L G+ VGVMI
Sbjct: 3   WNVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMI 62

Query: 65  TASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKID 124
           TASHN   DNGVKIVEPDGSML  +WEP+A +LAN ASF  + +EF++ L +     K+D
Sbjct: 63  TASHNQPCDNGVKIVEPDGSMLDQSWEPFATELANKASFCHSTQEFKLYLQEKFAQYKVD 122

Query: 125 LNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRK 184
             + + P +VVGRDSR+S P LL+CL S    +   +++D G +TTPQLH++T+  N  K
Sbjct: 123 --SGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLTNAINTTK 180

Query: 185 LEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASE 244
                APV TE DYYSFF+ A+  + A + + K L  P+L+ID ANGIGGP++ KL   E
Sbjct: 181 ---SRAPV-TEDDYYSFFMDAWVSITALHGI-KVLQSPRLYIDAANGIGGPKVSKLF--E 233

Query: 245 DWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFD---SLYCSFDGDA 301
            W   A Q  ++N+    P LLN +CGADYVKTNQRLPK + P++     +LYCSFDGDA
Sbjct: 234 VWP-QAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGDA 292

Query: 302 DRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAY 361
           DR+VFYY D+ + FHLLDGDKISTLFA F+SKQL+ A L   + +GVVQTAYANG+ST Y
Sbjct: 293 DRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTNY 352

Query: 362 IKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKL 421
           ++N L+ PVSC KTGVKHLHHEA T YD+GIYFEANGHGTI+FS KF  T +S L   K 
Sbjct: 353 LENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLL---KE 409

Query: 422 NGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCI 481
           N ++L ++TL  F+ LINQTVGDAISDML VLA L+I+K++P  WD+EYTDLPN L K +
Sbjct: 410 NNESLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVV 469

Query: 482 VPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSK 541
           VPDRS+F TTDQERKLL P G Q KID +VAKY  GRSFVRASGTEDAVRVYAE      
Sbjct: 470 VPDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQD 529

Query: 542 LGQFCDEVVEHVKAS 556
                +EV + V AS
Sbjct: 530 AAALNEEVSKAVLAS 544

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/548 (54%), Positives = 398/548 (72%), Gaps = 14/548 (2%)

Query: 10  KLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHN 69
           KL++  C TK+ ++ YGTAGFR  A  L+TVMF+TGI+A LRS+ L G+ VGVMITASHN
Sbjct: 4   KLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDLNTTV 129
           P +DNGVKIVEP+G+ML  +WEP A +LAN A+ +T F++ +  + + ++    +  + V
Sbjct: 64  PPEDNGVKIVEPNGAMLDQSWEPMATELANIAANST-FDDLKAYVEEKVKKFSPESGSKV 122

Query: 130 VPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKLEGDT 189
            P +VVGRDSRES  YLL CL +S  +  +A++++ G +TTPQLH++T+  N +K     
Sbjct: 123 QPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEINVKK----- 177

Query: 190 APVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASEDWDVP 249
           +    E  YY++FI ++N++ A + +   L    L IDTANGIGGP++++LL S  W   
Sbjct: 178 SYAVQESSYYNYFIESWNKITALHNITD-LYCSSLTIDTANGIGGPKIQELLKS--WPF- 233

Query: 250 AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDS-LYCSFDGDADRVVFYY 308
           A +V ++N+  + P+LLN  CGAD+VKTNQ+LP G+S +S ++ LYCS+DGDADR+VFY+
Sbjct: 234 ASKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVFYF 293

Query: 309 VDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKNTLHC 368
            D   +FHLLDGDKISTLFAK ++K L  A+L   + +GVVQTAYANGSST Y++ TL+ 
Sbjct: 294 QDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTLNV 353

Query: 369 PVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGDTLAL 428
           PVSC KTGVKHLHHEA T YDIG+YFEANGHGTIIFS+ F++  + EL   K N +++A+
Sbjct: 354 PVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKEL---KANSESIAV 410

Query: 429 RTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVPDRSIF 488
            TL   S LINQTVGDAISDML VL+ L+I+K+S   WD EYTDLPN L K IVPDRS+F
Sbjct: 411 NTLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVF 470

Query: 489 QTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLGQFCDE 548
            TTDQERKLL+P GLQ KID  ++++  GRSFVRASGTEDAVRVYAE     +  +    
Sbjct: 471 ITTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNAL 530

Query: 549 VVEHVKAS 556
           V + VK S
Sbjct: 531 VTKLVKES 538

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/549 (55%), Positives = 385/549 (70%), Gaps = 26/549 (4%)

Query: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65
           E L  L +  C T+  ++ YGTAGFR  ++ LDTVMF+TGI+A LRS  L G+ VGVMIT
Sbjct: 3   EPLESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMIT 62

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125
           ASHNP  DNGVK+VEPDGSML+ +WE  A +LAN  +     E+ + ++ +L   E    
Sbjct: 63  ASHNPSGDNGVKVVEPDGSMLIQSWESTATELANLLA-NRPLEDIKAKVGQLTSGE---- 117

Query: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKL 185
            ++V P ++VGRDSR S P+LL CL +S  S+F A++ D G +TTPQLH++T   N   +
Sbjct: 118 -SSVRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLT---NETMI 173

Query: 186 EGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASED 245
            G       EQ Y++ F+GA++++ A     + + +P + +D ANGIGGP++  LL    
Sbjct: 174 TGAHV---DEQAYFAHFLGAWDQIAAL----QPVKLPNVVVDCANGIGGPKMSALLTQ-- 224

Query: 246 WDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDADRVV 305
           W   A+Q  VIND+ D PELLN  CGAD+VKT+QRLP G+ P++ D LYCSFDGDADRVV
Sbjct: 225 WGF-AKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNAND-LYCSFDGDADRVV 282

Query: 306 FYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKNT 365
           FYY+D    FHLLDGDKISTLFA F++K L+   L+  L +GVVQTAYANGSST Y+++ 
Sbjct: 283 FYYLDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDN 342

Query: 366 LHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGDT 425
           L  PVSCTKTGVKHLHHEA   YDIGIYFEANGHGT++FS KFH T+ +   +      T
Sbjct: 343 LQVPVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQ------T 396

Query: 426 LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVPDR 485
             L+ LK  ++LINQTVGDAISDM+AVLA L+IL+ SP  WD E+TDLPNKL K +V DR
Sbjct: 397 PELKILKYLAKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDR 456

Query: 486 SIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLGQF 545
           S F TTDQER+L++P GLQDKID  VA+   GRSFVRASGTEDAVRVYAE    S+  Q 
Sbjct: 457 SAFTTTDQERRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQL 516

Query: 546 CDEVVEHVK 554
              V + V+
Sbjct: 517 SSIVGDLVR 525

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/559 (53%), Positives = 388/559 (69%), Gaps = 27/559 (4%)

Query: 4   DYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVM 63
           D  QL   +   C T+N  ++YGTAGFR  A  LDTVMF+TGI+A+LRSL LQG+Y+GVM
Sbjct: 3   DITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIGVM 62

Query: 64  ITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKI 123
           ITASHNP QDNGVKIVEP G+ML+ +WE  A  LAN AS   NF  F + L+++I   K+
Sbjct: 63  ITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANIASHG-NFTAFVMHLSQVIA--KL 119

Query: 124 DLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRR 183
           +++ T  P ++VG DSRESSPYL+ CL ++ A VF   V++   +TTPQLHY+T L N  
Sbjct: 120 NIDETTTPRLIVGHDSRESSPYLMECLQAA-APVFDTIVINHTLITTPQLHYLTMLQND- 177

Query: 184 KLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLAS 243
                   V TE DYY FF  ++N LF+ Y  +  L+   L +D ANG+G  Q  K L  
Sbjct: 178 --------VVTEVDYYKFFSTSWNNLFSLYP-DLNLTFNNLIVDGANGVGSVQFSKFLPY 228

Query: 244 EDWDVP--AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDA 301
               +P  A    +IND+ +VP++LN +CGAD+VKTNQ+LP G+   +   LY SFDGDA
Sbjct: 229 ----LPQLATLTTIINDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFDGDA 284

Query: 302 DRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAY 361
           DR+VFYYVD+  KFHLLDGDKIST+  K L   L  + L + + +GVVQTAYANGSST Y
Sbjct: 285 DRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSSTKY 344

Query: 362 IKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSEL----S 417
           I  +L  PV CTKTGVKHLHH A +++DIGIYFEANGHGT++FS KF+  ++  +    S
Sbjct: 345 ITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDNGSS 404

Query: 418 KSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKL 477
             K++   L+L     FS+LINQTVGD+++D+LAV+ATL+IL++SP DWD EY DLPN L
Sbjct: 405 SEKIHKARLSLF---YFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLL 461

Query: 478 VKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECK 537
            KC V +R +F+TTD ERKL +P GLQ+KID  V+KY  GRSFVRASGTEDAVR+YAE K
Sbjct: 462 TKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAK 521

Query: 538 DSSKLGQFCDEVVEHVKAS 556
             +++     EV + V+ S
Sbjct: 522 TKAEVEALSKEVTQLVENS 540

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/566 (54%), Positives = 392/566 (69%), Gaps = 32/566 (5%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
            ++D  +   L+   C+TKN  ++YGTAGFR  A  LDTVMF+TG +A LRSL   G+ V
Sbjct: 3   FQLDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAV 62

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRV-ELAKLIE 119
           GVM+TASHNP  DNGVKIVEP+GSML   WEP A  LAN AS      + ++ EL + + 
Sbjct: 63  GVMVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLANLAS------QGKIDELVQFVN 116

Query: 120 HEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179
            + I+LN+  VP ++VGRDSRESS  LL CL      +F A+++D   +TTPQLH++T+ 
Sbjct: 117 AKLIELNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLHFLTNA 176

Query: 180 SNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLS---VPKLFIDTANGIGGPQ 236
            N   LE D   +  E DYY  F  A+++L +        +   +  L ID+ANGIGGP+
Sbjct: 177 YN---LEKD---LPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPK 230

Query: 237 LKKLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLS-----PSSFD 291
           ++ LL    W     +V +IN+    PE LN  CGADYVKTNQ+LP G++      SS +
Sbjct: 231 MENLLKY--WKTNY-KVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKN 287

Query: 292 SLYCSFDGDADRVVFYYVDSGSK-FHLLDGDKISTLFAKFLSKQLELAHL--EHSLKIGV 348
            ++CSFDGDADRVVFYY D  S  F+LLDGDKISTLFA F+S QL+LA +  E+ +K+GV
Sbjct: 288 VIHCSFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGV 347

Query: 349 VQTAYANGSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKF 408
           VQTAYANGSST Y++  L  PV+C KTGVKHLHHEA T+YDIG+YFEANGHGTIIFSE F
Sbjct: 348 VQTAYANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENF 407

Query: 409 HRTIKSELSKSKLNGDT---LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMD 465
           ++ I  +++      +T    AL+TLK  S LINQTVGDAISDM+ V+A LAIL  +P  
Sbjct: 408 YKIINQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQI 467

Query: 466 WDEEYTDLPNKLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASG 525
           W++EYTDLPNKL K +VPDRS+F+TTDQERKL +P GLQ KI+ +VAKY  GRSFVRASG
Sbjct: 468 WNKEYTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASG 527

Query: 526 TEDAVRVYAECKDSSKLGQFCDEVVE 551
           TEDAVRVYAE  D   + + C EV++
Sbjct: 528 TEDAVRVYAEASDD--VNKLCQEVLD 551

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/556 (55%), Positives = 388/556 (69%), Gaps = 17/556 (3%)

Query: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62
           V+ + L +LYD  C+T    ++YGTAGFR  A  LDTVMF+TGILA +RS+ L+GQYVGV
Sbjct: 2   VNIQLLEELYDKHCKT-GFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122
           MITASHNP QDNGVKIV+P G ML   WEP+A +LAN+AS     +E    L KLI   K
Sbjct: 61  MITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANSASKGK--QELIKALDKLIT--K 116

Query: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182
           + ++ T    I + RDSRES P LL+ +      + + QV+D   +TTPQLH++T   N 
Sbjct: 117 LGIDDTESAKITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQLHFLTYQYN- 175

Query: 183 RKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241
              +G ++ V  E  YYS F  A+ ++   + +    S+P ++ ID ANGIGGP++ ++L
Sbjct: 176 ---QGSSSKVE-ESTYYSAFSSAWTKICGLHDIN---SLPYRVIIDAANGIGGPKVSEML 228

Query: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDS-LYCSFDGD 300
               +   +  V VIN++   PELLN  CGADYVKTNQ  PKG+S +S +  +YCSFDGD
Sbjct: 229 LKNKF--FSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFDGD 286

Query: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           ADR+VFYY D  SKF+LLDGDKISTLFAKF  + L  A  E+ LK+GVVQTAYANGSST 
Sbjct: 287 ADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSSTE 346

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           Y+ + L  PVSCT TGVKHLHHEA   YDIGIYFEANGHGT+IFS++FH+TI  +L + +
Sbjct: 347 YLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKEPQ 406

Query: 421 LNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKC 480
                 AL+TL  F+ LINQTVGDAISDMLAVLA L ILK SP  WD+EYTDLPNKLVK 
Sbjct: 407 DEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLVKV 466

Query: 481 IVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSS 540
           IVPDRS+F+T++ ER+L++P GLQ+KID  V ++  GRSFVRASGTEDAVRVYAE     
Sbjct: 467 IVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAATKE 526

Query: 541 KLGQFCDEVVEHVKAS 556
           K  +    V + V  S
Sbjct: 527 KADRLAASVSDLVSRS 542

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/568 (54%), Positives = 395/568 (69%), Gaps = 29/568 (5%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQ-- 58
           M  + +QL   +++ C+TKN  ++YGTAGFR  AK LDTVMF+TGI+A LRSL LQ    
Sbjct: 5   MNTNKDQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNK 64

Query: 59  --YVGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAK 116
              +GVM+TASHNP +DNGVKI+EP+GSMLL  WEP A Q AN A+  + F+EF   L  
Sbjct: 65  HSAIGVMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFANIAANES-FDEFYQLLID 123

Query: 117 LIEHEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYI 176
            I   + DLN    P +++G DSR+SSP L+  +  S   +F+A++++   VTTPQLH++
Sbjct: 124 SIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQLHFL 183

Query: 177 TDLSNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQ 236
           T+L+N           A E +YY  F    ++L + Y     L    L ID ANGIG PQ
Sbjct: 184 TNLTNTTG-------TAEEINYYDHFNKYLSQLQSLYP-PFNLPFDNLIIDAANGIGAPQ 235

Query: 237 LKKLLASEDWDVP---AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFD-- 291
           ++KLL +++   P      +++IN+ S  P LLN  CGADYVKTNQ+LP+G+ P   D  
Sbjct: 236 VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGI-PKDIDAN 294

Query: 292 -SLYCSFDGDADRVVFYYVDS-GSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVV 349
            +L+CS+DGDADR+VFYY+D   + F+LLDGDKI+TLFAKF S  L +A L H LK+GVV
Sbjct: 295 STLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVV 354

Query: 350 QTAYANGSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFH 409
           QTAYANGSST YI + L  PVSCTKTGVKHLHHEA T+YDIGIYFEANGHGT+IFS+KFH
Sbjct: 355 QTAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFH 414

Query: 410 RTIKSELSKSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEE 469
               SEL+K K +G +  ++TL  FSELINQTVGDA+SDMLAV+A L+IL++SP  WD+E
Sbjct: 415 ----SELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKE 470

Query: 470 YTDLPNKLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDA 529
           Y DLPNKL K IVPDRS F TTDQERKL+ P GLQ  ++  VA   +GRSFVRASGTEDA
Sbjct: 471 YKDLPNKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDA 530

Query: 530 VRVYAECKDSSKL----GQFCDEVVEHV 553
           VRVYAE K   +      + C  V+E V
Sbjct: 531 VRVYAEAKTQEETEWLSKKVCQLVIESV 558

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/558 (51%), Positives = 388/558 (69%), Gaps = 14/558 (2%)

Query: 1   MKVDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYV 60
           M +D   L ++Y+ TC T++ +++YGTAGFR  A  LDTVMF+TGI+A  RS+ L G  V
Sbjct: 1   MTIDKSVLQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPV 60

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEH 120
           GVM+TASHNP  DNGVK+VEP G+ML+  WEP   +LAN A+  + FE+    + ++ + 
Sbjct: 61  GVMVTASHNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAANES-FEKVYDFILEVSKD 119

Query: 121 EKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLS 180
            K        P +++G DSRESSP L + L ++   +++A + + G VTTPQLH+IT L 
Sbjct: 120 PKFPFQENK-PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSLW 178

Query: 181 NRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKL 240
           N  K   +T  V +  +YY++F  ++++    Y      S   L ID+ANGIGGP++  L
Sbjct: 179 NA-KYNKNTNDVISVDNYYNYFNASWSKFQELYDFNSFKSFENLIIDSANGIGGPKVTDL 237

Query: 241 LASEDWDVPAE-QVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDG 299
           +++  W       V +IN+  + P LLN +CGADYVKTNQ+LPKG+   S  +L+CSFDG
Sbjct: 238 IST--WPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDG 295

Query: 300 DADRVVFYYV-DSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358
           DADR+VFYY+ +   KFHLLDGDKI+TLFAKFLS  L+  +L   LK+GVVQTAYANGSS
Sbjct: 296 DADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSS 355

Query: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418
           T Y+ N L  PVSCTKTGVKHLHHEA+T+YDIGIYFEANGHGT++FSE+F + +++E   
Sbjct: 356 TNYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNE--- 412

Query: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478
                 T A +TL  F ++INQTVGDA++DML V+  L++ K++P  WD+ Y DLPNKL 
Sbjct: 413 ----PKTTATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLA 468

Query: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD 538
           K IVPDRS+F TT+QER+L +PVGLQ+KID+ V+K   GRSFVRASGTEDAVRVYAE   
Sbjct: 469 KVIVPDRSVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAAT 528

Query: 539 SSKLGQFCDEVVEHVKAS 556
             +  +   EV + V +S
Sbjct: 529 QEETEKLSQEVCKFVLSS 546

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/555 (53%), Positives = 376/555 (67%), Gaps = 29/555 (5%)

Query: 8   LCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITAS 67
           L KL D  C   +  + YGTAGFR  A  LDTV+F+TGILA LRSL L+G  +GVM+TAS
Sbjct: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66

Query: 68  HNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEE--------FRVELAKLIE 119
           HNP  DNGVK+VEPDGSM+  +WEP A +LAN  +   +  E         + EL   ++
Sbjct: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126

Query: 120 HEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179
                 N  +VP +VVGRDSRES P LL CL +S   +FHA++ D G +TTPQLH++T  
Sbjct: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE 186

Query: 180 SNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRL-SVPKLFIDTANGIGGPQLK 238
           + +       A V TE  YY  F+ A++ +   + + + L ++  L ID ANGIG P+++
Sbjct: 187 TAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240

Query: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFD 298
           +LL+   W     QV  IND+   PELLN ECGAD+VK+NQR P G + S+   L CS+D
Sbjct: 241 ELLS--QWACRG-QVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCSYD 295

Query: 299 GDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358
           GDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L+  L +GVVQTAYANG+S
Sbjct: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355

Query: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418
           T Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ IK +  +
Sbjct: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKER 415

Query: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478
           S      +A+ TL+ FS LINQTVGDAISDML VLA L+I K +P  W +E+TDLPN+L 
Sbjct: 416 S------VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469

Query: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC-- 536
           K +VPDRS+F TTDQER+L  P GLQ KID  V  +  GRSFVRASGTEDAVRVYAE   
Sbjct: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529

Query: 537 -KDSSKLGQFCDEVV 550
            +D  KL     E+V
Sbjct: 530 LEDVEKLSNTVKELV 544

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/556 (54%), Positives = 381/556 (68%), Gaps = 31/556 (5%)

Query: 10  KLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHN 69
           +LY+  C T++  ++YGTAGFR  A+ LD+VMF+TG++A LRS+  Q   VGVMITASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 70  PYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDLNTTV 129
           P +DNGVKIVE DGSMLL  WEP A +LAN+ +   ++  F   L  +++  +++++   
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA---DYHTFESTLNAIMQ--ELNISPGH 118

Query: 130 VPHIVVGRDSRESSPYLLRCLTSSMASVF-HAQVLDLGCVTTPQLHYITDLSNRRKLEGD 188
            P IVVG DSRESSP LL  L   + +V   A++ + G +TTPQLH++T           
Sbjct: 119 APQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLT----------- 167

Query: 189 TAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASEDWDV 248
             P   E  YY +F+ A+N+LF  Y +E   S  KL IDTANGIGGPQ  K+L+    D+
Sbjct: 168 ANPAHFEDYYYRYFLDAWNQLFELYGIEGFKSFDKLVIDTANGIGGPQFLKMLSYSQTDL 227

Query: 249 P------AEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDAD 302
           P        Q+++ N+    P +LN  CGAD+VKTNQRLP+G++     +LYCSFDGDAD
Sbjct: 228 PHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADP-RNLYCSFDGDAD 286

Query: 303 RVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYI 362
           RVVFYYVD    FHLLDGDKISTL A F++  L+ A L   LK+GVVQTAYANGSST Y+
Sbjct: 287 RVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTTYV 346

Query: 363 KNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLN 422
              L  PVS  KTGVKHLHHEA T YDIG+YFEANGHGT+IFS+ F+  I+  L+K   N
Sbjct: 347 TKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAK---N 403

Query: 423 GDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIV 482
               +  TL+  S LINQT+GDAISDMLA++  L IL  SP  WD EYTDLPNKL K +V
Sbjct: 404 AHDKSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVV 463

Query: 483 PDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKD---S 539
           PDRSIF TTDQER+L++P GLQDKID++VA  P GRSF+RASGTEDAVRVYAE +    +
Sbjct: 464 PDRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEAT 523

Query: 540 SKLG-QFCDEVVEHVK 554
            KL  +  D ++E VK
Sbjct: 524 EKLSTEVTDALIETVK 539

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/541 (53%), Positives = 373/541 (68%), Gaps = 26/541 (4%)

Query: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62
           +D + L  LY+  C T    ++YGTAGFR  A  LDTVMF+TG++A LRS+ L+G+ VGV
Sbjct: 2   LDTKALKSLYEAHCST-GFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+AS    F EF   + +L+   K
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANSAS--QGFSEFVASVERLMT--K 116

Query: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182
           +++ +     IVV RDSRES P LL    S +  + + +V D G +TTPQLH++T  SN 
Sbjct: 117 LEVGSNDHGSIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQLHFLTSKSNE 176

Query: 183 RKLEGDTAPVATEQD---YYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLK 238
                   P  TE     YY  F+ A+ E+    +L K  S+P KL ID ANGIG P + 
Sbjct: 177 -------LPKGTEIGKSLYYDNFLSAWVEI---AELCKIDSLPYKLEIDAANGIGAPVVT 226

Query: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSF 297
           ++L+   +   A    V+ND  + P+ LN  CGAD+VKTNQ+LP G++P    + + CSF
Sbjct: 227 EMLSQHKFFKGA--FAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCSF 284

Query: 298 DGDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGS 357
           DGDADR+VFYY      FHLLDGDK++TLFAKF  + L  A L+  L++GVVQTAYANGS
Sbjct: 285 DGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANGS 344

Query: 358 STAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELS 417
           STAYI+  L   V+CT TGVKHLHHEA  +YDIG+YFEANGHGT++FS KF   I  +LS
Sbjct: 345 STAYIEQVLGISVTCTPTGVKHLHHEA-VKYDIGVYFEANGHGTVVFSSKFLDVIDRKLS 403

Query: 418 KSKLNGDTL--ALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPN 475
           + KL  D    +L+ L  F++LINQTVGDAISDMLAVLA L+ILK SP  WDEEYTDLPN
Sbjct: 404 E-KLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPN 462

Query: 476 KLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAE 535
           KL+K +VPDR++F+T + ER+L++P G+Q+KID +VA +  GRSFVRASGTEDAVRVYAE
Sbjct: 463 KLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAE 522

Query: 536 C 536
            
Sbjct: 523 A 523

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/533 (52%), Positives = 367/533 (68%), Gaps = 12/533 (2%)

Query: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65
           E++ KLYD  C ++  ++ YGTAGFR  A+ LDTV+F+TG+LA LRS+ L+GQYVG MIT
Sbjct: 5   EEVSKLYDKHCCSR-FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMIT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125
           ASHNP QDNGVK+V+P G ML   WE YA +LAN AS   +  +F   L +L+    I  
Sbjct: 64  ASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANCASDGKH--QFLHRLQELMNQFGIKA 121

Query: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKL 185
           ++     IVV RDSRES   LL+ L    +   +  ++D   +TTPQLH++T   NR ++
Sbjct: 122 DSEA--RIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTPQLHFLTYHLNR-QM 178

Query: 186 EGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASED 245
           E +      E  YYS F+ A  EL   + +   L  P L ID ANG+GG + ++L     
Sbjct: 179 ESERVIEVNEAFYYSHFLSALKELTELFNIPG-LPYP-LVIDAANGVGGAKAEELFMKNT 236

Query: 246 WDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSFDGDADRV 304
           +    +   +IN      +LLN  CGADYVKTNQ LP+G+S ++  +SL+CSFDGDADRV
Sbjct: 237 F--FKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINSLHCSFDGDADRV 294

Query: 305 VFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKN 364
           +FYY D    FHLLDGDKISTLFAKF    L +A ++ ++K+GVVQTAYANGSST Y+  
Sbjct: 295 IFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTAYANGSSTRYLSE 354

Query: 365 TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGD 424
            L  PVSCT TGVK+LH +A   YD+GIYFEANGHGT+IFSE F+ T+   L +  L+ +
Sbjct: 355 VLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTVSKRLKEGSLSAE 414

Query: 425 T-LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVP 483
           + +AL+TL+ FS+LINQTVGDA+SDM+AVLA L ILK +P  WD EYTDLPN L+K +VP
Sbjct: 415 SKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYTDLPNTLMKVVVP 474

Query: 484 DRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC 536
           DRS+F+TT+ ER+L++P GLQ +ID V+  Y   RSFVRASGTEDAVR+YAE 
Sbjct: 475 DRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVRIYAEA 527

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/556 (52%), Positives = 383/556 (68%), Gaps = 21/556 (3%)

Query: 3   VDYEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGV 62
           +D + L  LY+  C++    ++YGTAGFR  A  LDTVMF+TG+LA LRS+ L+G+ VGV
Sbjct: 2   LDTKTLETLYETHCKS-GFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVGV 60

Query: 63  MITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122
           MITASHNP +DNGVKIV+P G ML  +WE YA  LAN+A+   +F  F   L  L+   +
Sbjct: 61  MITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLANSAT--QSFTAFLAYLQNLVS--E 116

Query: 123 IDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNR 182
           + L+T  +  + V RDSRES P LL  L +    + + ++ D G +TTPQLH++T  S R
Sbjct: 117 LGLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQLHFLT--SKR 174

Query: 183 RKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241
            +L  DTA       YY  F+ A++++ A   ++   S+P KL ID ANGIG P++K++L
Sbjct: 175 NELPNDTA--IDRFFYYKEFLSAWDDITALCGIQ---SLPYKLEIDAANGIGAPRVKEML 229

Query: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSS-FDSLYCSFDGD 300
           ++  +        V+ND  + P  LN  CGADYVKTNQRLP G+  ++    + CSFDGD
Sbjct: 230 STHKFFDGV--FRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSFDGD 287

Query: 301 ADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           ADR+VFY+ DS  +F LLDGDK++TLFAKF    L  A+L+  L +GVVQTAYANGSST 
Sbjct: 288 ADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGSSTH 347

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           YI+  L  PV+CT TGVKHLHHEA   YDIG+YFEANGHGT++FS+KF   + S LS   
Sbjct: 348 YIERVLGIPVTCTPTGVKHLHHEA-INYDIGVYFEANGHGTVVFSKKFDEVVNSGLSNKH 406

Query: 421 LNGDTL-ALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVK 479
            +  +L +L  L  F+ LINQTVGDAISDM+ VLA L+ILK +P  W++EYTDLPNKLVK
Sbjct: 407 QSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNKLVK 466

Query: 480 CIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC--- 536
            +VPDR++F+TT+ ER+LL+P+GLQ KI+ +VA+Y   RSFVRASGTEDAVRVYAE    
Sbjct: 467 VLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEASTR 526

Query: 537 KDSSKLGQFCDEVVEH 552
           +++  L     +VVEH
Sbjct: 527 EEADSLASRVSQVVEH 542

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  528 bits (1359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/546 (52%), Positives = 364/546 (66%), Gaps = 15/546 (2%)

Query: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65
           +++ KLYD   R     ++YGTAGFR+ A+ L  V+F+TG+LA LRSL L G YVGVM+T
Sbjct: 5   QEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVGVMLT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125
           ASHNP +DNGVK+V+P G ML A WE +A  LAN AS     +E    L  L++   +DL
Sbjct: 64  ASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANCASQGQ--QELLDALHMLVDRLGLDL 121

Query: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDLSNRRKL 185
              +   +VV RDSR S P LL  L      +   +V+D G +TTPQLH++T   N R  
Sbjct: 122 --ALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQLHFLTCACNER-- 177

Query: 186 EGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVPKLFIDTANGIGGPQLKKLLASED 245
            G  A V  E  YY+ F+ A  EL A + LE  L  P L +DTANG+G  + ++L     
Sbjct: 178 -GSAAGV-REDLYYAHFVAALEELAALHGLET-LPFP-LVVDTANGVGALKARELFRRSP 233

Query: 246 WDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSF-DSLYCSFDGDADRV 304
             +   +V +IND     ELLN  CGADYVKT Q LP+G+S     +SL+CS+DGDADRV
Sbjct: 234 --LFKNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSYDGDADRV 291

Query: 305 VFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTAYIKN 364
           +FYY+D   +FHLLDGDKISTL AKFL   L  A +   + +GVVQTAYANGSST Y+  
Sbjct: 292 IFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGSSTRYLSE 351

Query: 365 TLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSKLNGD 424
            L  PVSCT TGVKHLH EA  +YD+GIYFEANGHGT+IFSE F  T++  L    L+  
Sbjct: 352 VLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALENPALSAK 411

Query: 425 T-LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVKCIVP 483
             L+L+TLK F+ LINQT+GDAI+DMLAV+A L+IL  SP DWD++YTDLPN LVK +VP
Sbjct: 412 ARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNNLVKVVVP 471

Query: 484 DRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLG 543
           DRS+F+TT+ E++L +P GLQ+ ID +V  Y  GRSFVRASGTEDAVR+YAE     +  
Sbjct: 472 DRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEAASQQQAD 531

Query: 544 QFCDEV 549
           +   +V
Sbjct: 532 ELATKV 537

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/555 (52%), Positives = 374/555 (67%), Gaps = 28/555 (5%)

Query: 5   YEQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMI 64
           YEQ CK        +   ++YGTAGFR     LDTVMF+TGI+AVLRS+ L+ ++VGVMI
Sbjct: 7   YEQYCK--------QGHAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMI 58

Query: 65  TASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKID 124
           TASHNP +DNGVK+VEP G ML+  WEP A +LANAAS  ++F +    L  +I    ID
Sbjct: 59  TASHNPPEDNGVKVVEPYGEMLVQNWEPIATKLANAAS--SSFTQLESTLQSIIAELNID 116

Query: 125 LNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHA-QVLDLGCVTTPQLHYITDLSNRR 183
             TT + +I V RDSRES P LL  L + + SVF A +++D   +TTPQLH++       
Sbjct: 117 --TTQLANITVARDSRESGPRLLAALKAGI-SVFPAVKIIDFELLTTPQLHFLV-----Y 168

Query: 184 KLEGDTAPVAT-EQDYYSFFIGAFNELFATYQLEKRLSVP-KLFIDTANGIGGPQLKKLL 241
            L   + P    +  YY  F+  +N+L   Y++ +   +P  L ID ANGIG  ++K+L+
Sbjct: 169 SLNTSSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE---LPFHLTIDCANGIGADKVKQLI 225

Query: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFDGDA 301
            S+   +    +  +N  +   +LLN  CGAD+VKTNQ  P   +P     LYCSFDGDA
Sbjct: 226 -SQAGHMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKP-SQLYCSFDGDA 283

Query: 302 DRVVFYYVDSG-SKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSSTA 360
           DRVVFYYVD   +KFHLLDGDKI+TL AK ++  L    L  +LK+GVVQTAYANGSST 
Sbjct: 284 DRVVFYYVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTK 343

Query: 361 YIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSKSK 420
           YI + L  PVSCTKTGVKHLHHEA ++YDIGIYFEANGHGT+IFS +F  T+ S L ++ 
Sbjct: 344 YITDKLKIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETS 403

Query: 421 LNGDT-LALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLVK 479
            N     +L +LK  S+LINQTVGDAISDMLAV+ATL+I  + P DWD  Y DLPN+L K
Sbjct: 404 GNEQQYKSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTK 463

Query: 480 CIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDS 539
            IVPDRS+F +T+ ER+LL+P GLQ KIDL+V ++P  RSFVRASGTEDAVRVYAE + +
Sbjct: 464 VIVPDRSVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETT 523

Query: 540 SKLGQFCDEVVEHVK 554
               +   +V E VK
Sbjct: 524 ESAIELATKVGELVK 538

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  508 bits (1309), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 279/558 (50%), Positives = 363/558 (65%), Gaps = 37/558 (6%)

Query: 6   EQLCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMIT 65
           E +  ++D  C TK   ++YGTAGFR  A  LDTVMF+TG +AVLRS +L G  VGVM+T
Sbjct: 4   EAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGVMVT 63

Query: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEKIDL 125
           ASHNP +DNGVK+V+P+G ML   WEP A +LAN A+  T F+++      L+E    + 
Sbjct: 64  ASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLANLAANGT-FDQWWEYWTSLVE----EG 118

Query: 126 NTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQV-LDLGCVTT-PQLHYITDLSNRR 183
           N T    + VG D+RESSP LL+ L  +  +V    + +    +T  PQLHY+T L    
Sbjct: 119 NYTGGARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQLHYLTSL---- 174

Query: 184 KLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRLSVP--KLFIDTANGIGGPQLKKLL 241
           + +G T   A    Y   F G + +LF     +  ++ P  +LFIDTANG+G  QL++  
Sbjct: 175 QRDGVTDAAA----YNDHFQGCWQKLFP----DGVVAWPFDRLFIDTANGVGAVQLQQFF 226

Query: 242 ASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLP------KGLSPSSFDSLYC 295
             + W V   +  ++N     PE LN +CGAD+VKTN RLP      +G S  +   LYC
Sbjct: 227 --KGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTS-GALPDLYC 283

Query: 296 SFDGDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYAN 355
           SFDGDADR+VFY+V +  +FHLLDGDKISTLFAKF+ +    A  +  L +GVVQTAYAN
Sbjct: 284 SFDGDADRIVFYFVKN-KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYAN 342

Query: 356 GSSTAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSE 415
           G+ST YI + L  P +CTKTGVKHLHH A TQYDIGIYFEANGHGT++FS+KF+  +   
Sbjct: 343 GNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAGV 402

Query: 416 LSKSKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPN 475
            S +       A  TL  FS+LINQTVGDAI+DML VLA L  L+ +P  W  EYTDLPN
Sbjct: 403 ASTND------AASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPN 456

Query: 476 KLVKCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAE 535
            L K +VPDRSIF+TTDQER+L++P GLQ+KID  V ++   RSFVRASGTE+AVR+Y E
Sbjct: 457 LLTKVVVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCE 516

Query: 536 CKDSSKLGQFCDEVVEHV 553
            +D  ++ +   +V E V
Sbjct: 517 AEDPQEVQELSKQVTEAV 534

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 18/149 (12%)

Query: 27  TAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86
            AGF+    N +     T ++     + L    +GVMITASHNP  DNG K+   +G  +
Sbjct: 126 NAGFKVYYLNPNDEFVHTPMVPF--GINLYSASIGVMITASHNPEMDNGYKVYYNNGCQI 183

Query: 87  LA------------TWEPYAMQLANAASFATNFEEFRVELAK--LIEHEKIDLNTTVVP- 131
           +               EP +      A  +   E  ++  +K  +++   ++L+  ++P 
Sbjct: 184 IPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPK 243

Query: 132 HIVVGRDSRESSPYLLRCLTSSMA-SVFH 159
           +I +G   +   P+ +      +   +FH
Sbjct: 244 NISLGTTIKGKKPWFVYTPMHGVGYQIFH 272

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           AGF+ +  N       T I+    ++   G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 129 AGFKVIFLNDGDKFVHTPIVPF--TVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186

Query: 88  ATWEPYAMQLANA 100
               P+  ++A +
Sbjct: 187 P---PHDSEIAQS 196

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           AGF+ L  N    +  T ++    ++      VGVMITASHNP  DNG K+   +G  ++
Sbjct: 124 AGFKVLYLNPGDTLVHTPLVPF--TVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181

Query: 88  ATWEPYAMQLANA 100
               P+ + +A +
Sbjct: 182 P---PHDLNIARS 191

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANA 100
           VGVMITASHNP  DNG K+   +G  ++    P+   ++NA
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQIIP---PHDQAISNA 188

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G  VG+MITASHNP  DNG K+   +G  ++
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNGCQII 181

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 45/107 (42%), Gaps = 14/107 (13%)

Query: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVK--------IV 79
           AGF+      D     T ++     L L+   VGVMITASHNP  DNG K        I+
Sbjct: 123 AGFKVFYLTPDDQFVHTPLVP-FSVLNLKAS-VGVMITASHNPKMDNGYKVYYDNACQII 180

Query: 80  EPD----GSMLLATWEPYAMQLANAASFATNFEEFRVELAKLIEHEK 122
            P       M+    EP++      A+F    E  ++   K +  EK
Sbjct: 181 PPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEK 227

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQII 175

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 20/31 (64%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87
           G   GVMITASHNP  DNG K+   +G  ++
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNGCQII 182

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 12/62 (19%)

Query: 60  VGVMITASHNPYQDNGVK--------IVEPDGSMLLAT----WEPYAMQLANAASFATNF 107
           +GVMITASHNP  DNG K        I+ P    + AT     EP++      ++F  N 
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNL 213

Query: 108 EE 109
           +E
Sbjct: 214 KE 215

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNGCQII 178

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNGCQII 178

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 24  SYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDG 83
           ++  AGF+    N +     T +  V  S+       GVMITASHNP  DNG K+   +G
Sbjct: 123 TFLNAGFKVFYLNTENEFVHTPL--VPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180

Query: 84  SMLL 87
             ++
Sbjct: 181 CQII 184

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87
           VGVMITASHNP  DNG K+   +G  ++
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQII 174

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           GVMITASHNP  DNG K+   +G  ++
Sbjct: 160 GVMITASHNPKMDNGYKVYYANGCQII 186

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 16/100 (16%)

Query: 61  GVMITASHNPYQDNGVKIVEPDG------------SMLLATWEPYAMQLANAASFATNFE 108
           G+MITASHNP  DNG K+   +G              +LA  EP+      AA  A   +
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNGCQIIPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQ 216

Query: 109 -EFRVELAKLIEHEKIDLNTTVVPHIVVGRDSRESSPYLL 147
            E  ++  K++  + +D   TV   +V+   +   +P+ +
Sbjct: 217 SEMLIDAKKVLVDQYVD---TVRRSLVITNVNHTKAPWFV 253

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 61  GVMITASHNPYQDNGVKIVEPDGSMLL 87
           G+MITASHNP  DNG K+   +G  ++
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNGCQII 182

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSML 86
           G   G+MITASHNP  DNG K+   +G  +
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQI 189

>TBLA0C01590 Chr3 complement(370571..371797) [1227 bp, 408 aa] {ON}
           Anc_1.456 YJR032W
          Length = 408

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 28/49 (57%)

Query: 506 KIDLVVAKYPMGRSFVRASGTEDAVRVYAECKDSSKLGQFCDEVVEHVK 554
           K+D+  A Y  G  ++     EDA++ Y  CK+++   +  D+ +EHV+
Sbjct: 326 KLDVAKAYYRSGNCYLAKKRLEDALKDYNLCKENNPNDKVVDQKIEHVE 374

>CAGL0K06655g Chr11 (648911..651319) [2409 bp, 802 aa] {ON} similar
           to uniprot|P32831 Saccharomyces cerevisiae YBR212w
           Negative growth regulatory protein
          Length = 802

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 62/153 (40%), Gaps = 31/153 (20%)

Query: 65  TASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASF---ATN--------FEEFRVE 113
           +AS+ P  D+G++  E + S    T +P  + + N  SF   AT         F EF   
Sbjct: 126 SASNTPASDSGIQTSEGEQS----TQQPLKINI-NGVSFIDPATTQLHHAGYCFVEFE-- 178

Query: 114 LAKLIEHEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQL 173
            ++    E + LN+T +P+ V     ++ +P   R    + AS      L     TTP+ 
Sbjct: 179 -SQKDAQEGLALNSTPLPNFVSTTTGQDINPTGQRTFRLNWAS---GATLQSSIPTTPEY 234

Query: 174 HYITDLSNRRKLEGDTAPVATEQDYYSFFIGAF 206
                        GD +P ATE D  S F   F
Sbjct: 235 SLFV---------GDLSPTATEADLLSLFQTKF 258

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,668,002
Number of extensions: 2486600
Number of successful extensions: 6440
Number of sequences better than 10.0: 51
Number of HSP's gapped: 6502
Number of HSP's successfully gapped: 51
Length of query: 557
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 442
Effective length of database: 40,294,809
Effective search space: 17810305578
Effective search space used: 17810305578
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)