Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL057Cna 1ON23323311671e-164
Smik_5.30na 1ON2342349251e-127
Skud_5.32na 1ON2332338801e-120
Suva_5.11na 1ON2332338681e-118
Skud_8.382.540ON62742740.55
KAFR0F037504.162ON27878701.6
ADL249W2.252ON38782683.1
Ecym_13848.863ON59886673.7
TBLA0J016707.170ON31236664.3
CAGL0F09009g5.303ON37055649.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL057C
         (233 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Prot...   454   e-164
Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON} YE...   360   e-127
Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON} YE...   343   e-120
Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON} YE...   338   e-118
Skud_8.38 Chr8 complement(74019..75902) [1884 bp, 627 aa] {ON} Y...    33   0.55 
KAFR0F03750 Chr6 complement(739286..740122) [837 bp, 278 aa] {ON...    32   1.6  
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    31   3.1  
Ecym_1384 Chr1 (797566..799362) [1797 bp, 598 aa] {ON} similar t...    30   3.7  
TBLA0J01670 Chr10 complement(370534..371472) [939 bp, 312 aa] {O...    30   4.3  
CAGL0F09009g Chr6 (883964..885076) [1113 bp, 370 aa] {ON} simila...    29   9.7  

>YEL057C Chr5 complement(45020..45721) [702 bp, 233 aa] {ON} Protein
           of unknown function involved in telomere maintenance;
           target of UME6 regulation
          Length = 233

 Score =  454 bits (1167), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 222/233 (95%), Positives = 222/233 (95%)

Query: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60
           MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK
Sbjct: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60

Query: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120
           DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH
Sbjct: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120

Query: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180
           LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA
Sbjct: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180

Query: 181 TSSIMVVRSSFIESDFFYEDYLIFDCXXXXXXXXXXXILFISTTMNFNYQTKV 233
           TSSIMVVRSSFIESDFFYEDYLIFDC           ILFISTTMNFNYQTKV
Sbjct: 181 TSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV 233

>Smik_5.30 Chr5 complement(47313..48017) [705 bp, 234 aa] {ON}
           YEL057C (REAL)
          Length = 234

 Score =  360 bits (925), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 175/234 (74%), Positives = 199/234 (85%), Gaps = 1/234 (0%)

Query: 1   MANDGIQRND-NRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNH 59
           M NDGIQRND N K  KTV+FSAYSKEIDVIM+KISFLE+NITQQL TLPHFPKTLPPNH
Sbjct: 1   MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH 60

Query: 60  KDCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQV 119
           K  V R +R +  WS+QL NLLGIYSK+EIFTLD+LAATLHDQVL+LQ+TLFP AIL+QV
Sbjct: 61  KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV 120

Query: 120 HLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFES 179
           HL+N N+ENK++LKEITY+YLS ENC   NKFGTFI+KRIFFGDLSLG+S+L+NR  FE+
Sbjct: 121 HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET 180

Query: 180 ATSSIMVVRSSFIESDFFYEDYLIFDCXXXXXXXXXXXILFISTTMNFNYQTKV 233
            TSSI+VVRSSFIE+DF YEDYLIFDC           ILFISTT+NFNYQTKV
Sbjct: 181 VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV 234

>Skud_5.32 Chr5 complement(44026..44727) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  343 bits (880), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 172/233 (73%), Positives = 193/233 (82%)

Query: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60
           MAN GIQ+NDN   FK  QFS YSKEI++IMKKI+FLERNITQQLDTLPHFPKTLPP+HK
Sbjct: 1   MANGGIQKNDNTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSHK 60

Query: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120
            C  R  + R  WS+QLKNLLGIYSKEEI TLDNLAATLHDQVLKLQA LFP AILKQVH
Sbjct: 61  TCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180
           LDN N+EN++ILKE+TY+YLS ENC+ E KFG FIVKRIFFGDLSLGVS+L+NR+ FE+ 
Sbjct: 121 LDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFETV 180

Query: 181 TSSIMVVRSSFIESDFFYEDYLIFDCXXXXXXXXXXXILFISTTMNFNYQTKV 233
           TSSI++V SSFIE+DFFYEDYLI  C           ILFIS T+NFNYQTKV
Sbjct: 181 TSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV 233

>Suva_5.11 Chr5 complement(21032..21733) [702 bp, 233 aa] {ON}
           YEL057C (REAL)
          Length = 233

 Score =  338 bits (868), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/233 (70%), Positives = 191/233 (81%)

Query: 1   MANDGIQRNDNRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNHK 60
           MAN GIQ+ND   G KTV F   SKEID+IMKKISFLERNIT+QLDTLP FPKTLPPNH+
Sbjct: 1   MANGGIQKNDGTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNHE 60

Query: 61  DCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQVH 120
             ++R  R +  W +QLKNLLGIYS++EI TLDNLAATLHDQVLKLQA LFP AILKQVH
Sbjct: 61  TRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQVH 120

Query: 121 LDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFESA 180
           L+  N+ENK+ILKEITY+YLS +NC+ E+KFG FIV+RIFFGDLSLGVS+L+NRIAFE+ 
Sbjct: 121 LNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFETV 180

Query: 181 TSSIMVVRSSFIESDFFYEDYLIFDCXXXXXXXXXXXILFISTTMNFNYQTKV 233
            SSI+VVRSSFIE+DF YEDYLI+             I+FISTT+NFNYQTKV
Sbjct: 181 GSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV 233

>Skud_8.38 Chr8 complement(74019..75902) [1884 bp, 627 aa] {ON}
           YHL008C (REAL)
          Length = 627

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%)

Query: 46  DTLPHFPKTLPPNHKDCVSRKHRARRGWSSQLKNLLGIYSKE 87
           DT PH   T  P + D V   H  RR  S+ L  LLG+ S E
Sbjct: 521 DTFPHNAPTSSPTYTDDV---HSPRRANSATLGGLLGVVSTE 559

>KAFR0F03750 Chr6 complement(739286..740122) [837 bp, 278 aa] {ON}
           Anc_4.162 YGR026W
          Length = 278

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 41/78 (52%), Gaps = 9/78 (11%)

Query: 110 LFPNAILKQVHLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVS 169
           L P  IL  +HL N N E K+  K+   K ++ EN K        ++  I + ++ + V+
Sbjct: 146 LLPFMILSYMHLINKNNEFKKDSKDEDVK-VTRENVK--------LLHLIAYSEVLVAVT 196

Query: 170 VLINRIAFESATSSIMVV 187
           +L++ I F++ TS  M V
Sbjct: 197 LLLDAILFKTGTSGFMFV 214

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 30.8 bits (68), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 9/82 (10%)

Query: 109 TLFPNAI-LKQVHLDNANIENKRILKEI-TYKYLSNENCKEENKFGTFIVKRIFFGDLSL 166
            L P A+ L Q H+D  N E +RI+K + T  ++ N+     +    FI+ R+  GD SL
Sbjct: 274 ALQPEALKLMQKHIDQINTEKRRIIKALATLNHIENDPVGGLD--ANFILFRVRGGDNSL 331

Query: 167 GVSVLINRIAFESATSSIMVVR 188
                  ++ +  AT S +++R
Sbjct: 332 A-----KKLYYSLATESGVIIR 348

>Ecym_1384 Chr1 (797566..799362) [1797 bp, 598 aa] {ON} similar to
           Ashbya gossypii AFR438W
          Length = 598

 Score = 30.4 bits (67), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 38/86 (44%), Gaps = 10/86 (11%)

Query: 59  HKDCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAAT----------LHDQVLKLQA 108
           H+   SR+      W+ QLK  L IY +EE    + L A           + D+ L+L+ 
Sbjct: 458 HRKTSSRRSDKSNKWNEQLKAQLSIYDEEERLKREKLDAEERLRRNFVGDVEDEELQLKI 517

Query: 109 TLFPNAILKQVHLDNANIENKRILKE 134
            L  +   +  H D  + E ++ L+E
Sbjct: 518 ALLESESTELHHQDTFDEELQQALEE 543

>TBLA0J01670 Chr10 complement(370534..371472) [939 bp, 312 aa] {ON}
           Anc_7.170 YBR251W
          Length = 312

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 111 FPNAILKQVHLDNANIENKRILKEITYKYLSNENCK 146
           F NA+ KQ  LD   I+NK  +K +  K +SN+  K
Sbjct: 129 FANALAKQTGLDPLFIKNKLTMKPLVLKRVSNQTAK 164

>CAGL0F09009g Chr6 (883964..885076) [1113 bp, 370 aa] {ON} similar
           to uniprot|P38772 Saccharomyces cerevisiae YHR040w
          Length = 370

 Score = 29.3 bits (64), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 32/55 (58%), Gaps = 8/55 (14%)

Query: 118 QVHLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLI 172
           +V +D++  +NKRIL+EI   Y++N+  +  +   + +++R        GVS L+
Sbjct: 83  EVQIDDSKRKNKRILREIYDPYMANKRQRGNSDNSSRLIRR--------GVSCLM 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,845,769
Number of extensions: 998289
Number of successful extensions: 3098
Number of sequences better than 10.0: 21
Number of HSP's gapped: 3183
Number of HSP's successfully gapped: 21
Length of query: 233
Length of database: 53,481,399
Length adjustment: 106
Effective length of query: 127
Effective length of database: 41,326,803
Effective search space: 5248503981
Effective search space used: 5248503981
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 64 (29.3 bits)