Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL056W (HAT2)6.9ON40140120800.0
Skud_5.336.9ON40140018610.0
Smik_5.316.9ON42740118550.0
Suva_5.126.9ON40140118350.0
NDAI0K029006.9ON43841212601e-172
NCAS0F001906.9ON41139912011e-163
TDEL0G046206.9ON39240311971e-163
ZYRO0F00462g6.9ON39340011931e-162
KNAG0E009806.9ON41440111851e-161
Kpol_1045.786.9ON39240111681e-159
Ecym_30126.9ON39739011351e-154
SAKL0E00814g6.9ON39839511141e-151
CAGL0B03575g6.9ON41939910941e-147
KLLA0D00814g6.9ON40840110781e-145
ACR017W6.9ON42339710601e-142
TPHA0M001906.9ON39140010531e-141
KAFR0L003206.9ON39140410501e-141
KLTH0C11550g6.9ON39838610481e-140
Kwal_56.223456.9ON39638910121e-135
TBLA0A071206.9ON4074129911e-132
KLTH0E12694g8.548ON4184112958e-29
ZYRO0A13068g8.548ON3974062861e-27
Kpol_1024.398.548ON4174182772e-26
Ecym_70428.548ON4144082772e-26
SAKL0H09900g8.548ON4254132754e-26
KLLA0E23541g8.548ON4174062711e-25
Kwal_27.120708.548ON4184232702e-25
YBR195C (MSI1)8.548ON4224182702e-25
NDAI0C055108.548ON4194242683e-25
CAGL0M05291g8.548ON4194292683e-25
Smik_2.3358.548ON4224192684e-25
Suva_4.4498.548ON4244262676e-25
Skud_2.3218.548ON4224182667e-25
TBLA0H036508.548ON4194162667e-25
KAFR0I008408.548ON4134192641e-24
TPHA0L017208.548ON4194192641e-24
AEL250C8.548ON4174132631e-24
TDEL0B029808.548ON4124192587e-24
NCAS0B021708.548ON4144162445e-22
KNAG0A036708.548ON4264162384e-21
Suva_13.3112.401ON5104221364e-08
KAFR0A003802.401ON5164081339e-08
TPHA0G026502.401ON5164361283e-07
YMR131C (RRB1)2.401ON5114011267e-07
AAR078W7.356ON5621571258e-07
TDEL0G033402.401ON5144021258e-07
CAGL0K03861g2.401ON5133951259e-07
SAKL0F11506g7.356ON5681551232e-06
KAFR0L015207.356ON5841561204e-06
YLR196W (PWP1)7.356ON5761501195e-06
ADR242C2.401ON5212501185e-06
Skud_13.2912.401ON5094111186e-06
NCAS0B036908.288ON11451221197e-06
Suva_10.2927.356ON5801501187e-06
Skud_12.2617.356ON5801561187e-06
KLLA0E19515g7.356ON5721551177e-06
Smik_13.3292.401ON5094061179e-06
TDEL0A068906.276ON4473561161e-05
Kwal_56.246617.356ON5611511161e-05
Smik_12.2567.356ON5761501151e-05
KLLA0F17237g2.401ON5231381151e-05
KNAG0B025807.356ON5801331151e-05
KNAG0I010508.288ON11591231152e-05
Smik_6.3488.672ON4511291123e-05
KNAG0E021802.401ON5171411123e-05
SAKL0H06666g8.672ON4411251105e-05
Kpol_1060.246.276ON4861881105e-05
NDAI0J011808.288ON11341201116e-05
Kpol_530.257.356ON5741561106e-05
KLLA0E08449g2.283ON4222301097e-05
Kpol_1041.202.401ON5152461097e-05
Kwal_56.236858.288ON11021191108e-05
ZYRO0B02486g7.356ON5751481098e-05
NCAS0F019702.401ON5111381099e-05
KNAG0B064504.309ON6341441081e-04
NDAI0H027502.401ON5121381081e-04
Sklu_YGOB_Anc_2.4012.401ON5203861071e-04
TBLA0C050107.356ON5721501071e-04
TBLA0B092502.401ON5263991071e-04
Kwal_47.178272.401ON5231331071e-04
Skud_16.1318.672ON4511291062e-04
YPL151C (PRP46)8.672ON4511291062e-04
NDAI0E044407.356ON5811501062e-04
ZYRO0E08184g6.276ON5063301062e-04
TBLA0D040208.288ON11781231062e-04
CAGL0A04037g7.356ON5831501062e-04
Suva_16.1598.672ON4511291052e-04
TDEL0C019207.356ON5631501052e-04
TPHA0F030307.356ON5821561052e-04
KLTH0E09394g2.401ON5221331052e-04
Kwal_56.24399na 1ON3691491043e-04
Kwal_55.220673.25ON4512191043e-04
TBLA0C018408.672ON4231241043e-04
KLTH0H01122g7.356ON5791551043e-04
KAFR0H024508.672ON4172041033e-04
KLTH0F19294g3.25ON4512231034e-04
KLTH0A06754g6.340ON5142681034e-04
KLTH0G13068g8.288ON11011191044e-04
KNAG0A030808.651ON4462551034e-04
Ecym_60672.401ON5222391034e-04
KAFR0B055808.288ON11201221044e-04
Ecym_47177.356ON6031631034e-04
Suva_11.2681.247ON6452391034e-04
NCAS0G011206.276ON4941701025e-04
YKR036C (CAF4)1.247ON6432171025e-04
Skud_11.2711.247ON6462391026e-04
Kwal_26.87768.672ON4331251016e-04
ZYRO0B10450g5.201ON4822741017e-04
SAKL0H16390g8.288ON11401191010.001
TDEL0A061808.672ON4342041000.001
KLTH0D11132g8.672ON437125980.001
ZYRO0D06556g8.288ON1147242990.001
KAFR0A033801.247ON666128990.001
Smik_13.2772.469ON513182980.002
AEL314W1.247ON715172980.002
KNAG0I028406.340ON519259980.002
YCR072C (RSA4)6.340ON515262970.002
TPHA0G031002.469ON509183970.002
KLTH0G10296g2.283ON426147970.002
NCAS0B01440na 2ON428260970.002
ZYRO0A08690g2.401ON516133970.002
TBLA0A038908.316ON362239960.002
KLLA0C08547g6.340ON515242960.003
Suva_3.1096.340ON515262960.003
KLLA0F15598g5.201ON478157960.003
YMR093W (UTP15)2.469ON513182960.003
KLTH0C07634g3.259ON425272960.003
AEL269C7.534ON455156960.003
Kpol_1072.178.672ON433210960.003
NCAS0E028407.356ON607148960.003
Skud_13.2492.469ON513206960.003
SAKL0D04796g1.247ON769195960.003
TDEL0D010904.309ON642168960.003
Ecym_42808.288ON1132126960.004
Suva_10.5454.309ON642123950.004
CAGL0D05588g5.201ON477122940.005
Kwal_33.151365.201ON47397940.005
Kwal_23.63246.340ON514262940.005
Smik_3.1726.340ON515262940.005
KAFR0E012303.259ON369133930.005
TDEL0E042805.201ON481135940.006
ZYRO0F07282g8.672ON427204930.006
AGR067W8.288ON1125119940.006
Ecym_33212.283ON409189930.006
ZYRO0D08206g6.340ON515286930.006
Suva_13.2702.469ON513207930.006
KNAG0A032208.631ON423153930.006
KAFR0H033402.283ON367205930.006
KAFR0G01900na 2ON426260930.007
TDEL0A075506.340ON515265930.007
Smik_12.5254.309ON652123930.007
AAL157C5.201ON47983930.007
KLTH0B03410g5.201ON477120930.007
Kpol_1028.416.340ON512211930.007
KAFR0J009805.201ON480138930.007
SAKL0G12892g5.201ON476122930.007
Skud_12.5214.309ON645123920.008
Suva_14.3112.283ON389195920.009
Kpol_2002.995.201ON487122920.009
Skud_4.3898.288ON1151129930.009
YNL317W (PFS2)3.25ON465172920.010
KAFR0G019708.631ON425161910.011
Smik_11.2981.247ON662218910.012
TBLA0E045704.309ON595136910.012
KAFR0A056104.309ON620123910.012
Skud_3.1456.340ON515259910.013
NDAI0E01320na 2ON427260900.014
Suva_14.223.25ON469113900.014
TBLA0F041306.340ON514304900.015
KLTH0B00924g1.534ON714106900.015
Smik_4.3748.288ON1152129910.015
TPHA0B005904.309ON588123900.015
KLLA0F19734g8.288ON1133126900.017
CAGL0L02761g8.631ON419152890.017
KLLA0F11231g8.672ON434125890.018
Smik_14.143.25ON466172890.019
Kpol_2001.657.322ON1206212900.019
TPHA0C010508.288ON1124117900.019
TPHA0E030805.201ON488122890.019
TDEL0A059708.651ON475390890.020
YLR429W (CRN1)4.309ON651123890.021
SAKL0A01276g6.340ON515262890.021
NDAI0G038303.25ON510115890.021
NCAS0D027305.201ON47597890.021
Suva_16.606.276ON526223890.022
Suva_10.645.201ON490122890.022
CAGL0M04081g3.25ON455265880.023
Kwal_27.115502.283ON407101880.023
NCAS0C044503.25ON461113880.024
Smik_12.525.201ON489122880.024
TPHA0M018306.340ON515219880.024
Suva_2.2918.288ON1151129890.026
AER114W4.309ON633119880.026
SAKL0E07766g2.283ON39891870.028
CAGL0J03960g8.651ON435198870.033
KLTH0E08096g4.119ON41098870.034
KNAG0J016808.672ON398129870.035
AER263C6.340ON513304870.035
Skud_14.223.25ON467114870.037
Kpol_1065.303.344ON522150870.038
YNL035C2.283ON389198860.040
ZYRO0C03124g3.25ON445113860.044
KAFR0I028403.25ON456113860.044
YLL011W (SOF1)5.201ON489122860.045
KAFR0F043506.340ON515222860.046
YDR128W (MTC5)8.288ON1148127860.051
ACR137W8.672ON425204850.052
TBLA0D055601.247ON589185860.053
TPHA0P014903.25ON459113850.057
CAGL0H00781g6.276ON513367850.058
Kpol_1019.307.310ON1252187860.061
Ecym_24018.672ON426122850.061
Kpol_1033.198.288ON1139112860.061
NCAS0C032608.324ON98378860.062
NDAI0I021805.201ON47997850.062
CAGL0B02013g8.288ON1120129860.062
TDEL0F041508.288ON1134119850.064
NDAI0G006302.283ON397134840.066
TPHA0B011201.247ON719172850.070
NDAI0E024008.672ON434206840.071
Smik_15.4138.651ON469202840.072
CAGL0J01265g2.469ON517183840.080
KLLA0E07085g3.25ON452212840.081
Ecym_24986.340ON542219840.083
NDAI0J024904.309ON629125840.084
Skud_14.2982.283ON389135830.086
CAGL0M02277g8.672ON427125840.087
Suva_4.537.310ON1271160840.087
NDAI0I003506.340ON515262840.093
TBLA0E007607.534ON384134830.095
KLTH0H02508gna 1ON309152830.096
NDAI0J010408.316ON39880830.098
NCAS0F033405.429ON44848830.098
Skud_16.326.276ON522227830.10
YPL247C6.276ON523181830.10
Kwal_26.87008.651ON381262830.10
TBLA0H020005.201ON47397830.11
KNAG0M017505.201ON48597830.11
NCAS0C016808.672ON431124830.12
CAGL0J03476g6.340ON517259830.12
Smik_14.2962.283ON389136820.12
Smik_6.4516.276ON523170830.12
TBLA0B059202.283ON403152820.12
SAKL0H07150g8.651ON441253820.13
ADL322C3.344ON501174820.13
NDAI0F012406.276ON524163820.13
CAGL0F06853g2.663ON388126820.14
NCAS0G043001.534ON72591820.14
Skud_12.565.201ON489122820.15
TDEL0D013101.247ON709172820.15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL056W
         (401 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   805   0.0  
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   721   0.0  
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   719   0.0  
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   711   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     489   e-172
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   467   e-163
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   465   e-163
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   464   e-162
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   461   e-161
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   454   e-159
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   441   e-154
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   433   e-151
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   426   e-147
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   419   e-145
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   412   e-142
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   410   e-141
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   409   e-141
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   408   e-140
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   394   e-135
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   386   e-132
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   118   8e-29
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   114   1e-27
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   111   2e-26
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   111   2e-26
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   110   4e-26
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   108   1e-25
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   108   2e-25
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   108   2e-25
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   107   3e-25
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   107   3e-25
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   107   4e-25
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   107   6e-25
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   107   7e-25
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   107   7e-25
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   106   1e-24
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   106   1e-24
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   105   1e-24
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   103   7e-24
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    99   5e-22
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    96   4e-21
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    57   4e-08
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    56   9e-08
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    54   3e-07
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    53   7e-07
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    53   8e-07
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    53   8e-07
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    53   9e-07
SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {...    52   2e-06
KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {...    51   4e-06
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    50   5e-06
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    50   5e-06
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    50   6e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    50   7e-06
Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196...    50   7e-06
Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196...    50   7e-06
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    50   7e-06
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    50   9e-06
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    49   1e-05
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    49   1e-05
Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196...    49   1e-05
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    49   1e-05
KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.3...    49   1e-05
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    49   2e-05
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    48   3e-05
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    48   3e-05
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    47   5e-05
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    47   5e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    47   6e-05
Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON} (67445..6...    47   6e-05
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    47   7e-05
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    47   7e-05
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    47   8e-05
ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {...    47   8e-05
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    47   9e-05
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    46   1e-04
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    46   1e-04
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    46   1e-04
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    46   1e-04
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    46   1e-04
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    46   1e-04
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    45   2e-04
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    45   2e-04
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    45   2e-04
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    45   2e-04
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    45   2e-04
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    45   2e-04
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    45   2e-04
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    45   2e-04
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    45   2e-04
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    45   2e-04
Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [conti...    45   3e-04
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    45   3e-04
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    45   3e-04
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    45   3e-04
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    44   3e-04
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    44   4e-04
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    44   4e-04
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    45   4e-04
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    44   4e-04
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    44   4e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    45   4e-04
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    44   4e-04
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    44   4e-04
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    44   5e-04
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    44   5e-04
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    44   6e-04
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    44   6e-04
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    44   7e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    44   0.001
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    43   0.001
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.001
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    43   0.001
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    43   0.001
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    42   0.002
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    42   0.002
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    42   0.002
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    42   0.002
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    42   0.002
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    42   0.002
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               42   0.002
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    42   0.002
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    42   0.002
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    42   0.003
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    42   0.003
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    42   0.003
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    42   0.003
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    42   0.003
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    42   0.003
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    42   0.003
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    42   0.003
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    42   0.003
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    42   0.003
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    42   0.003
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    42   0.004
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    41   0.004
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    41   0.005
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    41   0.005
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    41   0.005
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    41   0.005
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    40   0.005
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    41   0.006
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    40   0.006
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    41   0.006
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    40   0.006
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    40   0.006
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    40   0.006
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    40   0.006
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    40   0.006
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               40   0.007
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    40   0.007
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    40   0.007
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    40   0.007
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    40   0.007
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    40   0.007
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    40   0.007
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    40   0.007
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    40   0.008
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    40   0.009
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    40   0.009
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    40   0.009
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    40   0.010
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    40   0.011
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    40   0.012
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    40   0.012
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    40   0.012
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    40   0.013
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    39   0.014
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    39   0.014
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    39   0.015
KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON...    39   0.015
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    40   0.015
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    39   0.015
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    39   0.017
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    39   0.017
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    39   0.018
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    39   0.019
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    39   0.019
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    39   0.019
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    39   0.019
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    39   0.020
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    39   0.021
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    39   0.021
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      39   0.021
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     39   0.021
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    39   0.022
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    39   0.022
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    39   0.023
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    39   0.023
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      39   0.024
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    39   0.024
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    39   0.024
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    39   0.026
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    39   0.026
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    38   0.028
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    38   0.033
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    38   0.034
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    38   0.035
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    38   0.035
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    38   0.037
Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {O...    38   0.038
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    38   0.040
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    38   0.044
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    38   0.044
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    38   0.045
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    38   0.046
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    38   0.051
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    37   0.052
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    38   0.053
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    37   0.057
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    37   0.058
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    38   0.061
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    37   0.061
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    38   0.061
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    38   0.062
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    37   0.062
CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highl...    38   0.062
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    37   0.064
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    37   0.066
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    37   0.070
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     37   0.071
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    37   0.072
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.080
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    37   0.081
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    37   0.083
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    37   0.084
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    37   0.086
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    37   0.087
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    37   0.087
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       37   0.093
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               37   0.095
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    37   0.096
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    37   0.098
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    37   0.098
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    37   0.10 
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    37   0.10 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    37   0.10 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    37   0.11 
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    37   0.11 
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     37   0.12 
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    37   0.12 
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    36   0.12 
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    37   0.12 
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    36   0.12 
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    36   0.13 
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    36   0.13 
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    36   0.13 
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    36   0.14 
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    36   0.14 
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    36   0.15 
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    36   0.15 
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    36   0.15 
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    36   0.16 
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    36   0.16 
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    36   0.16 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    36   0.16 
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    36   0.16 
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    36   0.16 
KAFR0A04080 Chr1 (820402..821889) [1488 bp, 495 aa] {ON} Anc_8.7...    36   0.17 
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     36   0.17 
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    36   0.17 
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    36   0.18 
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    36   0.18 
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    36   0.19 
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    36   0.20 
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    36   0.21 
TPHA0K01570 Chr11 (329273..330553) [1281 bp, 426 aa] {ON} Anc_4....    35   0.22 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    35   0.22 
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    35   0.22 
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               35   0.23 
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    35   0.24 
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    35   0.25 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    35   0.25 
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    35   0.25 
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    35   0.26 
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    35   0.26 
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    35   0.27 
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    35   0.28 
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       35   0.28 
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    35   0.28 
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    35   0.28 
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    35   0.30 
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    35   0.30 
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    35   0.33 
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    35   0.34 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    35   0.37 
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    35   0.37 
Smik_4.265 Chr4 complement(483300..484820) [1521 bp, 506 aa] {ON...    35   0.38 
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    35   0.40 
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    35   0.41 
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    35   0.42 
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    35   0.43 
NCAS0C05310 Chr3 complement(1079501..1080550) [1050 bp, 349 aa] ...    34   0.45 
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    34   0.50 
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    34   0.57 
ACR162C Chr3 complement(637642..640224) [2583 bp, 860 aa] {ON} S...    34   0.60 
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    34   0.67 
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    34   0.68 
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    34   0.70 
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    34   0.70 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    34   0.71 
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    34   0.73 
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    34   0.78 
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    33   0.82 
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    34   0.83 
ZYRO0G10494g Chr7 complement(846835..848133) [1299 bp, 432 aa] {...    33   0.84 
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    34   0.85 
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    34   0.86 
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    34   0.86 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    34   0.89 
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    34   0.90 
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    33   0.90 
TBLA0A09610 Chr1 (2369818..2370978) [1161 bp, 386 aa] {ON} Anc_5...    33   0.91 
CAGL0K11638g Chr11 complement(1124172..1125950) [1779 bp, 592 aa...    33   0.92 
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    34   0.93 
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    33   0.93 
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    34   0.93 
Suva_8.318 Chr8 (565468..566961) [1494 bp, 497 aa] {ON} YOR269W ...    33   0.94 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    33   0.96 
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    33   1.0  
CAGL0C02937g Chr3 (290289..291692) [1404 bp, 467 aa] {ON} simila...    33   1.0  
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    33   1.1  
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    33   1.1  
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    33   1.1  
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    33   1.1  
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    33   1.2  
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    33   1.2  
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    33   1.2  
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    33   1.2  
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    33   1.3  
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    33   1.3  
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    33   1.4  
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    33   1.4  
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    33   1.4  
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    33   1.4  
Suva_13.325 Chr13 complement(536805..537848) [1044 bp, 347 aa] {...    33   1.4  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    33   1.5  
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    33   1.5  
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    33   1.6  
Ecym_6167 Chr6 complement(309181..310437) [1257 bp, 418 aa] {ON}...    33   1.7  
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    33   1.7  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    33   1.7  
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    33   1.7  
NDAI0E00950 Chr5 complement(192199..193734) [1536 bp, 511 aa] {O...    33   1.7  
ZYRO0G11660g Chr7 (924314..926665) [2352 bp, 783 aa] {ON} simila...    33   1.8  
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    32   1.8  
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    33   1.8  
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    33   1.8  
KNAG0G02790 Chr7 (617832..619247) [1416 bp, 471 aa] {ON} Anc_8.7...    33   1.9  
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    32   1.9  
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    32   1.9  
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    32   2.0  
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    33   2.0  
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    33   2.0  
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    32   2.0  
Suva_2.29 Chr2 complement(47586..55955) [8370 bp, 2789 aa] {ON} ...    33   2.1  
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    32   2.1  
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    32   2.1  
NDAI0F02240 Chr6 (542551..545610) [3060 bp, 1019 aa] {ON} Anc_6....    33   2.1  
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    33   2.2  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    32   2.2  
Kpol_526.37 s526 complement(88726..89769) [1044 bp, 347 aa] {ON}...    32   2.3  
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    32   2.3  
Skud_2.229 Chr2 (415869..417506) [1638 bp, 545 aa] {ON} YBR103W ...    32   2.3  
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    32   2.4  
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    32   2.4  
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    32   2.4  
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    32   2.4  
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    32   2.4  
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    32   2.4  
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    32   2.4  
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    32   2.5  
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    32   2.5  
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    32   2.6  
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    32   2.6  
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    32   2.7  
NCAS0A15170 Chr1 (2984221..2985645) [1425 bp, 474 aa] {ON} Anc_7...    32   2.7  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    32   2.7  
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    32   2.8  
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    32   2.8  
Skud_13.307 Chr13 complement(530776..531819) [1044 bp, 347 aa] {...    32   2.8  
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    32   2.8  
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    32   2.9  
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    32   2.9  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    32   3.0  
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    32   3.2  
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    32   3.2  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   3.2  
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    32   3.4  
Kpol_2001.68 s2001 complement(187786..188673) [888 bp, 295 aa] {...    32   3.4  
Skud_4.283 Chr4 complement(493677..495191) [1515 bp, 504 aa] {ON...    32   3.4  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   3.5  
Kwal_47.17206 s47 complement(299680..300366) [687 bp, 228 aa] {O...    31   3.5  
TPHA0M00990 Chr13 complement(193577..194938) [1362 bp, 453 aa] {...    32   3.5  
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    32   3.6  
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    32   3.6  
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    32   3.7  
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    32   3.8  
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    32   3.8  
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    32   3.8  
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    32   3.9  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    32   4.0  
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    32   4.0  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    31   4.0  
SAKL0G14432g Chr7 complement(1245508..1247877) [2370 bp, 789 aa]...    32   4.2  
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    32   4.2  
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    31   4.2  
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    32   4.4  
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    31   4.5  
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    32   4.6  
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    31   4.7  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    31   4.8  
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    31   4.8  
Skud_15.434 Chr15 (765132..766616) [1485 bp, 494 aa] {ON} YOR269...    31   4.9  
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    32   4.9  
TDEL0A04970 Chr1 complement(877816..878817) [1002 bp, 333 aa] {O...    31   5.1  
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    31   5.2  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    31   5.2  
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    31   5.3  
TBLA0B09190 Chr2 (2171629..2172669) [1041 bp, 346 aa] {ON} Anc_2...    31   5.5  
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     31   5.6  
TBLA0A01540 Chr1 complement(355418..357592) [2175 bp, 724 aa] {O...    31   5.6  
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    31   5.6  
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    31   5.6  
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    31   5.7  
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    31   5.9  
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    31   6.3  
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    31   6.5  
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     31   6.7  
TDEL0B03120 Chr2 complement(553997..554650) [654 bp, 217 aa] {ON}      30   6.8  
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               31   6.9  
NCAS0B00430 Chr2 (57814..59280) [1467 bp, 488 aa] {ON} Anc_8.717...    31   6.9  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    31   7.1  
TPHA0J01890 Chr10 (430218..432287) [2070 bp, 689 aa] {ON} Anc_6....    31   7.1  
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    31   7.2  
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    30   7.4  
TDEL0F02260 Chr6 (414020..415309) [1290 bp, 429 aa] {ON} Anc_4.1...    31   7.5  
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    31   7.6  
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    31   7.6  
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    30   7.8  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    31   8.0  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    30   8.0  
SAKL0H21846g Chr8 (1905888..1908134) [2247 bp, 748 aa] {ON} simi...    31   8.1  
TPHA0G00720 Chr7 complement(136125..137672) [1548 bp, 515 aa] {O...    30   8.2  
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    30   8.2  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    31   8.2  
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    30   8.4  
KLTH0H03608g Chr8 (327747..327764,327941..330550) [2628 bp, 875 ...    31   8.4  
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    30   8.4  
Suva_4.348 Chr4 (616802..618448) [1647 bp, 548 aa] {ON} YBR103W ...    30   8.4  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    30   8.6  
KAFR0H00550 Chr8 (97619..98683) [1065 bp, 354 aa] {ON} Anc_5.631...    30   8.8  
TDEL0E04900 Chr5 complement(913381..915738) [2358 bp, 785 aa] {O...    30   9.0  
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    30   9.0  
Smik_4.518 Chr4 complement(935380..936372) [993 bp, 330 aa] {ON}...    30   9.1  
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    30   9.2  
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    30   9.3  
YDR267C Chr4 complement(1002510..1003502) [993 bp, 330 aa] {ON} ...    30   9.4  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    30   9.5  

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/401 (97%), Positives = 390/401 (97%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI
Sbjct: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS
Sbjct: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
           NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           LEFSTH           NRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401
           NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/400 (85%), Positives = 367/400 (91%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ+  GGFIKQELI
Sbjct: 1   MEGQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKE+L+NE+PQE+A    ++SLP PRSNIRITAKYEHEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEE 120

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           ITRARYMPQDPN+VATINGQGTVFLYSRS+GLQSTLKFHKDNGYALSFS L+KG LLSGS
Sbjct: 121 ITRARYMPQDPNMVATINGQGTVFLYSRSDGLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DDH+VALW+V  G D T P+RTW+DLHSDI+ND+KWHNFNKDLFGTVSEDSLLKIND+RA
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
            NTTIDT KCPQPFNTLAFSHHSSN+LAAAGMDS+VYLYDLRNMKEPLHHMSGHEDAV N
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           LEFS H           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRS+VNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           N Q+PWL+AS EEENILQVWKCSHSLPIVGG PK+NKDI+
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/401 (85%), Positives = 368/401 (91%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           ME QEK LSVDEEYDLWKSNVPLMYDFVSETRLTWPSL+VQWLPTP+QE +GGFI+QELI
Sbjct: 27  METQEKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELI 86

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEIN+PKEIL+N+DPQEEA E+ +++L AP+SNIRITAKY HEEE
Sbjct: 87  IGTHTSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEE 146

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           ITRARYMPQ+P+ VAT+NGQGTVFLYSRS GLQSTLKFHKDNGYALSF+ LV+G+LLSGS
Sbjct: 147 ITRARYMPQNPDFVATLNGQGTVFLYSRSGGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DDHTVALWEVGS      PVRTWNDLHSDI+ND KWHNFN+ LFGTVSEDSLLKINDVRA
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
           +N TID VKCPQPFNTLAFSHHSSNLLAAAGMDS+VYLYDLRNM+EPLHHMSGHEDAV N
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           +EFSTH           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401
           N QIPWLVAS+EEENILQVWKCSH+LPIVGGPPKVNKDIIS
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDIIS 427

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/401 (84%), Positives = 365/401 (91%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           ME QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQE +GGFIKQELI
Sbjct: 1   METQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELI 60

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           IGTHTSGEEENYLKFAEINLPKEIL+NEDPQEEAGE+ + S PAPRSNI+ITAKY+HEEE
Sbjct: 61  IGTHTSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEE 120

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           ITRARYMPQ+P  VATINGQGTVF+YSRSEGLQSTLKFH++NGYALSFS LV+G LLSGS
Sbjct: 121 ITRARYMPQNPGTVATINGQGTVFIYSRSEGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DDHTVALW+V    D T+P+RTW+DLHSDI+ND+KWHNFNKDLFGTVSEDSLLKIND+R 
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
            NTT  T KCP+PFNTLAFSHHSSNLLAAAG DS+VYLYDLRNMKEPLHHMSGHEDAV N
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           LEFS H           NRL+MWDLKQIGAEQTPDDAEDGVPELIMVHAGH+S+VNDFDL
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDIIS 401
           N QIPWLVAS EEENILQVWKCSHSLP+VGGPPKV+ D+IS
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMIS 401

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  489 bits (1260), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 239/412 (58%), Positives = 306/412 (74%), Gaps = 20/412 (4%)

Query: 3   NQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLP-----TPVQELDGGFIKQ 57
           ++ K L++DEEYDLWKSNVPLMYDFVSET+LTWP+LTV+WLP     TPV        +Q
Sbjct: 32  DENKELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSN------RQ 85

Query: 58  ELIIGTHTSGEEENYLKFAEINLPKEIL----SNEDPQEEAGEEYQSSLPAPRSNIRITA 113
           ELI+GTHTSGEE+NYLK A I+LP E++    ++   Q E  E+       PRSNI+I  
Sbjct: 86  ELILGTHTSGEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVK 145

Query: 114 KYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFS 169
           K++HEEEITRAR+MPQ+ +I+ATING GTVF+Y++S      L STL+FHK+NGY LSF+
Sbjct: 146 KFKHEEEITRARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFN 205

Query: 170 TLVKGRLLSGSDDHTVALWEVGSGGD-PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVS 228
              KG+LLSGSDD T+ALW++        KP++ W+ +H+DI+ND KW+ FN ++F +VS
Sbjct: 206 PNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVS 265

Query: 229 EDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPL 288
           EDS L+++D R  NT I+++K   PFNTLAFS HS  L+AAAG DS VYLYD RN+  PL
Sbjct: 266 EDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPL 325

Query: 289 HHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVH 348
           + M+GHED++ NLEFS H            R++MWD+  IGAEQ PDDAEDG PE+IM+H
Sbjct: 326 YSMNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIH 385

Query: 349 AGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           AGHRS+VNDF +NP IPWL+ASAEEENI+QVWKCSH LPIVGG P+V+  I+
Sbjct: 386 AGHRSAVNDFSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSIL 437

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  467 bits (1201), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 227/399 (56%), Positives = 289/399 (72%), Gaps = 12/399 (3%)

Query: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61
           E+  K LS+DEEY+LW+SNVPLMYDFVSETRLTWPSL+++WLP   ++      +QELII
Sbjct: 16  EDPNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQ--EKSAQAPNRQELII 73

Query: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121
           GTHTSGEE+NYLK A I+LP +I+    P  E  E+ Q      +SNI+I  K++HEEEI
Sbjct: 74  GTHTSGEEDNYLKIAAIDLPNDII----PSTEKLEDQQKGETTTKSNIKIIKKFKHEEEI 129

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLL 177
           TRARYMPQ+ N+VATING G VFLY RS+    GL ST ++HK+NGY LSF+    G+LL
Sbjct: 130 TRARYMPQNSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLL 189

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           SGSDD T+ALW V +    + P+  W+ +HSDI+ND KW NF+ ++FG+VSEDS L+++D
Sbjct: 190 SGSDDGTIALWNVNNSN--SSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHD 247

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
            R  +T     K   PFNTLAFS HS  L AAAG DS+VYL+D R++  PLH M+GH+ A
Sbjct: 248 QREKDTFTSQFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGA 307

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           V N+EFS              R ++WD+  IG EQ PDDAEDG PE++M+HAGHRS++ND
Sbjct: 308 VTNMEFSPDQDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAIND 367

Query: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396
           F +NP IPWL+AS+EEENI+QVWKCSH LP VGG P V+
Sbjct: 368 FSMNPNIPWLMASSEEENIIQVWKCSHKLPRVGGTPTVS 406

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  465 bits (1197), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 228/403 (56%), Positives = 285/403 (70%), Gaps = 19/403 (4%)

Query: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61
           E  +KPLS+DEEY+LW+SNVPLMYDFVSET LTWP+LT++WLP           +QELI+
Sbjct: 4   EQVDKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHS-----NRQELIL 58

Query: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121
           GTHTS EE NYLK A I+LP EI+  ++ +E  G          +SNI+I  K++HE+E+
Sbjct: 59  GTHTSEEEPNYLKIAAIDLPDEIVPGKEDRERDG--------FTKSNIKIIKKFKHEQEV 110

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLL 177
           TRARYMPQD N++ATING GTVFLY RS    EGL S+L FH+DNGY LSF+ + KG+LL
Sbjct: 111 TRARYMPQDSNLIATINGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLL 170

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           SGSDD  +ALW++ +  + TKPV TW   H D +ND KWH  N + FG+VSED  L+++D
Sbjct: 171 SGSDDSKIALWDITT--NSTKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHD 228

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
            R  ++  D +K    FNT+AFS HS+NL AAAG DS +YLYD R     LH MSGHE  
Sbjct: 229 QRVKDSVTDKIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESN 288

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           V NLEF               R++MWDL +IGAEQ PDDA+DG PE++M+HAGHRS VND
Sbjct: 289 VTNLEFYAAKDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVND 348

Query: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           F +NP IPWL+ASAEEENI+QVWKCS  LP VGG PKV+  ++
Sbjct: 349 FSMNPNIPWLMASAEEENIVQVWKCSSKLPRVGGLPKVDDSVL 391

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  464 bits (1193), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 291/400 (72%), Gaps = 19/400 (4%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP           +QE+I+GTH
Sbjct: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS-----NRQEMILGTH 62

Query: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124
           TS EE+NYLK A I LP E++ + +P+EE  EE        +SN++I  K+EHE E+TRA
Sbjct: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEE--EEVL------KSNVKIIKKFEHENEVTRA 114

Query: 125 RYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           RYMPQD N++ATI+G GT++LY+R+     GL ST +FH +NGY LSF+   KG+LLSGS
Sbjct: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DD  + LW+V   G   +P+ T+ D HSDI+ND KWHNF++++FG+VSEDS L+++D R 
Sbjct: 175 DDSNIVLWDVT--GKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
            +  ++ V+  +P+NTLAFS HS+NL AAAG DS VYLYD R   +PLH M GHEDAV +
Sbjct: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           LEF               R ++WDL +IGAEQ PDDA+DG PE++M+HAGHRSS+NDF +
Sbjct: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352

Query: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           NP IPWL A+AEEENI+QVWK S  LP +GG P V+  ++
Sbjct: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  461 bits (1185), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 288/401 (71%), Gaps = 16/401 (3%)

Query: 3   NQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIG 62
           ++ +PL   EEYDLWKSNVP+MYDFVSETRL WPSLTVQWLP           +QELI+G
Sbjct: 26  DENRPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLP---HSAPNPVTRQELILG 82

Query: 63  THTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEIT 122
           THTS EE+NYLK A ++LP E+    +  E   E+        RSNIR+T K++H+ E+T
Sbjct: 83  THTSDEEQNYLKIAVVDLPTEVTDTSNLTESDEEQV-------RSNIRVTRKFKHDSEVT 135

Query: 123 RARYMPQDPNIVATINGQGTVFLYSRS---EGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179
           RARYMPQDPNI+ATI+G GTV++Y RS   +    TL++H DNGY L+F+ L+KG LLSG
Sbjct: 136 RARYMPQDPNILATISGTGTVYIYDRSNERDTASITLQYHTDNGYGLAFNPLIKGHLLSG 195

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239
           SDD  VALW+V S  D  +PV+ W ++HSDI+ND +WHNF K LFGTVSEDS L+I+D R
Sbjct: 196 SDDSNVALWDVTS--DRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR 253

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
            +   + T+   +PFNTL+FSHHS NLLA  G++S VYLYD R ++EPLH MSGH DAV 
Sbjct: 254 ESKP-VATINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVT 312

Query: 300 NLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359
           +L+FS+             R+++WD+  IGAEQ  +DAED   E++M+HAGHRS +NDF 
Sbjct: 313 SLDFSSQDDGIILSAGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFA 372

Query: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           +NP IPWLVASAEEENI+Q+WKCSH LP + G P V  D++
Sbjct: 373 INPSIPWLVASAEEENIVQLWKCSHKLPRISGTPPVRVDML 413

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  454 bits (1168), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 298/401 (74%), Gaps = 20/401 (4%)

Query: 4   QEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGT 63
           QE+PL+VD+EY+LWK+NVPLMYDFVSETRLTWPSLT QWLP   ++      +Q +I+GT
Sbjct: 7   QEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEED-----TRQYMILGT 61

Query: 64  HTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITR 123
           HTSGEE +YLK A ++LP E+++ E     A ++ + +    +SNI+I  K+EH+ EI R
Sbjct: 62  HTSGEEVDYLKVAALDLPDEVVTGE-----ANDDNRRT----KSNIKIVKKFEHDGEINR 112

Query: 124 ARYMPQDPNIVATINGQGTVFLY----SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179
           ARYMP+D NI+ATING+G V +Y    SRS+GL++TLK+HK+NGY LSF+  V   L+SG
Sbjct: 113 ARYMPKDSNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISG 172

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239
           SDD T+ALW++ SG    K V  W+++HSDI+ND  WH+F+++LFG+VSEDS LK++D R
Sbjct: 173 SDDFTIALWDIDSGSKSPKSV--WDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKR 230

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
           + +  I+T++    FNTLAFS HS+NL AAAG+D+ +YLYD R   +PLH M+GHEDA+ 
Sbjct: 231 STSKVINTIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAIT 290

Query: 300 NLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359
            L+F               R+++WDL +IGAEQ PD+A+DG PE++M+HAGHRS++NDF 
Sbjct: 291 CLQFHPKEDGILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFT 350

Query: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           L+P IPWL AS EE+N++QVWKCS +L  VGG P+++  ++
Sbjct: 351 LHPTIPWLSASVEEDNVVQVWKCSKNLSRVGGTPEIDTKML 391

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  441 bits (1135), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/390 (54%), Positives = 285/390 (73%), Gaps = 18/390 (4%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           +E+ E PL+VD+EY+LWKSNV LMYDFVSET+LTWPSL++QWLP+   + +    +QE+I
Sbjct: 7   IEHDESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSV--DANVPLKQQEMI 64

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           +GTHTSG+E NYLK A I+LP E++   D       E  SS P  +S I++T K+EHE+E
Sbjct: 65  LGTHTSGDENNYLKIAAIDLPYEVVGLPD-------EDNSSEPV-KSMIKVTKKFEHEDE 116

Query: 121 ITRARYMPQDPNIVATINGQGTVFLY----SRSEGLQSTLKFHKDNGYALSFSTLVKGRL 176
           + RARYMP++  I+ATING+G +F+Y    S+SEGL  TL +HKDNGY L+F+  ++G L
Sbjct: 117 VIRARYMPKNDKIIATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGEL 176

Query: 177 LSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN 236
           LS SDD TVALW++ S   P   V      H+DI+ND+KWH F++++FGTVSED  L+++
Sbjct: 177 LSASDDTTVALWDINSTDRPVSIVMN----HTDIVNDSKWHEFDENIFGTVSEDKTLQVH 232

Query: 237 DVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHED 296
           D R+ + +   +   +P N LAFS HS NL+AAAG D+ VYLYDLR + EPLH M+GH+D
Sbjct: 233 DKRSLSNSAQVLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQD 292

Query: 297 AVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 356
           AV ++EFS+H            RL +WDL QIGAEQ  +DA+DGVPEL+M+HAGHRS++N
Sbjct: 293 AVTSIEFSSHKDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAIN 352

Query: 357 DFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           DF  NPQ+PWL+ASAEE+N++QVWK S  L
Sbjct: 353 DFSFNPQVPWLIASAEEDNVVQVWKISKKL 382

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  433 bits (1114), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 273/395 (69%), Gaps = 15/395 (3%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           +E + K LS++EEY+LWK+NVPLMYDFVSET+LTWPSLT+QWLP      +    KQE+I
Sbjct: 3   IEEENKLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPG-----NSSSTKQEMI 57

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           +GTHTSGE++NYLK A I LP++IL  E  +     E        +S I+IT K +HEEE
Sbjct: 58  LGTHTSGEDDNYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEE 117

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRL 176
           ITRAR+MPQDPN +ATING G VFL+ RS    E L S   FHKDNGY LSF+   KG L
Sbjct: 118 ITRARFMPQDPNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGEL 177

Query: 177 LSGSDDHTVALWEV-GSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           LS SDD T+ALW V G+   P+K V T    H DI+ND  WH FN++LFG+VSED  L+I
Sbjct: 178 LSCSDDGTIALWNVMGTNTSPSKAVTT----HEDIVNDCTWHEFNENLFGSVSEDKTLQI 233

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
           +D R N +T+  +    PFNTL FS HS NL AAAG DS VYLYDLRN  + LH MSGHE
Sbjct: 234 HDKRTN-STVHRLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHE 292

Query: 296 DAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 355
           D+V +LEFS H            R+++WDL QIG+EQ  +DA DGVPEL+M+HAGH+S+V
Sbjct: 293 DSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAV 352

Query: 356 NDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVG 390
           NDF  N  IPWL+AS EE+NI+ VWK S  L   G
Sbjct: 353 NDFSFNWNIPWLMASVEEDNIVHVWKVSKKLTSPG 387

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  426 bits (1094), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 207/399 (51%), Positives = 284/399 (71%), Gaps = 10/399 (2%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHT 65
           +P++VDEEY+LWKSNVP++YDFVSETRLTWP+LTV+WLP   + L     +Q+LI+GTHT
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQ--KNLVAARTRQQLILGTHT 83

Query: 66  SGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRAR 125
           SGEE+NYLK   ++LP E+  N    ++  E  +       SN++I  K+ H+ EITRAR
Sbjct: 84  SGEEQNYLKIGAVDLPVEVTEN---SKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRAR 140

Query: 126 YMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLLSGSD 181
           YMPQD NI+ATING+G +F+Y RS    E L STL++H +NGY L+F+   K  LLSGSD
Sbjct: 141 YMPQDDNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSD 200

Query: 182 DHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRAN 241
           D  +ALW++ +     KP  T+ D H+DIIND KWH+    +FG+VSEDS +K+ D R++
Sbjct: 201 DSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKRSS 260

Query: 242 NTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNL 301
              I  +   +P+NTLAFS  SSNL AAAG D+ VYLYD+R++  PL+ M+GHEDAV  +
Sbjct: 261 QI-IHNINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAI 319

Query: 302 EFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLN 361
           EF  +            R ++WDL++IGAEQT D+ EDG PE++M+HAGH++S+ND  +N
Sbjct: 320 EFDPNNDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVN 379

Query: 362 PQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           P I WLVASAEE+NI+Q+WKCS ++P +GG P+V+  I+
Sbjct: 380 PNINWLVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSIL 418

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  419 bits (1078), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 212/401 (52%), Positives = 281/401 (70%), Gaps = 13/401 (3%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQ--ELDGG-FIKQ 57
           +E  E+P +++EEYDLW SNVP+MYDFVSETRLTWPSLTVQWLPT +Q  E+DG   ++Q
Sbjct: 4   VEEPEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQ 63

Query: 58  ELIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEH 117
           EL+IGT T+  E NYLK A I+LP+ + S++    +  +E  + L   +S I+I  K++H
Sbjct: 64  ELLIGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKE--NELSHRQSKIKIVRKFKH 121

Query: 118 EEEITRARYMPQDPNIVATINGQGTVFLYSRS-----EGLQSTLKFHKDNGYALSFSTLV 172
           E+E+TRARYMPQ PNI+AT+NG G V+++ R+      G  ++  +HK+NGY L+F+  V
Sbjct: 122 EQEVTRARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTV 181

Query: 173 KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSL 232
            G+LLS SDD TVALW+V S  + + P +T+ D+H+DI+ND KWH F   LFGTVSED+ 
Sbjct: 182 SGQLLSASDDGTVALWDVTSTANKS-PSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNT 239

Query: 233 LKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMS 292
           L I+D  ++   I  +     FNTLAFS  S NLLAAAG DS VYLYDLR +++PLH M+
Sbjct: 240 LIIHDTNSDRA-IQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMA 298

Query: 293 GHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHR 352
           GHED+V +LEFS H            R++MWDL  IGAEQ PDDA DGVPEL M+H GHR
Sbjct: 299 GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHR 358

Query: 353 SSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPP 393
           S VN+F  N  +PWL+ S EEEN+LQ+WK ++ +     PP
Sbjct: 359 SPVNEFSHNSNVPWLMCSVEEENVLQIWKPANKIVRPPQPP 399

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  412 bits (1060), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 206/397 (51%), Positives = 269/397 (67%), Gaps = 25/397 (6%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHT 65
           + L+V+EEY+LW SNVP+MY+FVSET+LTWPSLT+QWLP+     DG   +Q LI GTHT
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPS-----DGQSPEQSLIFGTHT 94

Query: 66  SGEEENYLKFAEINLPKEI--LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITR 123
           +GEE NYLK A INLP  I  L   D ++EA +          S+  I  K+ H EE+ R
Sbjct: 95  AGEEVNYLKVATINLPAGIAGLDQGDEEDEAND---------HSSFAIANKFPHIEEVIR 145

Query: 124 ARYMPQDPNIVATINGQGTVFLYSR----SEGLQSTLKFHKDNGYALSFSTLVKGRLLSG 179
           ARYMP + NI+ATING+GT+ ++ R    S+   STL FHK+NGY L+F+  + G LLSG
Sbjct: 146 ARYMPANSNIIATINGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSG 205

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR 239
           SDD TVALW++ +   P   + +    H DI+ND KWH F  ++FGTVSED  L+++D R
Sbjct: 206 SDDTTVALWDIEAAKKPKSILTS----HDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKR 261

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
                +  +    PFNTL+FS HS NLLAAAG+DS +YLYD+R+M  PLH MSGH+D+V 
Sbjct: 262 VRLEPVKKLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVT 321

Query: 300 NLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFD 359
            +EFS H            R ++WDL QIGAEQ+ DDA+DG PEL+M+HAGHRS VN+F 
Sbjct: 322 TVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFS 381

Query: 360 LNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396
            NPQIPWL+AS EE+N++Q WK S  L +   PP ++
Sbjct: 382 FNPQIPWLLASTEEDNVIQAWKVSMKL-VNASPPAIS 417

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  410 bits (1053), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 200/400 (50%), Positives = 271/400 (67%), Gaps = 21/400 (5%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           +E QE+PL+VD+EYDLWKSNVPL+YDFVSETRLTWPSLT+QWLP      D    +Q LI
Sbjct: 4   VEQQEEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPG-----DKTSTRQHLI 58

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           +GT TSG E +YLK A ++LP EI+             + S    +SN+++  K+ H+ E
Sbjct: 59  LGTLTSGAETDYLKIAALDLPDEIIIG-----------KKSDKVVKSNLKVVKKFAHDGE 107

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRL 176
           I RARYMPQ+ NI+AT+NG+GT+F+Y  S      L STLK+HKDN Y L+F+   +G L
Sbjct: 108 INRARYMPQNTNIIATVNGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGEL 167

Query: 177 LSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN 236
           +SGSDD T+ALW+  +     +P++ W   HSDI+ND +WH FN ++FG+VSEDS L++ 
Sbjct: 168 ISGSDDSTIALWD-ATNDKLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLF 226

Query: 237 DVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHED 296
           D R    +   +     +N++AFS  S NL AAAG  + +YLYD+RN  + LH M+GHE+
Sbjct: 227 DKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEE 286

Query: 297 AVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVN 356
            V +LEFS              R++MWDL +IGAEQ PD+A+DG+PE++M+HAG RS++N
Sbjct: 287 PVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAIN 346

Query: 357 DFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVN 396
           D   +P IPWL AS EE NI+QVWKCS  LP + G P+V+
Sbjct: 347 DISTHPSIPWLNASVEENNIVQVWKCSSKLPRISGTPEVS 386

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  409 bits (1050), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 212/404 (52%), Positives = 277/404 (68%), Gaps = 22/404 (5%)

Query: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61
           + +E+ LS+DEEY LWKSNVPLMYDFVSET+LTWPSLTV+WLP   Q       +QE+II
Sbjct: 4   QEEERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQ---APLTQQEMII 60

Query: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAP-RSNIRITAKYEHEEE 120
           GTHTS +E NY+K A I LP E++   DP   +         AP +SN+RIT K++ E+E
Sbjct: 61  GTHTSDQEPNYVKIASIELPNEVI---DPHNVSD--------APVKSNVRITKKFKLEKE 109

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSR--SEGLQSTLKFHKDNGYALSFSTLVKGRLLS 178
           ITR+RYM QDPNI++TI+G GTV ++ R  S+    T  +HKDNGY LSF+ + KG+LLS
Sbjct: 110 ITRSRYMVQDPNIISTIDGNGTVSIFDRNSSDSPVKTYSYHKDNGYGLSFNPISKGQLLS 169

Query: 179 GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSED-SLLKIND 237
            +DD  +A++++ +  +   PV TW    + IIND KWH+F+  LFGTVSE+ + L I D
Sbjct: 170 AADDGYIAMYDINAESE--DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYD 227

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +R  +  + +++  QPFN+LAFS HS NL +AAG D  VYLYDLRN ++ LH MSGHE  
Sbjct: 228 LRTKDK-VTSIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGP 286

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           V NLEF               R+++WDL +IG+EQ  +DA+D  PEL+M+HAGHRSSVND
Sbjct: 287 VTNLEFHDSVDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVND 346

Query: 358 FDLNPQIPWLVASAEEENILQVWKCSHSLP-IVGGPPKVNKDII 400
           F LN  IPWL+AS EEENI+QVWK S  LP I    P +N D+I
Sbjct: 347 FSLNSSIPWLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLI 390

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  408 bits (1048), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 203/386 (52%), Positives = 273/386 (70%), Gaps = 13/386 (3%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64
           E  +SVDEEYDLWKSNVPLMYDFVSET+L WPSLT+QWLP+     +    +QELI+GTH
Sbjct: 7   ENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPS-----NDRSNEQELILGTH 61

Query: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124
           TSG E+NYLK A ++LP E++S+      + ++ + S   P+S I+I  K+EH +E+TRA
Sbjct: 62  TSGTEQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRA 121

Query: 125 RYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           RY P +PN++ATI+G G VFLY RS+     L +   FHK+NGY L+FS +  G LLS S
Sbjct: 122 RYAPFNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCS 181

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           DD ++A+W+V SG +   PV+  +  H++I+N+ KWH  +  LFG+VS+DS L I+D R 
Sbjct: 182 DDGSIAIWDVCSGKN--TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI 238

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
           +   +  ++  +P+NTLAFS HSSNL AAAG DS V LYDLR  + P+H MSGH D+V +
Sbjct: 239 DKPVVKILQS-EPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTS 297

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           LEF+ H            R+++WDL QIGAEQ  +DA+DGVPEL+M+HAGH+S VNDF  
Sbjct: 298 LEFAPHKDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSC 357

Query: 361 NPQIPWLVASAEEENILQVWKCSHSL 386
           +P IPWL+AS EEEN++Q+WK S  L
Sbjct: 358 SPNIPWLMASVEEENVVQIWKASKKL 383

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  394 bits (1012), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 271/389 (69%), Gaps = 21/389 (5%)

Query: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64
           E+ LS+D+EYDLWKSNVPLMYDFVSETRL WPSLT+QWLP           +QEL++GTH
Sbjct: 7   ERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDS-----TEQELLVGTH 61

Query: 65  TSGEEENYLKFAEINLPKEILSNEDP---QEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121
           TS  E+NYLK AEINLP+EILSNE P    +  G + Q  +P   S I+I  K++HE E+
Sbjct: 62  TSDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQ--VP---SKIKIIKKFKHENEV 116

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSE----GLQSTLKFHKDNGYALSFSTLVKGRLL 177
           TRARY P D N++ATI+G GTVFLY R++     L+    +HK+NGY L+FS    G L+
Sbjct: 117 TRARYAPFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELI 176

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           S SDD ++A+W++ SG   T P    N LHSDI+N+ KWH  + +++G+VSEDS L I+D
Sbjct: 177 SCSDDGSIAIWDIKSG--KTVPTSV-NSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHD 233

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
            R+    +  +   +PFNT+AFS HSSNL AAAG D+ VYL+D R   E LH MSGH++A
Sbjct: 234 KRSEKP-LQKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEA 292

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           V +LEF+ H            R+++WDL QIG EQ  +DA+DG PEL+M+HAGH+S++ND
Sbjct: 293 VTSLEFAHHKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAIND 352

Query: 358 FDLNPQIPWLVASAEEENILQVWKCSHSL 386
           F  +P +PWL+AS EEENI+Q+WK S  L
Sbjct: 353 FSFSPNVPWLMASVEEENIVQIWKPSRKL 381

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 204/412 (49%), Positives = 278/412 (67%), Gaps = 30/412 (7%)

Query: 1   MENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI 60
           ++ +E+PL+ D+EY+LWKSNVPL+YDFVSET+L WPSLTV+WLP+  +  +    +Q L+
Sbjct: 13  IKEEEEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSN-ETTNLPSNEQRLL 71

Query: 61  IGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
           +GTHTSGEE+NYLK AEI LP +I+ NE  ++ + +         +SNIRI  K++HE E
Sbjct: 72  LGTHTSGEEQNYLKIAEITLPDQII-NEKTEDNSDKHV-------KSNIRIIKKFKHELE 123

Query: 121 ITRARYMPQDPNIVATINGQGTVFLY------SRSEGLQSTLKFHKDNGYALSFSTLVKG 174
           +TRA YMPQD  I+ATING GTVF+Y      ++S  + S L  HK+NGY L+F+ L KG
Sbjct: 124 VTRAHYMPQDSTIIATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKG 183

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           +LLS SDD +VA W +      + P+ T  +  + IIND +W+ FN++LFG V+E S L 
Sbjct: 184 KLLSSSDDGSVAYWNI----QKSIPLLTLQE--TSIINDVRWNQFNQNLFGYVTESSCLN 237

Query: 235 INDVRANNTTIDTV-----KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLH 289
           + DVR NN  +  V     K P  FN +AFS HS  L+AA+G DS +YLYD RN+ +PLH
Sbjct: 238 LKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLH 297

Query: 290 HMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDG-VPELIMVH 348
           +M GHED+V +L+F               R+ +WDLKQIG EQT D+ EDG VPEL+M+H
Sbjct: 298 YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIH 357

Query: 349 AGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400
           AGHRS +NDF ++  + WL AS EE+NI+QVWK ++SL      P VN ++I
Sbjct: 358 AGHRSPINDFSMSNNLNWLCASIEEDNIVQVWKMNNSLR---EDPLVNMNVI 406

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  118 bits (295), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 102/411 (24%), Positives = 182/411 (44%), Gaps = 55/411 (13%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L YD+++     WPSLT Q  P    +LD    +  +++ + TS +  E
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFP----DLDLATDEHRILLSSFTSSQVPE 78

Query: 70  ENYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEE-EITRA 124
           +  L  A ++  K I    L+N D  EE   +  +SL  P  ++    + +    +  +A
Sbjct: 79  DESLYVARLSSMKHIPWSSLNNFD-MEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKA 137

Query: 125 RYMPQDPNIVATINGQGTVFLYSRSE--------------------GLQSTLKFHKDNGY 164
           RY P +P+++ + +  G+++++ R++                     L ++L+ HK+   
Sbjct: 138 RYCPSNPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAV 197

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDII-----NDNKWHNF 219
           +L+++   +G L +      V +W++    D   P    N L    +     N+  W   
Sbjct: 198 SLAWNWQRQGLLATSYSHGQVCVWDL-EKYDKNSPTLI-NPLAMSTVDPRGSNEVSWMVR 255

Query: 220 NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ---PFNTLAFSHHSSNLLAAAGMDSYV 276
           +  L    SED+L+ I D+R       +   P      NT  F++H   LL +A     +
Sbjct: 256 HDSLLAYCSEDNLVGIMDIRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRI 315

Query: 277 YLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQTPD 335
            L+D+RN  +PL  +  H D+++ L+++               L+ +WDL Q   +    
Sbjct: 316 NLWDIRNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ---- 370

Query: 336 DAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                  ELI  H GH   VND   +P   W++ S   +N +QVW+ S+SL
Sbjct: 371 -------ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  114 bits (286), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 98/406 (24%), Positives = 180/406 (44%), Gaps = 51/406 (12%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE--E 69
           + Y LWK N  L+YD+++     WPSL+ Q+ P    +LD       L+  + TS +  +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFP----DLDTSSDTHRLLFTSFTSSQLPQ 65

Query: 70  ENYLKFAEIN----LPKEILSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124
           +  +  A I+    +P   L+N D  E E   +  + LP     I++T  + H  +  RA
Sbjct: 66  DENVTIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQIQLTINFPH-GDCNRA 124

Query: 125 RYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHK----------DNG------YALSF 168
            Y+PQ+P++++T +  G+V+++ R++  +S +   +          +NG       AL +
Sbjct: 125 TYLPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDW 184

Query: 169 STLVKGRLLSGSDDHTVALWEVGS--GGDP--TKPVRTWNDLHSDIINDNKWHNFNKDLF 224
           +  ++G L S   +  + +W++      +P  ++P   + D  S   ND  W   +  L 
Sbjct: 185 NRQIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLL 244

Query: 225 GTVSEDSLLKINDVRANNTTIDT---VKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDL 281
               ED+++ + D R N     T          N   F+     L+A A  D  V L+D+
Sbjct: 245 SIAREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDI 304

Query: 282 RNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQTPDDAEDG 340
           R +  P+  ++  E  ++ LE++             + L+ +W            +A +G
Sbjct: 305 RKLHNPIKTINC-ESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG 351

Query: 341 VPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
             +L+  H GH   VND   +P   WL+ S   +N   +WK +  L
Sbjct: 352 --QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 178/418 (42%), Gaps = 60/418 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q+ P    + D       +++ + TS
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDS----HRILLSSFTS 73

Query: 67  G--EEENYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPRSNI--RITAKYEHE 118
               E+  L    I+  K +    L+N D  E   +   S++  P  N+   +  ++ + 
Sbjct: 74  SLVPEDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPNG 133

Query: 119 EEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLV------ 172
           +   RARY+PQ+P+++A  +  G+V+++ R++    T    + +G+  S+   +      
Sbjct: 134 D-CNRARYLPQNPDLIAAASSDGSVYIFDRTK--HGTAMHSRQSGFTQSYQAKLAVNNNS 190

Query: 173 ------------------KGRLLSGSDDHTVALWEVGS--GGDPTKPVRTWN-DLHSDII 211
                             +G L+    D  V  W++      DP      +N  L     
Sbjct: 191 QSLNGENEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGC 250

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP--FNTLAFSHHSSNLLAA 269
           ND  W   +  LF   SED+ L + D R  +  ID          N   F+  +S LLA+
Sbjct: 251 NDAVWMPEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLAS 310

Query: 270 AGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQI 328
                 + L+D+R  + P++ +  H  +++ +E++ +           + L+ +WD    
Sbjct: 311 GDSIGNICLWDIRKKETPINILD-HGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA--- 366

Query: 329 GAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                      G  + + +H GH   VND   N   PWL+ S  ++N +Q+WK +H+L
Sbjct: 367 -----------GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 103/408 (25%), Positives = 188/408 (46%), Gaps = 55/408 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+Y++++     WPSLT Q++P    ++D    K  +++ + TS
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMP----DMDIASDKHRILLSSFTS 73

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE 119
            +  E+  +  +EI+  K I    L+N   +E E   + Q  L     N+  T K +  E
Sbjct: 74  AQLPEDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKL---SKNLTETIKIQFPE 130

Query: 120 -EITRARYMPQDPNIVATINGQGTVFLYSRSEG-------LQSTLKFHKD---------- 161
            +  RARYMPQ+P+++A+ +  G+V+++ R++        L +T K+  +          
Sbjct: 131 GDCNRARYMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNY 190

Query: 162 NGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI----INDNKWH 217
              +L+++    G L +   D  V +W++ +  +  +P  T  DL   +     N+  W 
Sbjct: 191 EASSLAWNYQRSGILAASYSDGDVKIWDI-TKYNKAQPQLTVPDLRWQVDKEGANEVSWM 249

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTIDTVK--C-PQPFNTLAFSHHSSNLLAAAGMDS 274
             +  +     E + L I D R   TT  T +  C     N + F++ +  LL +A  + 
Sbjct: 250 VHHSSILAVCGEGNGLTILDTRTP-TTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEG 308

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQT 333
            + + D+R ++ P+   S H DAV+ ++++             + L+ +WDL Q   E  
Sbjct: 309 TLNICDIRQLEHPVKTWS-HLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ---EDD 364

Query: 334 PDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           P         L+ +H GH   VND   N   PW++ S   +N + +WK
Sbjct: 365 P---------LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWK 403

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  110 bits (275), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/413 (23%), Positives = 182/413 (44%), Gaps = 51/413 (12%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P  V   Y  WK N  L+YD+++     WPSLT Q+ P    +LD    +  L++ + TS
Sbjct: 27  PEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTNDQHRLLLSSFTS 82

Query: 67  GE--EENYLKFAEIN----LPKEILSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE 119
            +  E+  +  + ++    LP   L+N D  E E   +  S LP+      +   +   +
Sbjct: 83  SQLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGD 142

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNG---------------- 163
               ARY+PQ+P+++A  +  G+++++ R++   +  K H D G                
Sbjct: 143 -CNGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLH-DGGSMFELEFQSSSLEEHQ 200

Query: 164 --YALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHS---DIINDNKWHN 218
              +L+++   +G L +      V +W+V         +   +  H+      ND  W  
Sbjct: 201 EVVSLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMV 260

Query: 219 FNKDLFGTVSEDSLLKINDVRAN----NTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
            +  +     E + + + D RA     ++T DT    +  N+  F++H+  LL +     
Sbjct: 261 NHASILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTG 320

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQT 333
            V L+D+R+++ PL  +  H  +++  +++ +           + L+ +WD+ Q   E  
Sbjct: 321 RVNLWDIRDLETPLKSLD-HGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE-- 377

Query: 334 PDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                    EL+ VH GH   VND   N   PWL+ S   +N +Q+W+ + +L
Sbjct: 378 ---------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  108 bits (271), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/406 (22%), Positives = 189/406 (46%), Gaps = 41/406 (10%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE- 68
           V + Y  WK N  L+YD+++     WPSL+ Q+ P      D    KQ +++ + TS + 
Sbjct: 20  VQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTND----KQRILLSSFTSQQL 75

Query: 69  ---EENYL-KFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEH-EEEITR 123
              E  Y+   + +N  K    N    +E   +  +SL      +    +  + + +  R
Sbjct: 76  PQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVRITYPDGDCNR 135

Query: 124 ARYMPQDPNIVATINGQGTVFLYSRSE---GLQSTLKFH----------KDNGYALSFST 170
            RYMPQ+P+I+ T +  G+V+++ R++    + +  KF           +D   +L+++ 
Sbjct: 136 CRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGDDEQDESLSLAWNY 195

Query: 171 LVKGRLLSGSDDHTVALWEVGSGGDPTK-----PVRTWNDLHSDIINDNKWHNFNKDLFG 225
            ++G L +   +  V +W++ +  D +K     P R  + + ++ +ND  W   +  +  
Sbjct: 196 QLEGTLATCQSNGKVKVWDL-TKFDKSKQRMEIPERE-SVMDANGVNDVSWMVNHTSILA 253

Query: 226 TVSEDSLLKINDVRANNTTIDTV---KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  E +++ + D+R + T +DT+         N + F++ +  +L        + ++D+R
Sbjct: 254 SCGESNVIGLIDIRQD-TKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQGQLKIWDIR 312

Query: 283 NMKEPLHHMS-GHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQTPDDAEDG 340
           + KEP+     G +D ++ ++++             + L+ +WD      EQ   +AE+ 
Sbjct: 313 DFKEPIKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWD---ASGEQEDSNAENN 369

Query: 341 VPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           +  L+ VH GH   VND   +   PW + S   +N + +WK + +L
Sbjct: 370 M--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 102/423 (24%), Positives = 184/423 (43%), Gaps = 69/423 (16%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P    + Y  WK N  L+Y++++     WPSLT Q  P    +LD    +  +++ + TS
Sbjct: 18  PEDRQQRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFP----DLDLAGDEHRILLSSFTS 73

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEE- 119
            +  E+  +  A ++  K I    L+N D  +E   +  +SL  P  NI    + +    
Sbjct: 74  SQLPEDEAIYVARLSSMKHIPWSSLNNFD-TDEMEFKMDNSLKLPPKNIVEDLRIKFPAG 132

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSE--------------------GLQSTLKFH 159
           +  +ARY P +P+++++ +  G+V+++ R++                     L ++L+  
Sbjct: 133 DCNKARYCPSNPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEER 192

Query: 160 KDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDII------ND 213
           ++    L+++   +G L +      V +W++    D   P  T  D HS ++      ND
Sbjct: 193 QNEALNLAWNWQQQGLLATCYSGGEVCVWDLAKY-DKASP--TLIDPHSSLLADPQGSND 249

Query: 214 NKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPF---------NTLAFSHHSS 264
             W   +  L     E + L + D R       T + PQ F         N   F+++  
Sbjct: 250 ISWMVNHDSLLAYCGEGNALGVLDTRI------TKQPPQSFSNPHHSNGVNACQFNYYKD 303

Query: 265 NLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MW 323
            LL +A     + L+D+R+   P+  +  H  +V+ L+++ H           + L+ +W
Sbjct: 304 LLLCSADSAGRINLWDIRDFSSPIRSLD-HHGSVSALQWNPHHPTILATAGQDDGLVKIW 362

Query: 324 DLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCS 383
           DL Q      P D E     L   H GH   VND   +P  PW++ S   +N +Q+WK S
Sbjct: 363 DLSQ------PVDQE-----LKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPS 411

Query: 384 HSL 386
            +L
Sbjct: 412 QNL 414

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  108 bits (270), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 97/418 (23%), Positives = 182/418 (43%), Gaps = 63/418 (15%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P+ + E Y  WK N  L+YD+++     WPSLT Q+ P    +LD    +  +++ + TS
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTSDEHRILLSSFTS 71

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
            +  E+  +  ++I+    I    L+N D  E   +   S+    +  +   + +    E
Sbjct: 72  SQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGE 131

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHK-------------------- 160
             RARY+PQ+P+I+A  +  G ++++ R++   + ++  K                    
Sbjct: 132 CNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVE 191

Query: 161 ---------DNGYALSFSTLVKGRLLSGSDDHTVALWEVG--SGGDPT--KPVRTWNDLH 207
                    +   +L+++   +  LLS   +  V +W++   S  +P    P+ + N   
Sbjct: 192 AMDTSSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINS-D 250

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDT--VKCPQPFNTLAFSHHSSN 265
              +ND  W   +  LF   +E + + + D+R     + +   K     N+  F++ +S 
Sbjct: 251 GTAVNDVTWMPTHDSLFAACTEGNAVSLLDLRTKKEKLQSNREKHDGGVNSCRFNYKNSL 310

Query: 266 LLAAAGMDSYVYLYDLRNM-KEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MW 323
           +LA+A  +  + L+D+RNM K P+  M  H  +V+ LE+S +           + L+ +W
Sbjct: 311 ILASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLW 369

Query: 324 DLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           D                  E I  H GH   VND   +   PWL+ S   +N + +WK
Sbjct: 370 DT--------------SCEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 99/424 (23%), Positives = 187/424 (44%), Gaps = 59/424 (13%)

Query: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61
           E    P  + + Y  WK N  L+YD+++     WPSLT Q+ P    +LD       ++I
Sbjct: 9   EQSTIPNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFP----DLDTTSDTHRILI 64

Query: 62  GTHTSGE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRITAK 114
            + TS +  E+  +  ++I+  K +    ++N D  E E   +    LP+      +T K
Sbjct: 65  SSFTSSQLPEDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTIK 124

Query: 115 YEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKD------------- 161
           + + +   RARY+PQ+P+++A  +  G+V+++ R++   S ++  K+             
Sbjct: 125 FPNGD-CNRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSE 183

Query: 162 ----------NGYALSFSTLVKGRLLSGSDDHTVALWEVGS--GGDPT--KPVRTWNDLH 207
                        +L+++   +G L S      V +W++      +P   KPV    ++ 
Sbjct: 184 TVEELHENTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVL---NIQ 240

Query: 208 SDI--INDNKWHNFNKDLFGTVSEDSLLKINDVRANN--TTIDTVKCPQPFNTLAFSHHS 263
            D   +ND  W   +  LF    E   L + D R     + I   +     N+  F++ +
Sbjct: 241 FDALGVNDVSWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQN 300

Query: 264 SNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-M 322
           + LLA+A  +  V ++D+RN+ +       H  +++ +E++ +           + L+ +
Sbjct: 301 NMLLASADSEGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKL 360

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKC 382
           WD+     E            L+ VH GH   VND   +    WL+ S   +N +Q+WK 
Sbjct: 361 WDVSNTDNE------------LLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKP 408

Query: 383 SHSL 386
           +H+L
Sbjct: 409 AHNL 412

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  107 bits (268), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 102/429 (23%), Positives = 187/429 (43%), Gaps = 80/429 (18%)

Query: 4   QEKPLS-----VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQE 58
           +E+P+S     V   Y  WK N  L+YD+++     WPSLT Q+ P    +LD    +  
Sbjct: 10  EEQPVSTIPEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTSSDQHR 65

Query: 59  LIIGTHTSGE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRI 111
           L++ + TS +  E+  +  ++I+  K +    L+N D  E E   +    LP       +
Sbjct: 66  LLLSSFTSSQLPEDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEV 125

Query: 112 TAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTL 171
           + ++ + +   R+RY+PQ+P+++A  +  G+V+++++++   S L+    + +       
Sbjct: 126 SIRFPNGD-CNRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDF------- 177

Query: 172 VKGRLLSGSDDHT-----------------------------VALWEVGSGGDP----TK 198
            + RL SGS D                                 +W+V          ++
Sbjct: 178 -QARLFSGSHDAQNLDNFNEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQ 236

Query: 199 PVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPF 254
           P  T     S+  ND  W   +  +F    E + L + D+R N      +I   K     
Sbjct: 237 PELTVT-FDSNGCNDLDWMPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGI 295

Query: 255 NTLAFSHHSSNLLAAAGMDSYVYLYDLRNM-KEPLHHMSGHEDAVNNLEFSTHXXXXXXX 313
           NT  F+  +S L+A+A     + L+D+R + +EP+  M  H  +++ +E++ +       
Sbjct: 296 NTCKFNPGNSLLVASADTCGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFAS 354

Query: 314 XXXXNRLM-MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAE 372
               + L+ +WD   +G E             I VH GH   VND   +   PWL+AS  
Sbjct: 355 AGQEDGLVKLWD-ASVGKE-------------IFVHGGHMLGVNDISWDMHDPWLMASVS 400

Query: 373 EENILQVWK 381
            +N +Q+W+
Sbjct: 401 NDNTIQIWR 409

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  107 bits (268), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 97/419 (23%), Positives = 185/419 (44%), Gaps = 65/419 (15%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P ++ E Y  WK N  L+Y++++     WPSLT Q+ P    +LD    +  +++ + TS
Sbjct: 16  PPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILLSSFTS 71

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE 120
            +  E+  +  ++I+    I    L+N D  E   +   S+   P+  +   + +    E
Sbjct: 72  SQKPEDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGE 131

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHK-------------------- 160
             RARY+PQ+P+I+A  +  G ++++ R++   + ++  K                    
Sbjct: 132 CNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVE 191

Query: 161 ---------DNGYALSFSTLVKGRLLSGSDDHTVALWEVG--SGGDPT--KPVRTWNDLH 207
                    +   +++++   +  LLS   +  V +W++   S  +P    P+ + N   
Sbjct: 192 TMDASSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDG 251

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ---PFNTLAFSHHSS 264
           S  +ND  W   +  LF   +E + + + D+R     + +  C       N+  F++ +S
Sbjct: 252 SG-VNDVTWMPTHDSLFAACTEGNTVSLLDLRTKKEKLKS-NCRSHNGGVNSCKFNYRNS 309

Query: 265 NLLAAAGMDSYVYLYDLRNMKE-PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-M 322
            +LA+A  +  + L+D+RNM + PL  M  H  +V+ LE+S +           + L+ +
Sbjct: 310 LILASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKL 368

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           WD  +               E I  H GH   VND   +   PWL+ S   +N + +WK
Sbjct: 369 WDTSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWK 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  107 bits (267), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 98/426 (23%), Positives = 191/426 (44%), Gaps = 69/426 (16%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P+ + E Y  WK N  L+YD+++     WPSLT Q+ P    +LD    +  +++ + TS
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLDEHRILLSSFTS 71

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE 119
            +  E+  +  ++I+    I    L+N D  E E   E  + LP P   +   + +    
Sbjct: 72  SQKPEDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENTTRLP-PSHLVNDISIFFPNG 130

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDN----------------- 162
           +  RARY+PQ+P+I+A  +  G ++++ R++   + ++  K++                 
Sbjct: 131 DCNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDV 190

Query: 163 ------------GYALSFSTLVKGRLLSGSDDHTVALWEVG--SGGDPT--KPVRTWNDL 206
                         +L+++   +  LLS   +  V +W++   S  +P    P+ +   +
Sbjct: 191 EAMDTSSADVNEATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVS---I 247

Query: 207 HSDI--INDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP--FNTLAFSHH 262
            SD   +ND  W   +  LF   +E +++ + D+R     + + +       N+  F++ 
Sbjct: 248 ESDASGVNDVTWMPTHDSLFAACTEGNVVSLLDLRTKKEKLRSNRQNHTGGVNSCKFNYR 307

Query: 263 SSNLLAAAGMDSYVYLYDLRNMKE-PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM 321
           +S +LA+A  +  + L+D+R M E P+  M  H  +++ LE++ +           + L+
Sbjct: 308 NSLVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLV 366

Query: 322 -MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVW 380
            +WD  +               E I  H GH   VND   +   PWL+ S   +N + +W
Sbjct: 367 KLWDTAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIW 412

Query: 381 KCSHSL 386
           K + +L
Sbjct: 413 KPAENL 418

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  107 bits (266), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 183/418 (43%), Gaps = 69/418 (16%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE- 68
           + E Y  WK N  L+YD+++     WPSLT Q+ P    +LD    +  +++ + TS + 
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFP----DLDTTLNEHRILLSSFTSSQK 74

Query: 69  -EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPR--SNIRITAKYEHEEE 120
            E+  +  + I+    I    L+N D  E E   E  ++ P+     +IRI   +    E
Sbjct: 75  PEDETIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRI---FFPNGE 131

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHK-------------------- 160
             RARY+PQ+P+I+A  +  G ++++ R++   + ++  K                    
Sbjct: 132 CNRARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVE 191

Query: 161 ---------DNGYALSFSTLVKGRLLSGSDDHTVALWEVG--SGGDPTKPVRTWN-DLHS 208
                    +   +L+++   +  LLS   +  + +W++   S  +P   V   + D   
Sbjct: 192 TMDTSLVDINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDG 251

Query: 209 DIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCP---QPFNTLAFSHHSSN 265
             +ND  W   +  LF   +E + + + D+R     + +  C       N+  F++ +S 
Sbjct: 252 SSVNDVTWMPTHDSLFAACTERNAVSLLDLRTKKEKLKS-NCKIHGGGVNSCKFNYKNSL 310

Query: 266 LLAAAGMDSYVYLYDLRNMKE-PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MW 323
           +LA+A  +  + L+D+RNM E P+  M  H  +V+ LE+S +           + L+ +W
Sbjct: 311 ILASADSNGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLW 369

Query: 324 DLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           D  +               E I  H GH   VND   +   PWL+ S   +N + +WK
Sbjct: 370 DTTR--------------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWK 413

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  107 bits (266), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 95/416 (22%), Positives = 183/416 (43%), Gaps = 63/416 (15%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q+ P    ++D       L++ T TS + 
Sbjct: 13  LQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFP----DIDKSNDTHRLLLSTFTSSQI 68

Query: 69  ---EENYLK-FAEIN-LPKEILSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEEEIT 122
              E  Y+   + +N L    L+N D  E E   + +   P+      I+  +  E +  
Sbjct: 69  PDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISITFP-EGDCN 127

Query: 123 RARYMPQDPNIVATINGQGTVFLYSRSE----------------------GLQSTLKFHK 160
           +ARYMPQ+P+I+   +  G ++++ R++                       L    KF  
Sbjct: 128 KARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEAKLAKQRKFVI 187

Query: 161 DNG--------YALSFSTLVKGRLLSGSDDHTVALWEVG---SGGDPTKPVRTWNDLHSD 209
           ++G         +++++   +G+LLS   +  + LW+     S  +       W+    D
Sbjct: 188 EDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREINNTIWDTNFDD 247

Query: 210 I-INDNKWHNFNKDLFGTVSEDSLLKINDVRANN--TTIDTVKCPQPFNTLAFSHHSSNL 266
           +  N+  W N +  +F T  E++ + + D R      +I+        N+  F++ ++ L
Sbjct: 248 LGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINSCKFNYENAML 307

Query: 267 LAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDL 325
           LA+   +  + L+D+R + +P+ ++  H  +++ +E+S             + L+ +WD 
Sbjct: 308 LASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQEDGLVKLWD- 365

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
             I  E+ P          I +H GH   +ND   +   PWL+ S   +N +Q+WK
Sbjct: 366 --ISNEEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDNSIQIWK 409

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 99/419 (23%), Positives = 188/419 (44%), Gaps = 62/419 (14%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P  + E Y  WK N  L+Y +++     WPSLT Q+ P    +LD       +++ T TS
Sbjct: 13  PDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFP----DLDTTTDTHRILLSTFTS 68

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE 119
            +  E+  L  A ++    +    L+N D  E E   +  +  P+   N+ I+  + +  
Sbjct: 69  SQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNLNVDISIPFPN-G 127

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSE---------------GLQSTLKF-----H 159
           +  RARY+PQ+P+++A  +  G++++++R++                L ST K      +
Sbjct: 128 DCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENFTN 187

Query: 160 KDNGYALSFSTLVKGRLLSGSDDHTVALWEVG--SGGDPTKPVRTWNDL----HSDIIND 213
            +   +++++    G L S     ++ +W++   S  DPT  +R  N+L      +  N+
Sbjct: 188 SNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPT--LRE-NELTIPFDPEGCNE 244

Query: 214 NKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC----PQPFNTLAFSHHSSNLLAA 269
             W   +  +F   SE + L + DVR     +   +         N+  F++++  LLA+
Sbjct: 245 VTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDMLLAS 304

Query: 270 AGMDSYVYLYDLRNM-KEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQ 327
           A     + ++D+R + KEP+     H  +++ LE++ +           + L+ +WD   
Sbjct: 305 ADSTGKINMWDIRKLDKEPIKSF-NHNSSISTLEWNPNLETILVTAGQDDGLVKIWDTAN 363

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                          + I VH GH   VND   +   PWL++S   +N + VWK + +L
Sbjct: 364 --------------GQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATNL 408

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  106 bits (264), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 185/419 (44%), Gaps = 69/419 (16%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSG-- 67
           + E Y  WK N  L+YD+++     WPSL+ Q+     Q+++       +++ + TSG  
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFF----QDVNTKNDSHRILLSSFTSGLM 78

Query: 68  ---EEENYLKFAEI-NLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEE--- 120
              E  N +  + + ++P   L+N D  E    E++     P +N+++  K  H E+   
Sbjct: 79  PEQESINIMSISTLKHVPWASLNNFDMDEM---EFK-----PDNNLKLPPKNLHTEQTIT 130

Query: 121 -----ITRARYMPQDPNIVATINGQGTVFLYSRSE---GLQSTLKFHK------------ 160
                  RARY+PQ+ +I+A  +  GTV++++R++    L+ T  F              
Sbjct: 131 FPNGDCNRARYLPQNQDIIAGASSDGTVYIFNRTKYGSTLRQTSSFQSYQARFAEPENTV 190

Query: 161 -------DNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWND---LHSDI 210
                  +   ++ ++   +G L +   D  +  W++    +    + T      + ++ 
Sbjct: 191 QSVDSNPNEALSIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNG 250

Query: 211 INDNKWHNFNKDLFGTVSEDSLLKINDVRAN--NTTIDTVKCPQPFNTLAFSHHSSNLLA 268
            ND  W   +  L     E + L I D+R +  +TTI +       N   F++ ++ ++A
Sbjct: 251 ANDVTWMPLHDSLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVA 310

Query: 269 AAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQ 327
           +A     V+++D+R   E +  +  H  +++ +E++ +           + L+ +WD+  
Sbjct: 311 SADTVGNVHIWDIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD 369

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                          ELI  H GH   VND   N   PWL+ S   +N +Q+W+ +H+L
Sbjct: 370 --------------SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  105 bits (263), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 104/413 (25%), Positives = 182/413 (44%), Gaps = 56/413 (13%)

Query: 10  VDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE- 68
           + + Y  WK N  L+YD+++     WPSLT Q++P    +L+    K  L++ + TS + 
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMP----DLEVPTDKHRLLLSSFTSSQL 76

Query: 69  -EENYLKFAEIN----LPKEILSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE-EI 121
            E+  +  +E++    +P   L+N D  E E   + Q+ L  P  N+  T + +    + 
Sbjct: 77  PEDEAVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKL--PNKNLVETVRIQFPSGDC 134

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSE---------GLQSTLKFH---------KDNG 163
            RA YMPQ+P+I+  I   G V ++ R++         G  ++ +            D+ 
Sbjct: 135 NRACYMPQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSA 194

Query: 164 YALSFS--TLVKGRLLSGSDDHTVALWEVG--SGGDPT---KPVRTWNDLHSDIINDNKW 216
            ALS +      G + S   +  + +W++       PT     +R   D      ND  W
Sbjct: 195 EALSLAWNWQKAGIIASSYSNGLIKVWDITRYQKSQPTISNPELRILQDKAG--TNDVSW 252

Query: 217 HNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP--FNTLAFSHHSSNLLAAAGMDS 274
              +  +     E + + + D RA +    T   P     N L F++ +  LL AA  + 
Sbjct: 253 MVHHSSILAACGESNTIGLLDTRAPDAFKPTKASPHTGGINALQFNYANDMLLCAADSNG 312

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGAEQT 333
            + L+D R   +PL  +  H D+V+ L+++ +           + L+ +WD       + 
Sbjct: 313 GIALWDCRAFSKPL-SVFNHGDSVSALQWNPNLPTIVATAGQGDGLIKIWD-----TSRE 366

Query: 334 PDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           P+D+      L+ VH GH   VND   N   PWL+ S   +N + VWK + +L
Sbjct: 367 PEDS------LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  103 bits (258), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 99/419 (23%), Positives = 186/419 (44%), Gaps = 73/419 (17%)

Query: 12  EEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE--E 69
           + Y  WK N  L+YD+++     WPSLT ++ P    +LD       L++ + TS +  E
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFP----DLDTTTDSHRLLLSSFTSSQLPE 72

Query: 70  ENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRS-----NIRITAKYEHEE 119
           +  +  + I+  K +    L+N D  E E   E  + LP PR+     +IRI +      
Sbjct: 73  DESIYISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLP-PRNLTDDISIRIPSG----- 126

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGY--------------- 164
           +  RARY+PQ+P++++  +  G+++++ R++   +  +      Y               
Sbjct: 127 DSNRARYLPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDS 186

Query: 165 -----ALSFSTLVKGRLLSGSDDHTVALWEVGS--GGDPT--KPVRTWNDLHSDIINDNK 215
                +L ++   +G L S      + +W++      +PT   P+ + +D      ND  
Sbjct: 187 PNEVVSLDWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDIT 246

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP------FNTLAFSHHSSNLLAA 269
           W   +  L     E + + I D R+ +     V   QP       N+  F+ H+  LLA+
Sbjct: 247 WMPSHDSLLAACGESNTVAIYDTRSKSQ----VSKIQPGLHNGGINSCDFNAHNDYLLAS 302

Query: 270 AGMDSYVYLYDLRNM-KEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQ 327
           A     V+++D+R + ++P+  +S H  +++ ++++ +           + L+ +WD   
Sbjct: 303 ADSIGTVHMWDIRKLDQDPIQSVS-HGSSISTVKWNPNVATIIAVAGQEDGLVKLWD--- 358

Query: 328 IGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                    A +G  +LI  H GH   VND   N   PWL+ S   +N + +W+ S  L
Sbjct: 359 ---------ASNG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score = 98.6 bits (244), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 91/416 (21%), Positives = 180/416 (43%), Gaps = 56/416 (13%)

Query: 7   PLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTS 66
           P  + + Y  WK N  L+YD+++     WPSLT Q+      +LD       +++   TS
Sbjct: 15  PEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFF----HDLDTTSDTHRILLSAFTS 70

Query: 67  GE--EENYLKFAEINLPKEI----LSNEDPQE-EAGEEYQSSLPAPRSNIRITAKYEHEE 119
            +  E+  +  A+++  K +    ++N D  E E   E    LP+      I+ ++  + 
Sbjct: 71  SQLPEDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFP-DG 129

Query: 120 EITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKD------------------ 161
           +   ARY+PQ+P+++A  +  G+++++ R++     ++  K+                  
Sbjct: 130 DCNIARYLPQNPDVIAGASSHGSIYIFDRTKHGSLRMRQSKNLKPYEAALYCPPKGIENV 189

Query: 162 ----NGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRT--WN-DLHSDIINDN 214
                  ++S++   +G L S      + LW++    +    + T   N D  +  +ND 
Sbjct: 190 ENTNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDV 249

Query: 215 KWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAAAGM 272
            WH  +  +     E +++ + D R     + + +       N+  F+ H  +LL +   
Sbjct: 250 NWHPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMHNGGINSCKFNSHCDSLLISGDS 309

Query: 273 DSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGA 330
           +  + L+DLR +  EP+  +  H  +++ LE++ +           + L+ +WD+     
Sbjct: 310 EGRINLWDLRKLDGEPIKTLH-HGSSISTLEWNPNLETIVASAGQDDGLVKLWDV----- 363

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
                       EL+  H GH   VND   N    WL+ S   +N +QVWK +H+L
Sbjct: 364 ---------STDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 102/416 (24%), Positives = 179/416 (43%), Gaps = 66/416 (15%)

Query: 13  EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGE--EE 70
            Y  WK N  L+YD+++     WPSLT Q+ P    ++D       +++ ++TS +  E+
Sbjct: 18  RYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFP----DVDANTDTHRILLSSYTSCQLPED 73

Query: 71  NYLKFAEINLPKEI----LSNEDPQEEAGEEYQSSLPAPR---SNIRITAKYEHEEEITR 123
             +  A I+    +    L+N D  E   +  +++   P+   +N+ IT       +  R
Sbjct: 74  ENVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNR 130

Query: 124 ARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHK----------------------- 160
           ARYMPQ+P+++A  +  G V++++R++     ++ H                        
Sbjct: 131 ARYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEA 190

Query: 161 -----DN-GYALSFSTLVKGRLLSGSDDHTVALWEVGSGG-DPTKPVRT-W--NDLHSDI 210
                DN   +L+++   +G L        V +W++     D T    T W  ++  S  
Sbjct: 191 RRTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRG 250

Query: 211 INDNKWHNFNKDLFGTVSEDS-LLKINDVRANNTT--IDTVKCPQPFNTLAFSHHSSNLL 267
           +ND  W + +  +     E S  L + D RA N    I      +  N   F+  ++ LL
Sbjct: 251 VNDVSWMSQHDSILAACGERSDSLALFDTRAQNAVAKIRNQFKSEGINACKFNWENNLLL 310

Query: 268 AAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDL 325
           A+        L+D+R +  EP+ H   H  +V+ LE++ H           + L+ +WD 
Sbjct: 311 ASTDSTGRTNLWDVRKLSAEPIVHFD-HGGSVSTLEWNPHDHSVLATAGQSDGLIKIWD- 368

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
                  T  + ED   + I VH+GH   VND   +   PWL+ S   +N + VWK
Sbjct: 369 -------TSLEIED---KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWK 414

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 94/422 (22%), Positives = 175/422 (41%), Gaps = 53/422 (12%)

Query: 1   MENQEKPLSVDE--EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQE 58
           + ++ +PL  DE  E D      P +Y+ +    + WP LT+  +P  +      + +  
Sbjct: 97  LPHKSRPLGPDEVLEAD------PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSI 150

Query: 59  LII-GTHTSGEEENYLK-FAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYE 116
           L+   T +S ++EN L   A  NL K +L +++ +++   E +  +     N  I  +  
Sbjct: 151 LLTTATQSSRKKENELMVLALSNLTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDT 210

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLY---SRSEGLQS--------------TLKFH 159
                     +     + AT++  G V++Y   ++S+   +              T+K H
Sbjct: 211 TNRLKVSPFAVSNQEVLTATMSENGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNH 270

Query: 160 KD-NGYALSFSTLVK-GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWH 217
            +  GY L +S L+K G LLSG     + L +  +    T   +++   +++ I D +W 
Sbjct: 271 GNVEGYGLDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDK-QSFTVSNNESIEDIQWS 329

Query: 218 NFNKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
                +F T + D  ++I D R+  +   I         N +++S     LLA+   +  
Sbjct: 330 RTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGT 389

Query: 276 VYLYDLRNMK-------EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL--- 325
             ++DLR          +P+     H+ A+ ++ F+             N + +WDL   
Sbjct: 390 WGVWDLRQFTPSNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVE 449

Query: 326 ------KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQV 379
                 KQ  AE    + +D  P+L+ VH   +  V D   + QIP  + S   +  L V
Sbjct: 450 ADDEEIKQQAAETK--ELQDIPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDG-LNV 504

Query: 380 WK 381
           WK
Sbjct: 505 WK 506

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 89/408 (21%), Positives = 161/408 (39%), Gaps = 62/408 (15%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI-IGTHTSGEEENYLKFAEIN- 79
           P +YD +    + WP LT+  +P  +      + +  L+   T  S ++EN L    ++ 
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 80  LPKEILSNEDPQEEAGEEYQSSLPAP---RSNIRITAKYEHEEEITRARYMP----QDPN 132
           L K ++ ++D      E+       P     NI +       +   R R  P        
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISL------RDTTNRLRVSPFAQSNKEV 232

Query: 133 IVATINGQGTVFLYS---RSEGLQS--------------TLKFHKD-NGYALSFSTLVK- 173
           + AT++  G V+++    +S+   S              T+K H +  GYAL +S L+K 
Sbjct: 233 LTATMSENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKT 292

Query: 174 GRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDS 231
           G LL+G     + L +  +    T  +P    N+     + D +W      +F +   D 
Sbjct: 293 GALLTGDCSGQIYLTQRNTSKWVTDKQPFTVGNNKS---VEDIQWSRTEATVFASCGCDG 349

Query: 232 LLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR------- 282
            ++I D R+  +   +         N ++++     LLA+   +    ++DLR       
Sbjct: 350 YVRIWDTRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNI 409

Query: 283 NMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL---------KQIGAEQT 333
           N  +P+     H+ A+ ++ F+             N + +WDL         KQ  AE  
Sbjct: 410 NNVQPVAQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK 469

Query: 334 PDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
             + E   P+L+ VH   +  V D   + QIP  + S   +  L +WK
Sbjct: 470 --ELESIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNIWK 512

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 103/436 (23%), Positives = 173/436 (39%), Gaps = 80/436 (18%)

Query: 1   MENQEKPLSVDE--EYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQE 58
           + N  +PL  DE  E D      P +Y+ +    L WP LT+  +P  +      + +  
Sbjct: 102 LPNISRPLGPDEVLEAD------PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSI 155

Query: 59  LII-GTHTSGEEENYLKFAEIN-LPKEILSNEDPQEE---------AGEEY--QSSLPA- 104
           L+   T  S +++N L   +++ L K ++ ++D  +          AGE      SLP  
Sbjct: 156 LMTTATQASKKKDNELMVLKLSHLTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLR 215

Query: 105 -PRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYS--------RSEGLQ-- 153
              + +RI+     ++EI           + +T++  G VF+Y          + G Q  
Sbjct: 216 DTTNRLRISPYATVQQEI-----------LTSTMSENGEVFIYDLTPQTRAFETPGYQIP 264

Query: 154 -------STLKFHKD-NGYALSFSTLVK-GRLLSGSDDHTVALWEVGSGGDPT--KPVRT 202
                   T++ H +  GY L +S L+K G LL+G     V L +  +    T   P   
Sbjct: 265 KTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLTGDCSGMVYLTQRHTSKWVTDKTPFTV 324

Query: 203 WNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFS 260
            N+     I D +W      +F T   D  ++I D R+  +   I TV      N ++++
Sbjct: 325 GNNKS---IEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPVISTVVSNTDVNVISWN 381

Query: 261 HHSSNLLAAAGMDSYVYLYDLRNMKE------PLHHMSGHEDAVNNLEFSTHXXXXXXXX 314
                LLA+        ++DLR          P+     H+ A+ ++ F+          
Sbjct: 382 EKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPVAQYDFHKGAITSISFNPLDESIVAVA 441

Query: 315 XXXNRLMMWDL---------KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
              N + +WDL         KQ  AE    + E   P+L+ VH   +  V D   + QIP
Sbjct: 442 SEDNTVTLWDLSVEADDEEIKQQKAE--IKELEQIPPQLLFVH--WQKEVKDVKWHKQIP 497

Query: 366 WLVASAEEENILQVWK 381
             + S   +  L VWK
Sbjct: 498 GCLVSTGTDG-LNVWK 512

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 89/401 (22%), Positives = 161/401 (40%), Gaps = 49/401 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 80  LPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATING 139
           L K +L +++  E+  E+ +  +     N  I  +            +     + AT++ 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 140 QGTVFLYS---RSEGLQS--------------TLKFHKD-NGYALSFSTLVK-GRLLSGS 180
            G V++Y+   +S+   +              T+K H +  GY L +S L+K G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 181 DDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV 238
               +   +  +    T  +P    N+     I D +W      +F T   D  ++I D 
Sbjct: 295 CSGQIYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRTESTVFATAGCDGYIRIWDT 351

Query: 239 RA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-------EPLH 289
           R+  +   I         N +++S     LLA+   +    ++DLR          +P+ 
Sbjct: 352 RSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQPVA 411

Query: 290 HMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL---------KQIGAEQTPDDAEDG 340
               H+ A+ ++ F+             N + +WDL         KQ  AE    + ++ 
Sbjct: 412 QYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETK--ELQEI 469

Query: 341 VPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
            P+L+ VH   +  V D   + QIP  + S   +  L VWK
Sbjct: 470 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 507

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S   S + A AG D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 317 TVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSD 376

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     TP +A+   P  +  +  H+ ++     NP   
Sbjct: 377 KIGYLLASGDDNGTWGVWDLRQF----TPSNADAVQP--VAQYDFHKGAITSIAFNPLDE 430

Query: 366 WLVASAEEENILQVWKCS 383
            +VA   E+N + +W  S
Sbjct: 431 SIVAVGSEDNTVTLWDLS 448

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 9/157 (5%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHS-DII 211
           Q     H D   +L+ +   +  L S S DHTV LW++  G    +  R+ + +HS   +
Sbjct: 264 QHVATHHTDAVLSLAHNRHFRAVLASTSADHTVKLWDLNHG----RAARSLDAVHSATAV 319

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVR-ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAA 270
           + ++WH  +  +  T   DS + ++DVR AN+  +           +  +   S  +  A
Sbjct: 320 SSSQWHPSDGSILLTAGYDSRVALSDVRIANDAGMSKYWKVMKGEEIESATFVSETVFLA 379

Query: 271 GMDS-YVYLYDLRNMKE--PLHHMSGHEDAVNNLEFS 304
           G DS  VY +DLRN ++  PL  ++ H+  +++L  S
Sbjct: 380 GTDSGNVYSFDLRNGEDSAPLWTLNAHDSGISSLSVS 416

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 89/402 (22%), Positives = 166/402 (41%), Gaps = 51/402 (12%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI-IGTHTSGEEEN---YLKFAE 77
           P +Y+ +    + WP LT+  +P  +      + +  L+   T  S ++EN    LK ++
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  INLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATI 137
           +N  K ++ ++  +EE  E+ + +   P       +  +    +  + +      + AT+
Sbjct: 178 LN--KTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATM 235

Query: 138 NGQGTVFLYS--------RSEGLQ---------STLKFHKD-NGYALSFSTLVK-GRLLS 178
           +  G V+++          + G Q          T++ H +  GY L +S L+K G LL+
Sbjct: 236 SENGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLT 295

Query: 179 GSDDHTVALWEVGSGGDPT-KPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           G     V L +  +    T K   T+++  S  I D +W      +F T   D  ++I D
Sbjct: 296 GDCSGQVYLTQRHTSKWVTDKQPFTFSNNKS--IEDIQWSRTESTVFATSGCDGYIRIWD 353

Query: 238 VRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-------EPL 288
            R+  +   I T       N ++++     LLA+   D    ++DLR +        +P+
Sbjct: 354 TRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQPV 413

Query: 289 HHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL---------KQIGAEQTPDDAED 339
                H+ A+ ++ F+             N + +WDL         KQ  AE    + + 
Sbjct: 414 AQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETK--ELQQ 471

Query: 340 GVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
             P+L+ VH   +  V D   + QIP  + S   +  L VWK
Sbjct: 472 IPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 510

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXXXXXXX 315
           + +S   S + A +G D Y+ ++D R+ K +P          VN + ++           
Sbjct: 330 IQWSRTESTVFATSGCDGYIRIWDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGD 389

Query: 316 XXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEEN 375
              R  +WDL+Q+    +P+++E+  P  +  +  H+ ++     NP    ++A A E+N
Sbjct: 390 DDGRWGVWDLRQL----SPNNSENVQP--VAQYDFHKGAITSISFNPLDESIIAVASEDN 443

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 444 TVTLWDLS 451

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 81/395 (20%), Positives = 159/395 (40%), Gaps = 39/395 (9%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII-GTHTSGEEENYLKFAEI-N 79
           P +Y+ +    + WP L++  +P  +      + +  L+   T  S ++EN L    + N
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 80  LPKEILSNEDPQ---------EEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQD 130
           L K +L +E+ +         E   E    +L    + I+++      +E+  A      
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPIIENENIALRDTTNRIKVSPFASQSQEVLTATMSENG 238

Query: 131 PNIVATINGQGTVF------LYSRSEGLQSTLKFHKD-NGYALSFSTLVK-GRLLSGSDD 182
              +  I  Q   F      +  +S+    T++ H +  GY L +S L+K G LLSG   
Sbjct: 239 EVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGDCS 298

Query: 183 HTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-- 240
             + L +  +    T   + ++  ++  I D +W      +F T   D  +++ D R+  
Sbjct: 299 GQIYLTQRHTSKWVTDK-QAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSKK 357

Query: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-------EPLHHMSG 293
           +   I         N ++++     LLA+   +    ++DLR          +P+   + 
Sbjct: 358 HKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYNF 417

Query: 294 HEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIG-----AEQTPDDAE--DGVPELIM 346
           H+ A+ ++ F+             N + +WDL          +QT +  E  +  P+L+ 
Sbjct: 418 HKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLLF 477

Query: 347 VHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           VH   +  + D   + QIP  + S   +  L +WK
Sbjct: 478 VH--WQKEIKDVKWHKQIPGCLVSTGTDG-LNIWK 509

>SAKL0F11506g Chr6 complement(894080..895786) [1707 bp, 568 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 568

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 81/155 (52%), Gaps = 13/155 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +LS +   +  L S S DHTV LW++ +G       R+   +H++  ++ ++WH
Sbjct: 278 HTDAVLSLSHNRHFRAVLASTSADHTVKLWDLNNG----IAARSIASIHNNKNVSSSQWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDVR-ANNTTID---TVKCPQPFNTLAFSHHSSNLLAAAGMD 273
           + +  +  T   DS + ++DVR A+++ +    +V   +   ++ F+  S N++      
Sbjct: 334 STDGSILLTGGYDSRVAVSDVRIADDSAMSKYWSVMAGEEIESVRFA--SENVIMCGTDS 391

Query: 274 SYVYLYDLRNMK--EPLHHMSGHEDAVNNLEFSTH 306
             VY +D+RN +  +PL  +  H+  +++L+ + H
Sbjct: 392 GNVYSFDIRNGEGSKPLWTLKAHDAGISSLDVNQH 426

>KAFR0L01520 Chr12 complement(278754..280508) [1755 bp, 584 aa] {ON}
           Anc_7.356 YLR196W
          Length = 584

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 75/156 (48%), Gaps = 13/156 (8%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-I 211
           Q     H D   +LS +   +  L S S DHTV LW++ SG       R+   +H++  +
Sbjct: 282 QHITSHHTDAVLSLSHNKHFRAVLASTSADHTVKLWDLNSG----NAARSMASIHNNKNV 337

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLL 267
           + ++WH+ N  +  T   DS + + DVR +N    +   +V   +   T+ F+    N++
Sbjct: 338 SSSQWHHGNGSILLTGGYDSRIALTDVRISNENEMSKYWSVSNGEEVETVIFA--DENII 395

Query: 268 AAAGMDSYVYLYDLRN--MKEPLHHMSGHEDAVNNL 301
            A      +Y +D+RN    +P+  +  H+  +++L
Sbjct: 396 LAGTDSGNIYSFDIRNNAGSKPVWTLKAHDAGISSL 431

>YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Protein
           with WD-40 repeats involved in rRNA processing;
           associates with trans-acting ribosome biogenesis
           factors; similar to beta-transducin superfamily
          Length = 576

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +++ +   +  L S S DHTV LW++ SG       R+   +HS+  ++ ++WH
Sbjct: 285 HTDAVLSMAHNKYFRSVLASTSADHTVKLWDLNSG----NAARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTID----TVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + + DVR ++ +      +    +   T+ F+  S N++      
Sbjct: 341 MLNGSILLTGGYDSRVALTDVRISDESQMSKYWSAMAGEEIETVTFA--SENIILCGTDS 398

Query: 274 SYVYLYDLRN--MKEPLHHMSGHEDAVNNL 301
             VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 399 GNVYSFDIRNNENRKPVWTLKAHDAGISTL 428

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 102/250 (40%), Gaps = 29/250 (11%)

Query: 153 QSTLKFHKD-NGYALSFSTLVK-GRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHS 208
           Q T+K H +  GY L +S L+K G LL+G     V L +  S    T  +P    N+   
Sbjct: 276 QYTIKNHGNVEGYGLDWSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKS- 334

Query: 209 DIINDNKWHNFNKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNL 266
             I D KW      +F T   D  ++I D+R+  +   +         N ++++   S L
Sbjct: 335 --IEDIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSWNQKISYL 392

Query: 267 LAAAGMDSYVYLYDLRNMK------EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRL 320
           LA    +    ++DLR          P+     H+ A+ ++ F+             N +
Sbjct: 393 LATGDDNGTWGVWDLRQFSNQQGGVSPVAQYDFHKGAITSISFNPLDESIIAVASEDNTV 452

Query: 321 MMWDL---------KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASA 371
            +WDL         KQ  AE    + +   P+L+ VH   +  V D   + QIP  + S 
Sbjct: 453 TLWDLSVEADDEEIKQQAAEVK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVST 508

Query: 372 EEENILQVWK 381
             +  L VWK
Sbjct: 509 GTDG-LNVWK 517

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 88/411 (21%), Positives = 162/411 (39%), Gaps = 70/411 (17%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI-IGTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S + EN L   A  N
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 80  LPKEILSNEDPQEEAG----------EEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQ 129
           L K +L +++ +++            E     L    + ++++      +E+        
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEV-------- 225

Query: 130 DPNIVATINGQGTVFLYS---RSEGLQS--------------TLKFHKD-NGYALSFSTL 171
              + AT++  G V++Y    +S+   +              T+K H +  GY L +S L
Sbjct: 226 ---LTATMSENGDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPL 282

Query: 172 VK-GRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNFNKDLFGTVS 228
           +K G LLSG     +   +  +    T  +P    N+     I D +W      +F T  
Sbjct: 283 IKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRTESTVFATAG 339

Query: 229 EDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK- 285
            D  ++I D R+  +   I         N +++S     LLA+   +    ++DLR    
Sbjct: 340 CDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTP 399

Query: 286 ------EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL---------KQIGA 330
                 +P+     H+ A+ ++ F+             N + +WDL         KQ  A
Sbjct: 400 SNADTVQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTA 459

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           E    + ++  P+L+ VH   +  V D   + QIP  + S   +  L VWK
Sbjct: 460 ET--KELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S   S + A AG D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 315 TVSNNKSIEDIQWSRTESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSD 374

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     TP +A+   P  +  +  H+ ++     NP   
Sbjct: 375 KIGYLLASGDDNGTWGVWDLRQF----TPSNADTVQP--VAQYDFHKGAITSIAFNPLDE 428

Query: 366 WLVASAEEENILQVWKCS 383
            +VA   E+N + +W  S
Sbjct: 429 SIVAVGSEDNTVTLWDLS 446

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 61/122 (50%), Gaps = 2/122 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP-FNTLAFSHHSSN 265
           HS  I D  ++  N D+  T S D+ +   D+R+ +    T    +   + + +++  SN
Sbjct: 116 HSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWNYKDSN 175

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           +LA+A  +  +Y++DLR    PLH + GH+ +VN+++F+               +  WD+
Sbjct: 176 ILASAHSND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDI 234

Query: 326 KQ 327
            +
Sbjct: 235 SK 236

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 60/127 (47%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+  + ++LA   +D+YV+ +D+R+   P +  S      + ++++ +          
Sbjct: 123 INFNPENPDILATCSVDTYVHAWDMRSPHRPFYTTSAWRSGASQVKWN-YKDSNILASAH 181

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL+ +G+  TP      + +L+    GH SSVN  D N      + S+  +  
Sbjct: 182 SNDIYIWDLR-MGS--TP------LHKLV----GHDSSVNSIDFNRFKSSEIMSSSNDGT 228

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 229 VKFWDIS 235

>Suva_10.292 Chr10 (516694..518436) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 73/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +++ +   +  L S S DHTV LW++ SG       R+ + +HS+  ++ ++WH
Sbjct: 289 HTDAVLSMAHNRHFRSVLASTSADHTVKLWDLNSG----SAARSLDSIHSNKNVSSSEWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTID----TVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + + DVR ++ +      +V   +   T+ F+    N++      
Sbjct: 345 MLNGSVLLTGGYDSRVALTDVRISDESQMSKHWSVMSGEEIETVTFADE--NIILCGTDS 402

Query: 274 SYVYLYDLRN--MKEPLHHMSGHEDAVNNL 301
             VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 403 GNVYSFDIRNNESRKPVWTLKAHDAGISTL 432

>Skud_12.261 Chr12 (490588..492330) [1743 bp, 580 aa] {ON} YLR196W
           (REAL)
          Length = 580

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 74/156 (47%), Gaps = 13/156 (8%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-I 211
           Q     H D   +++ +   +  L S S DHTV LW++ SG       R+   +HS+  +
Sbjct: 283 QHITTHHTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSG----NAARSLASIHSNKNV 338

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTID----TVKCPQPFNTLAFSHHSSNLL 267
           + ++WH  N  +  T   DS + + DVR ++ +      +V   +   T+ F++   N++
Sbjct: 339 SSSEWHMLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETVTFANE--NII 396

Query: 268 AAAGMDSYVYLYDLRN--MKEPLHHMSGHEDAVNNL 301
                   VY +D+RN   ++P+  +  H+  ++ L
Sbjct: 397 LCGTDSGNVYSFDIRNNENRKPVWTLKAHDAGISTL 432

>KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]
           {ON} similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 572

 Score = 49.7 bits (117), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 13/155 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +L+ +   +  L S S DHTV LW++ +        R+  ++HS+  ++ ++WH
Sbjct: 287 HTDAILSLAHNKQFRAVLASTSADHTVKLWDLNTA----TAARSLINIHSNTNVSASQWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS   ++DVR  N    +    V   +    + F+    N+      +
Sbjct: 343 PSNGSVLLTAGYDSRAALSDVRIENDNDMSKYWNVSSGEEIECVRFA--DENIFICGTDN 400

Query: 274 SYVYLYDLRNMKE--PLHHMSGHEDAVNNLEFSTH 306
             VY +D+RN  E  P+  +  H+  V+++E + H
Sbjct: 401 GNVYSFDIRNGAESKPVWTLKAHDAGVSSVEINRH 435

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 94/406 (23%), Positives = 164/406 (40%), Gaps = 60/406 (14%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII-GTHTSGEEENYLK-FAEIN 79
           P +Y+ +    + WP LT+  +P  +      + +  L+   T +S ++EN L   A  N
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 80  LPKEILSNEDPQEEAGEEYQSSLPAPRS-NIRITAKYEHEEEITRARYMP----QDPNIV 134
           L K +L +E+ +E+  E+     P   + NI +       +   R +  P        + 
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPL------RDTTNRLKVSPFAVSNQEVLT 227

Query: 135 ATINGQGTVFLYS---RSEGLQS--------------TLKFHKD-NGYALSFSTLVK-GR 175
           AT++  G V++Y    +S+   +              T+K H +  GY L +S L+K G 
Sbjct: 228 ATMSENGDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGS 287

Query: 176 LLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
           LLSG     V   +  +    T  +P    N+     I D +W      +F T   D  +
Sbjct: 288 LLSGDCSGQVYFTQRHTSRWVTDKQPFTVSNNKS---IEDIQWSRSESTVFATAGCDGYI 344

Query: 234 KINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK------ 285
           +I D R+  +   I         N +++S     LLA+   +    ++DLR         
Sbjct: 345 RIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADS 404

Query: 286 -EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL---------KQIGAEQTPD 335
            +P+     H+ A+ ++ F+             N + +WDL         KQ  AE    
Sbjct: 405 VQPVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETK-- 462

Query: 336 DAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           + ++  P+L+ VH   +  V D   + QIP  + S   +  L VWK
Sbjct: 463 ELQEIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG-LNVWK 505

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S   S + A AG D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 315 TVSNNKSIEDIQWSRSESTVFATAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSD 374

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     TP +A+   P  +  +  H+ ++     NP   
Sbjct: 375 KIGYLLASGDDNGTWGVWDLRQF----TPSNADSVQP--VAQYDFHKGAITSIAFNPLDE 428

Query: 366 WLVASAEEENILQVWKCS 383
            +VA   E+N + +W  S
Sbjct: 429 SIVAVGSEDNTVTLWDLS 446

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 74/356 (20%), Positives = 131/356 (36%), Gaps = 57/356 (16%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P   Q          L      + E+E  ++  +INL  
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQPARAQPRTFATCSDSLXXFWSLT-EDETAIQ-EQINL-- 184

Query: 83  EILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIV--ATINGQ 140
            +  +   Q E G+E           +           IT   + P DPN++  ++I+  
Sbjct: 185 SLCKHNKQQSEKGKEL----------VGTNGVLGELPPITSFHWNPTDPNLLISSSIDTT 234

Query: 141 GTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPV 200
             V+    +  +++ L  H    + + F T       S   D +V ++++          
Sbjct: 235 CIVWDLQSANYIKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLA------ 288

Query: 201 RTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFS 260
                 HS II +    +   DL       +LL++               P PF+     
Sbjct: 289 ------HSTIIYEPTIPDGAPDLPSPTVPPALLRLE--------------PSPFD----- 323

Query: 261 HHSSNLLAAAGMDSY-VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNR 319
               N++A   +DS  V + D+R+   PL  +  H   +N +++               +
Sbjct: 324 ---PNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDCQ 380

Query: 320 LMMWDL-KQIGAEQTPDDAEDGVPELI-----MVHAGHRSSVNDFDLNPQIPWLVA 369
           ++ WDL   + +E T D   D  P+       M +A     VN+    PQ  W  A
Sbjct: 381 VLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGA 436

>Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]
           {ON} YLR196W (PWP1) - similar to beta-transducin
           superfamily [contig 161] FULL
          Length = 561

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 78/151 (51%), Gaps = 15/151 (9%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +LS S   +  L S S DHTV LW++ +G       R++  +HS+  ++ ++WH
Sbjct: 274 HTDAVLSLSHSKQFRAVLASTSADHTVKLWDLNAG----IAARSFASIHSNKNVSSSQWH 329

Query: 218 NFNKDLFGTVSEDSLLKINDVR-ANNTTID---TVKCPQPFNTLAFSHHSSNLLAAAGMD 273
           + +  +  T   DS + + DVR A+++ +    +V   +    + F+  ++ +    G D
Sbjct: 330 STSGSVLLTGGYDSRIALTDVRIADDSQMSKYWSVMSGEEVECVQFADENTIM---CGTD 386

Query: 274 S-YVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
           S  VY YD+R  +  +PL  ++ H+  ++ L
Sbjct: 387 SGNVYSYDIRQGEGSKPLWTLNAHDAGISTL 417

>Smik_12.256 Chr12 (490929..492659) [1731 bp, 576 aa] {ON} YLR196W
           (REAL)
          Length = 576

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +++ +   +  L S S DHTV LW++ SG       R+   +HS+  ++ ++WH
Sbjct: 285 HTDAVLSMAHNKHFRSVLASTSADHTVKLWDLNSG----NAARSLASIHSNKNVSSSEWH 340

Query: 218 NFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + + DVR ++    +   +V   +   T  F+  S N++      
Sbjct: 341 MLNGSVLLTGGYDSRVALTDVRISDESQMSKYWSVMSGEEIETATFA--SENIILCGTDS 398

Query: 274 SYVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
             VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 399 GNVYSFDIRNSENCKPVWTLKAHDAGISTL 428

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 59/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    L +S   S + A+ G+D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 329 TVANNKSIEDLQWSRTESTVFASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSE 388

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     TP +A    P  +  +  H+ ++     NP   
Sbjct: 389 KIGYLLASGDDDGTWGVWDLRQF----TPQNASTASP--VAQYQFHKGAITSISFNPLDE 442

Query: 366 WLVASAEEENILQVWKCS 383
            ++A A E+N + +W  S
Sbjct: 443 SIIAVASEDNTVTLWDLS 460

>KNAG0B02580 Chr2 (501215..502957) [1743 bp, 580 aa] {ON} Anc_7.356
           YLR196W
          Length = 580

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 11/133 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +L+ + L +  L S S DHTV LW++ +       VR+++ +HS   ++ ++WH
Sbjct: 278 HTDAVLSLAHNKLFRSVLASTSADHTVKLWDLNNA----SVVRSFDSIHSGKNVSASEWH 333

Query: 218 NFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + + DVR+N+    +   +V   +   +  F     N++      
Sbjct: 334 QSNGSILLTAGYDSRIALTDVRSNDAKNLSKYWSVSSGEEIESATFVDE--NIILCGTDT 391

Query: 274 SYVYLYDLRNMKE 286
             VY +D+RN  E
Sbjct: 392 GNVYSFDIRNNAE 404

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC-PQPFNTLAFSHHSSN 265
           HS  I D  +++ + D+  T S D+ +   D+R+ +    T        + + ++   SN
Sbjct: 114 HSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWNFKDSN 173

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  V+++DLR+   PLH ++GH   VN+++FS               +  WD
Sbjct: 174 ILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSRFEENKIMSSSNDGTVKFWD 231

Query: 325 LKQ 327
           L +
Sbjct: 232 LSK 234

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/127 (19%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+YV+ +D+R+   P +  S    + + ++++            
Sbjct: 121 INFNSQHPDILATCSIDTYVHAWDMRSPHRPFYTTSSWRSSASQVKWN-FKDSNILASSH 179

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL+      TP          +    GH S VN  D +      + S+  +  
Sbjct: 180 GNDVFIWDLRH---GSTP----------LHKLTGHNSGVNSIDFSRFEENKIMSSSNDGT 226

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 227 VKFWDLS 233

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 66/129 (51%), Gaps = 8/129 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++ +G      +RT    H   + D    + +  LF +VSED  +K 
Sbjct: 155 FITGSNDTTMKVWDLATG-----KLRTTLAGHVMTVRDIAISDRHPYLF-SVSEDKTVKC 208

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N    D         T++  H + +L+A AG DS + L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDIRT-RVPVITLVGHK 266

Query: 296 DAVNNLEFS 304
             +N ++ +
Sbjct: 267 GPINQVQCT 275

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 61/141 (43%), Gaps = 15/141 (10%)

Query: 252 QPFNT--------LAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLE 302
           QPF          + +S   S + A+AG D Y+ ++D R+ K +P   +      VN + 
Sbjct: 320 QPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVIS 379

Query: 303 FSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNP 362
           +S                 +WDL+Q     +PD+  D  P  +  +  H+ ++   + NP
Sbjct: 380 WSEKIGYLLASGDDNGLWGVWDLRQF----SPDNINDVQP--VAQYDFHKGAITSINFNP 433

Query: 363 QIPWLVASAEEENILQVWKCS 383
               ++A A E+N + +W  S
Sbjct: 434 LDDSIIAVASEDNTVTLWDLS 454

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 66/125 (52%), Gaps = 8/125 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ +G    K   + + +    I  +K H +   +F + SED L+K  D
Sbjct: 147 TGSNDTTIKIWDLATG--KLKLTLSGHIMTVKDICISKRHPY---MF-SASEDKLVKCWD 200

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H + NL+A AG DS V L+D+R  K P+  M+GH+  
Sbjct: 201 LEKNRVIRDYHGHLSGVHTVDI-HPTLNLIATAGRDSVVRLWDIRT-KLPVMTMAGHKSP 258

Query: 298 VNNLE 302
           +N ++
Sbjct: 259 INRVK 263

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 53/123 (43%), Gaps = 17/123 (13%)

Query: 267 LAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
            A    D+ + ++DL   K  L  +SGH   V ++  S               +  WDL+
Sbjct: 145 FATGSNDTTIKIWDLATGKLKLT-LSGHIMTVKDICISKRHPYMFSASED-KLVKCWDLE 202

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           +                +I  + GH S V+  D++P +  L+A+A  ++++++W     L
Sbjct: 203 K--------------NRVIRDYHGHLSGVHTVDIHPTLN-LIATAGRDSVVRLWDIRTKL 247

Query: 387 PIV 389
           P++
Sbjct: 248 PVM 250

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 78/188 (41%), Gaps = 27/188 (14%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           L+S S D T  +W++ S    +  VRT    H   + D K+   +  LF +   D  +++
Sbjct: 238 LISSSIDTTCIVWDLQS----SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRV 293

Query: 236 NDVRA----------------NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS-YVYL 278
            D+R+                ++T  D  K P     L  S    N++A   +DS  + +
Sbjct: 294 FDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALDSKSILI 353

Query: 279 YDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQ------IGAEQ 332
            D+RN   P+  + GH  AVN +++               +++ WDL +      + A +
Sbjct: 354 LDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPTSLSANE 413

Query: 333 TPDDAEDG 340
              +A DG
Sbjct: 414 NKVNANDG 421

>NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1134

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 58/120 (48%), Gaps = 4/120 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  ++  N D+  T S D+ +   D+R+ +     T       + + ++   SN
Sbjct: 112 HSRAITDINFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWNFKDSN 171

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  V+++DLRN   PL  + GHE +VN+++FS               +  WD
Sbjct: 172 ILASSHGND--VFIWDLRNGSTPLCQLVGHESSVNSIDFSRFKSTEIMSSSNDGTVKFWD 229

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/127 (20%), Positives = 56/127 (44%), Gaps = 14/127 (11%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+  + ++LA   +D+YV+ +D+R+  +P +  S    + + ++++            
Sbjct: 119 INFNPENPDILATCSIDTYVHAWDMRSPHKPFYSTSAWRSSASQVKWN-FKDSNILASSH 177

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL+            +G   L  +  GH SSVN  D +      + S+  +  
Sbjct: 178 GNDVFIWDLR------------NGSTPLCQL-VGHESSVNSIDFSRFKSTEIMSSSNDGT 224

Query: 377 LQVWKCS 383
           ++ W  S
Sbjct: 225 VKFWDYS 231

>Kpol_530.25 s530 (67445..69169) [1725 bp, 574 aa] {ON}
           (67445..69169) [1725 nt, 575 aa]
          Length = 574

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 72/156 (46%), Gaps = 13/156 (8%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-I 211
           Q     H D   +L+ +   +  L S S DHTV LW++ SG       R+   +HS+  +
Sbjct: 279 QHITTHHTDAVLSLAHNKHFRSVLASTSADHTVKLWDLNSG----TAARSIASIHSNKNV 334

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVR----ANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           + ++WH  +  +  T   DS L + DVR    +N +   +V   +      F+  S NL+
Sbjct: 335 SASEWHMSHGSILLTGGYDSRLALTDVRISDESNMSKYWSVMGGEEIEAATFA--SENLI 392

Query: 268 AAAGMDSYVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
                   VY +D+RN +  +P+  +  H+  ++ L
Sbjct: 393 LCGTDSGNVYSFDIRNNEGSKPVWTLKAHDAGISTL 428

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/230 (24%), Positives = 100/230 (43%), Gaps = 29/230 (12%)

Query: 156 LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            ++ ++N + L    L +  L++   D +V L + G+     K + +    H+  IND K
Sbjct: 8   CRYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGN----LKTISSIQ-CHTTSINDMK 62

Query: 216 WHNFNKD---LFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSNLLAAA- 270
             N + D   +F T +ED + K+ D+RA NN          PF +L   H   N+LA   
Sbjct: 63  VINSDFDTGAVFATAAEDGV-KVWDIRARNNVASLQNDKASPFFSLDSRH---NMLACGT 118

Query: 271 ---GMDSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
                D+ +++YD+RN  +P+   +  H D + +++F                + ++DL 
Sbjct: 119 ELKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLT 178

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
           Q       DD ED + ++I   + H        L P+  W ++  E   I
Sbjct: 179 Q-------DDEEDALHQVINFASIHSCGW----LGPKRIWSLSHMETFGI 217

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 100/246 (40%), Gaps = 25/246 (10%)

Query: 155 TLKFHKD-NGYALSFSTLVK-GRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDI 210
           T++ H +  GYAL +S L++ G LL+G     V   +  +    T  +P    N+     
Sbjct: 272 TIRNHGNVEGYALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKS--- 328

Query: 211 INDNKWHNFNKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLA 268
           I D +W      +F T   D  +++ D R+  +   I T       N ++++     LLA
Sbjct: 329 IEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLA 388

Query: 269 AAGMDSYVYLYDLRNMK------EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMM 322
           +   +    ++DLR         +P+     H+ A+ ++ F              N + +
Sbjct: 389 SGDDNGTWGVWDLRQFSPSNENAQPVAQYDFHKGAITSISFHPTDESIVAVASEDNTVTL 448

Query: 323 WDLKQIG-----AEQTPDDAEDGV--PELIMVHAGHRSSVNDFDLNPQIPWLVASAEEEN 375
           WDL          +QT +  E     P+L+ VH   +  V D   + QIP  + S   + 
Sbjct: 449 WDLSVEADDEEIKQQTAETKELAQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDG 506

Query: 376 ILQVWK 381
            L +WK
Sbjct: 507 -LNIWK 511

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 55/138 (39%), Gaps = 8/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S   + + A AG D Y+ ++D R+ K +P          VN + ++ 
Sbjct: 322 TVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNE 381

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q          E+  P  +  +  H+ ++     +P   
Sbjct: 382 KMGYLLASGDDNGTWGVWDLRQFSPSN-----ENAQP--VAQYDFHKGAITSISFHPTDE 434

Query: 366 WLVASAEEENILQVWKCS 383
            +VA A E+N + +W  S
Sbjct: 435 SIVAVASEDNTVTLWDLS 452

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 2/119 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC-PQPFNTLAFSHHSSN 265
           HS  I D  +H  + ++  T S D+ +   D+R+      +        + + +++ +SN
Sbjct: 113 HSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVKWNYKNSN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           ++A+A  +  VY++DLR    PLH + GH ++VN+++FS               +  WD
Sbjct: 173 VMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWD 230

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           +LA   +D+YV+ +D+R+ +   +  S      + ++++ +           N + +WDL
Sbjct: 129 ILATCSIDAYVHAWDMRSPRRAYYSASVWSAGASQVKWN-YKNSNVMASAHSNDVYIWDL 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHS 385
           ++ G   TP          + V  GH +SVN  D +      + S+  +  ++ W  S S
Sbjct: 188 RK-GC--TP----------LHVLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYSLS 234

>ZYRO0B02486g Chr2 complement(199474..201201) [1728 bp, 575 aa] {ON}
           similar to uniprot|P21304 Saccharomyces cerevisiae
           YLR196W PWP1
          Length = 575

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 72/148 (48%), Gaps = 9/148 (6%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +L+ +   +  L S S DHTV LW++ +G       R+   +HS   ++ ++WH
Sbjct: 287 HTDAILSLALNKHFRAVLASTSADHTVKLWDLNNG----TAARSLASIHSGKNVSSSEWH 342

Query: 218 NFNKDLFGTVSEDSLLKINDVR-ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS-Y 275
             N  +  T   DS + ++DVR ++ + +       P   +  S  +   +  +G DS  
Sbjct: 343 KTNGSVLLTSGYDSRVALSDVRISDESQLSKYWSVLPGEEVESSTFADENIILSGTDSGN 402

Query: 276 VYLYDLRN--MKEPLHHMSGHEDAVNNL 301
           VY +D+RN    +P+  ++ H+  ++ L
Sbjct: 403 VYAFDIRNNSGSKPVWTLNAHDAGISCL 430

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   Q    + +S   S + A+AG D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 317 TVANNQSIEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSE 376

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     +P++A  G  + +  +  H+ ++     NP   
Sbjct: 377 KLGYLLASGDDNGTWGVWDLRQF----SPENA--GSVQPVAQYDFHKGAITSISFNPLDE 430

Query: 366 WLVASAEEENILQVWKCS 383
            ++A   E+N + +W  S
Sbjct: 431 SIIAVGSEDNTVTLWDLS 448

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 158 FHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGD 195
           FHK    ++SF+ L +  +  GS+D+TV LW++    D
Sbjct: 415 FHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEAD 452

>KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa]
           {ON} Anc_4.309 YLR429W
          Length = 634

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 16/144 (11%)

Query: 168 FSTLVKGRLLSGSDDHTVALWEV----------GSGGDPT--KPVRTWNDLHSDIINDNK 215
           F    + RL SGSDD  + +W++           S GDP   KPV+     HS  +    
Sbjct: 89  FDPFNQRRLASGSDDSKIGIWDIPEDYSFHNYLDSNGDPKDIKPVKMLAG-HSRKVGHVL 147

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
           +H   +D+  + S D  +KI +V        T+K P    +++FS++ ++ LA    D  
Sbjct: 148 YHPLAQDILASSSLDYTVKIWNVETGEVLF-TLKHPDMVTSMSFSYNGAH-LATVARDKK 205

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVN 299
           + ++D+R   E +   + H  A N
Sbjct: 206 LRVWDVRK-GEVVSEGTAHAGAKN 228

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S     + A+AG D Y+ ++D R+ K +P   +      VN + +S 
Sbjct: 318 TVSNNKSIEDIQWSRTEGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSD 377

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q     +PD A    P  +  +  H+ ++     NP   
Sbjct: 378 KLGYLLASGDDNGVWGVWDLRQF----SPDTANSVQP--VAQYDFHKGAITSISFNPLDE 431

Query: 366 WLVASAEEENILQVWKCS 383
            +VA A E+N + +W  S
Sbjct: 432 SIVAVASEDNTVTLWDLS 449

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 87/421 (20%), Positives = 166/421 (39%), Gaps = 56/421 (13%)

Query: 6   KPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELI-IGTH 64
           +PL  DE  +      P +Y+ +    + WP LT+  +P  +      + +  L+   T 
Sbjct: 101 RPLGPDEVLEA----DPTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQ 156

Query: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124
            S ++EN L    ++   + L NED +++  E+ + +    +  +         +   R 
Sbjct: 157 ASKKKENELMVLSLSNLTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRL 216

Query: 125 RYMP----QDPNIVATINGQGTVFLYS---RSEGLQS--------------TLKFHKD-N 162
           +  P        + AT++  G V+++    +S+   +              T+K H +  
Sbjct: 217 KVSPFANSSKEVLTATMSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVE 276

Query: 163 GYALSFS-TLVKGRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNF 219
           GYAL +S ++  G LL+G     +   +  +    T  +P    N+     I D +W   
Sbjct: 277 GYALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKS---IEDIQWSRT 333

Query: 220 NKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVY 277
              +F +   D  ++I D R+  +   I         N +++S     LLA+   +    
Sbjct: 334 EGTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWG 393

Query: 278 LYDLR-------NMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL----- 325
           ++DLR       N  +P+     H+ A+ ++ F+             N + +WDL     
Sbjct: 394 VWDLRQFSPDTANSVQPVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEAD 453

Query: 326 ----KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
               KQ  AE    + +   P+L+ VH   +  V D   + QIP  + S   +  L +WK
Sbjct: 454 DEEIKQQAAETK--ELQQIPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDG-LNIWK 508

Query: 382 C 382
            
Sbjct: 509 T 509

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 78/386 (20%), Positives = 152/386 (39%), Gaps = 74/386 (19%)

Query: 22  PLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII-GTHTSGEEENYLKFAEINL 80
           P +Y+ +    + WP +T+  +P  +      + +  L+   T  S +++N L   +++ 
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 81  PKEILSNEDPQEEAGEEYQSSLPAP---RSNIRITAKYEHEEEITRARYMPQDPNIVATI 137
             + L+ ED  E+  EE       P     NI++       +    A        + AT+
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTATM 241

Query: 138 NGQGTVFLYSRSEGLQS-----------------TLKFHKD-NGYALSFSTLVK-GRLLS 178
           +  G V+++  +  +++                 T+K H +  GYAL +S L+K G LL+
Sbjct: 242 SENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGALLT 301

Query: 179 GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV 238
           G     V L                   H+     +KW + +K+ F              
Sbjct: 302 GDCSGQVYL----------------TQRHT-----SKWIS-DKEPFTV------------ 327

Query: 239 RANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDA 297
            ANN +++ ++         +S   S + A+ G D Y+ ++D R+ K +P   +      
Sbjct: 328 -ANNQSVEDIQ---------WSRTESTVFASCGCDGYIRVWDTRSKKHKPAISVKASNTD 377

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           VN + +S                 +WDL+Q     +P ++ +  P  +  +  H+ ++  
Sbjct: 378 VNVISWSEKIGYLLASGDDNGTWGVWDLRQF----SPSNSNNTSP--VAQYDFHKGAITS 431

Query: 358 FDLNPQIPWLVASAEEENILQVWKCS 383
              NP    +VA A E+N + +W  S
Sbjct: 432 ISFNPLDESIVAVASEDNTVTLWDLS 457

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDL-HSDIINDNKWH 217
           H D   +L+ + L +  L S S D TV LW++ SG       R+ N + H   ++ ++WH
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSG----TAARSLNQVHHGSRVSSSQWH 347

Query: 218 NFNKDLFGTVSEDSLLKINDVR----ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             +  +  T   DS + + DVR     N +    V   +   T +F +  + L   AG D
Sbjct: 348 QTDGSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVL---AGTD 404

Query: 274 S-YVYLYDLRNMK-EPLHHMSGHEDAVNNL 301
           +  VY +D+R+++ +PL  +  H+  +  L
Sbjct: 405 NGNVYSFDVRSVESKPLWTLKAHDAGIAGL 434

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 83/399 (20%), Positives = 163/399 (40%), Gaps = 46/399 (11%)

Query: 24  MYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII-GTHTSGEEENYLKFAEINLPK 82
           +Y+ +    L+WP +++  +P  +      + +  L+   T  S +++N L   +++   
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 83  EILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPN-----IVATI 137
           + L  ED  +   E+ +         I   A     +   R +  P   N     + AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 138 NGQGTVFLYSRSEGLQS-----------------TLKFHKD-NGYALSFSTLVK-GRLLS 178
           +  G V+++     ++S                 T++ H +  G+ L +S L+K G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 179 GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV 238
           G     + L    +    T+  ++++  ++  I D +W    + +F T   D  ++I D 
Sbjct: 309 GDCSGEIFLTSRHTSKWITEK-QSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDT 367

Query: 239 RA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVY-LYDLRNMK------EPLH 289
           R+  +   I T       N ++++     LL A+G D  V+ ++DLR          P+ 
Sbjct: 368 RSKKHKPAISTRASNVDVNVISWNEKMEYLL-ASGDDKGVWGVWDLRQFSPSQENASPVA 426

Query: 290 HMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIG-----AEQTPD--DAEDGVP 342
               H+ A+ ++ F+             N + +WDL          +QT +  + E   P
Sbjct: 427 QYDFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQIPP 486

Query: 343 ELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           +L+ VH   +  V D   + QIP  + S   +  L VWK
Sbjct: 487 QLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDG-LNVWK 522

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 51/128 (39%), Gaps = 8/128 (6%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXXXXXXX 315
           + +S     + A AG D Y+ ++D R+ K +P          VN + ++           
Sbjct: 343 IQWSKTEQTVFATAGCDGYIRIWDTRSKKHKPAISTRASNVDVNVISWNEKMEYLLASGD 402

Query: 316 XXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEEN 375
                 +WDL+Q    Q     E+  P  +  +  H+ ++     NP     VA A E+N
Sbjct: 403 DKGVWGVWDLRQFSPSQ-----ENASP--VAQYDFHKGAITSISFNPLDESTVAVASEDN 455

Query: 376 ILQVWKCS 383
            + +W  S
Sbjct: 456 TVTLWDLS 463

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 57/133 (42%), Gaps = 7/133 (5%)

Query: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXX 310
           Q    + FS   + + A  G D Y+ ++D R+ K +P   +      VN + ++      
Sbjct: 334 QSIEDIQFSRTEATVFATCGCDGYIRIWDTRSKKHKPAISVKASSTDVNVISWNEKIGYL 393

Query: 311 XXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVAS 370
                      +WDL+Q     +P++A    P  +  ++ H+ ++     NP    ++A 
Sbjct: 394 LASGDDNGTWGVWDLRQF----SPNNAASVSP--VAQYSFHKGAITSIAFNPLDDSIIAV 447

Query: 371 AEEENILQVWKCS 383
           A E+N + +W  S
Sbjct: 448 ASEDNTVTLWDLS 460

>Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 67/129 (51%), Gaps = 8/129 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++ +G      ++T    H   + D    + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLATG-----KLKTTLAGHVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N+   D         T++  H + +L+A AG DS V L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNHIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RMPVITLVGHK 266

Query: 296 DAVNNLEFS 304
             +N ++ +
Sbjct: 267 GPINQVQCT 275

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 66/129 (51%), Gaps = 8/129 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++ +G      ++T    H   + D    + +  LF +VSED  +K 
Sbjct: 155 FITGSNDTTMKVWDLATG-----KLKTTLAGHVMTVRDVAVSDRHPYLF-SVSEDKTVKC 208

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N    D         T++  H + +L+A AG DS + L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNQIIRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDMRT-RIPVITLVGHK 266

Query: 296 DAVNNLEFS 304
             +N ++ +
Sbjct: 267 GPINQVQCT 275

>NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON}
           Anc_7.356 YLR196W
          Length = 581

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 72/150 (48%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +LS +   +  L S S DHTV LW++ +G    +  R+   +HS   ++ ++WH
Sbjct: 290 HTDAILSLSHNKQFRAVLASTSADHTVKLWDLNNG----QTARSLASVHSGKNVSASEWH 345

Query: 218 NFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + ++DVR +N    +   +V   +      F++   N++      
Sbjct: 346 PTNGSILLTGGYDSRVALSDVRISNEKEMSKYWSVMSGEEIECTTFANE--NIILCGTDS 403

Query: 274 SYVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
             +Y +D+RN +  +P+  +  H+  ++ L
Sbjct: 404 GNIYSFDIRNNENSKPVWTLKAHDAGISTL 433

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 74/330 (22%), Positives = 129/330 (39%), Gaps = 46/330 (13%)

Query: 23  LMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTHTSGEEENYLKFAEINLPK 82
           L +D V+E  +T+P  T+QW P+             L I +    EEE  L+  +INL  
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATCSDSLRIWSFC--EEERNLQ-EQINLS- 205

Query: 83  EILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHE-----EEITRARYMPQDPNIV--A 135
             L   D Q++      ++     S IR   + +         IT   + P DPN++  +
Sbjct: 206 --LCKYDKQQQGASRVNAAAGGSGS-IRTNPQQQQGLIGELPPITSFHWNPVDPNLLISS 262

Query: 136 TINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGD 195
           +I+    V+    S  +++ L  H    Y + F T       S   D +V ++++     
Sbjct: 263 SIDTTCIVWDLQSSNYVRTQLIAHDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLA- 321

Query: 196 PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC-PQPF 254
                      HS II +            T+   +    +    ++T +  ++  P PF
Sbjct: 322 -----------HSTIIYEPP------SSPATLQPTTAAGSSSAADSDTGVPLLRLEPSPF 364

Query: 255 NTLAFSHHSSNLLAAAGMDS-YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXX 313
           +         N++A   +DS  V + D+RN   P+  + GH  AVN + +          
Sbjct: 365 D--------PNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMRWHPSKRNVLLS 416

Query: 314 XXXXNRLMMWDLKQ--IG--AEQTPDDAED 339
                +++ WDL    +G   +Q PD A D
Sbjct: 417 CADDCQVLYWDLNNYIMGHPTDQDPDHAVD 446

>TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa]
           {ON} Anc_8.288 YDR128W
          Length = 1178

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 4/123 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  + D  ++  + DL  T S D+ +   D+R+ N     T       + + +++  SN
Sbjct: 113 HSRAVTDITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWNYKQSN 172

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA+A G D  V ++DLR    PL+ +S H  +VNN++F+ H             +  WD
Sbjct: 173 ILASAQGND--VCIWDLRMGSTPLYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGTVKFWD 230

Query: 325 LKQ 327
             +
Sbjct: 231 YSK 233

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/129 (19%), Positives = 57/129 (44%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    +LLA   +D+Y++ +D+R+   P +  +      + ++++ +          
Sbjct: 120 ITFNFDHPDLLATCSIDTYIHAWDMRSPNRPFYTTTDWHSGASQVQWN-YKQSNILASAQ 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL+ +G+  TP          +   + H  SVN+ D N      + ++  +  
Sbjct: 179 GNDVCIWDLR-MGS--TP----------LYKLSDHSGSVNNIDFNKHRGTEIMTSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSKS 234

>CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P21304 Saccharomyces
           cerevisiae YLR196w PWP1
          Length = 583

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +L+ +   +  L S S DHTV LW++ +        R+  ++HS+  ++ ++WH
Sbjct: 289 HTDAVLSLAHNRQFRTVLASTSADHTVKLWDLNNA----TAARSMANIHSNKNVSSSQWH 344

Query: 218 NFNKDLFGTVSEDSLLKINDVR----ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS   + DVR    A  +   +V   +   T  F+  S N++      
Sbjct: 345 MQNASILLTAGYDSRAALTDVRISDEAQMSKYWSVLPGEEIETATFA--SENIILCGTDA 402

Query: 274 SYVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
             VY +D+RN +  +P+  +  H+  +++L
Sbjct: 403 GNVYSFDIRNNEGSKPVWTLKAHDAGISSL 432

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 8/129 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++ SG      ++     H   + D    + +  LF +VSED  +K 
Sbjct: 155 FVTGSNDTTMKVWDLASG-----KLKVTLTGHVMTVRDIAVSDRHPYLF-SVSEDKTVKC 208

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N    D         T++  H + +L+A AG DS V L+D+R  + P+  + GH+
Sbjct: 209 WDLEKNQIIRDYHGHLSGVRTVSI-HPTLDLIATAGRDSVVKLWDIRT-RVPVITLVGHK 266

Query: 296 DAVNNLEFS 304
             +N +E +
Sbjct: 267 GPINQVECA 275

>TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.356
           YLR196W
          Length = 563

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +L+ +   +  L S S DHTV LW++ S        R+   +HS   ++ ++WH
Sbjct: 271 HTDAVLSLTHNKQFRSVLASTSADHTVKLWDLNSA----TAARSMASIHSGKNVSSSEWH 326

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTID----TVKCPQPFNTLAFSHHSSNLLAAAGMD 273
             N  +  T   DS + ++DVR  + T      +V   +   T+ F+    N++      
Sbjct: 327 TTNGSVLLTGGYDSRIALSDVRIPDETKMSKYWSVVPGEDVETVTFADE--NIMLCGTDS 384

Query: 274 SYVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
             +Y +D+RN +  +P+  +  H+  +++L
Sbjct: 385 GNIYSFDIRNNENSKPVWTLKAHDAGISSL 414

>TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {ON}
           Anc_7.356 YLR196W
          Length = 582

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 72/156 (46%), Gaps = 13/156 (8%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-I 211
           Q     H D   +LS +   +  L S S DHTV +W++ SG       R+   +H++  +
Sbjct: 283 QHITTHHTDAILSLSHNKHFRSVLASTSADHTVKIWDLNSG----DAARSLASIHNNTNV 338

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLL 267
           + ++WH  N  +  T   DS + ++DVR ++    +   +V   +   T  F+    N++
Sbjct: 339 SSSEWHWTNGSILLTSGYDSRVALSDVRISDESQMSKYWSVMGGEDIETATFADE--NII 396

Query: 268 AAAGMDSYVYLYDLRN--MKEPLHHMSGHEDAVNNL 301
                   VY +D+RN    +P+  +  H+  ++ L
Sbjct: 397 LCGTDAGNVYSFDVRNGDASKPVWTLKAHDAGISTL 432

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 7/133 (5%)

Query: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXX 310
           Q    + FS   + + A+ G D Y+ ++D R+ K +P   +      VN + ++      
Sbjct: 333 QSIEDIQFSRTEATVFASCGCDGYIRIWDTRSKKHKPAISVKASATDVNVISWNEKIGYL 392

Query: 311 XXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVAS 370
                      +WDL+Q     +P+ A    P  +  +  H+ ++     NP    ++A 
Sbjct: 393 LASGDDNGSWGVWDLRQF----SPNTAASTSP--VAQYNFHKGAITSISFNPLDDSIIAV 446

Query: 371 AEEENILQVWKCS 383
           A E+N + +W  S
Sbjct: 447 ASEDNTVSLWDLS 459

>Kwal_56.24399 s56 (981153..982262) [1110 bp, 369 aa] {ON} [contig
           163] FULL
          Length = 369

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 74/149 (49%), Gaps = 12/149 (8%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHN 218
           H+ +    +F TL   R ++GS D  +AL ++ +G    + +R +   H+ ++N  +   
Sbjct: 117 HRRSAAITTFDTLDDTRAVTGSSDTRLALVDLHTG----RKLRNFAG-HTRVVNQVR--A 169

Query: 219 FNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSS--NLLAAAGMDSYV 276
            N D F +VS+D  LKI D     + +  +    P  TL  S  SS  N+L  +G+D  +
Sbjct: 170 LNTDRFASVSDDGALKIWDAH-TKSPVWQISSEFPLFTLTSSSSSSDDNILYTSGLDPVI 228

Query: 277 YLYDLR--NMKEPLHHMSGHEDAVNNLEF 303
             YDLR  N +E  +  + H D+V ++  
Sbjct: 229 RAYDLRQNNGQELFNWSTPHTDSVTSIHI 257

>Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]
           {ON} YNL317W (PFS2) - Polyadenylation Factor I subunit
           [contig 124] FULL
          Length = 451

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/219 (21%), Positives = 89/219 (40%), Gaps = 22/219 (10%)

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLF 224
            +SFS     + ++ SDD+ + +W   +G   +    T +  H D+     WH     L 
Sbjct: 172 GISFSG-TDSKFVTCSDDNILKIWNFSNGQQES----TLSGHHWDV-RSCDWHP-TMGLI 224

Query: 225 GTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-N 283
            + S+D+L+K+ D RA       + C     +  F     N+LA    D    ++D+R N
Sbjct: 225 ASGSKDNLVKLWDPRAGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRIFDIRQN 284

Query: 284 MKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD--LKQIGAEQTPDDAEDGV 341
           MKE    ++ + D  + +  + H             +  +D  +K     Q P D+  G 
Sbjct: 285 MKE----LAVYRDESDYMSLTWHPINESMFT-----VGCYDGSMKHFDLLQEPQDSSSGC 335

Query: 342 PELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVW 380
                +   H   +     NP +  ++ASA ++  ++ W
Sbjct: 336 --FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFW 371

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 63/124 (50%), Gaps = 8/124 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ SG      ++     H+  + D    N +  LF + SED L K  D
Sbjct: 129 TGSNDTTIKIWDLASG-----KLKITLSGHAMTVRDIAISNRHPYLF-SASEDKLAKCWD 182

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H + +L+A AG DS V L+D+R+ + P+  + GH+  
Sbjct: 183 LEKNTAIRDYHGHLSGVHTVDI-HPTLDLIATAGRDSVVKLWDIRS-RVPVVTLIGHKSP 240

Query: 298 VNNL 301
           +N +
Sbjct: 241 INKV 244

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 58/134 (43%), Gaps = 20/134 (14%)

Query: 267 LAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
            A    D+ + ++DL + K  +  +SGH   V ++  S +                WDL+
Sbjct: 127 FATGSNDTTIKIWDLASGKLKIT-LSGHAMTVRDIAIS-NRHPYLFSASEDKLAKCWDLE 184

Query: 327 QIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           +  A              I  + GH S V+  D++P +  L+A+A  ++++++W     +
Sbjct: 185 KNTA--------------IRDYHGHLSGVHTVDIHPTLD-LIATAGRDSVVKLWDIRSRV 229

Query: 387 PIV---GGPPKVNK 397
           P+V   G    +NK
Sbjct: 230 PVVTLIGHKSPINK 243

>KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} similar
           to uniprot|P21304 Saccharomyces cerevisiae YLR196W PWP1
          Length = 579

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 77/155 (49%), Gaps = 15/155 (9%)

Query: 155 TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-IND 213
            L  H D   +L+ S   +  L S S DHTV LW++  G       R+   +HS+  ++ 
Sbjct: 288 VLTHHTDAVLSLAHSKQFRAVLASTSADHTVKLWDLNEG----IAARSVASIHSNKNVSS 343

Query: 214 NKWHNFNKDLFGTVSEDSLLKINDVR-ANNTTID---TVKCPQPFNTLAFSHHSSNLLAA 269
           ++WH+ +  +  T   DS + ++DVR A ++ +    +V   +    + F+  ++ +   
Sbjct: 344 SQWHSTSGSVLLTGGYDSRVALSDVRIAEDSQMSKYWSVMTGEDVECVQFADENTFM--- 400

Query: 270 AGMDS-YVYLYDLRNMK--EPLHHMSGHEDAVNNL 301
            G DS  VY +D+R  +  +PL  ++ H+  ++ L
Sbjct: 401 CGTDSGNVYSFDIRQGEGSKPLWTLNAHDAGISAL 435

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/204 (25%), Positives = 97/204 (47%), Gaps = 25/204 (12%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W+  SG    K   + + +    +  +K H +   +F + SED L+K  D
Sbjct: 126 TGSNDSTIKVWDFASG--KLKLTLSGHVMGVRDLVVSKRHPY---MF-SASEDKLVKCWD 179

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H + +L+A+AG DS V L+D+R+ K+ +  + GH+  
Sbjct: 180 LEKNAPIRDYFGHLSGVHTVDI-HPTLSLIASAGRDSVVKLWDIRS-KKAVITLVGHKSP 237

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           +N+++  T              ++ WDL  + A+          P  ++ H  HR +V D
Sbjct: 238 INSVK-CTPADPQIISCSNDTTVITWDL--VAAK----------PMKVITH--HRKAVRD 282

Query: 358 FDLNPQIPWLVASAEEENILQVWK 381
             ++P   + VAS    +I + WK
Sbjct: 283 IAVHPG-EFSVASCSTNDI-RSWK 304

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 87/223 (39%), Gaps = 18/223 (8%)

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLF 224
            +SFS     + ++ SDD+ + +W   +G   +    T    H D+     WH     L 
Sbjct: 172 GISFSG-TDSKFVTCSDDNILKIWNFSNGQQES----TLTGHHWDV-RSCDWHP-TMGLI 224

Query: 225 GTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-N 283
            + S+D+L+K+ D R+       + C     +  F     N+LA    D    ++D+R N
Sbjct: 225 ASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFDIRQN 284

Query: 284 MKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPE 343
           MKE    ++ + D  + +  + H               M   K     Q P D+  G   
Sbjct: 285 MKE----LAVYRDESDYMSLTWHPINESIFTVGCYDGSM---KHFDLMQEPQDSSSGC-- 335

Query: 344 LIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
              +   H   +     NP +  ++ASA ++  ++ W  S  L
Sbjct: 336 FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPL 377

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 59/268 (22%), Positives = 105/268 (39%), Gaps = 56/268 (20%)

Query: 128 PQDPNIVATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVA 186
           P D   +A+ +  GT+ ++  +  +   TL  H ++   + +    +G L SGS D T+ 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRVCLFTLSGHTNSVSCVKWGG--RGVLYSGSHDKTIR 301

Query: 187 LWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTID 246
            W++ +GG     +++    H+  IN             ++S D  L++    A + T  
Sbjct: 302 AWDMNAGGKCINILKS----HAHWINHL-----------SLSTDYALRVG---AFDHTGK 343

Query: 247 TVKCPQPFNTLAFSHHSS---------NLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
               P+     A  ++            L+  A  D  +YL+D     +P+  M+GH+  
Sbjct: 344 KPSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKL 403

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           VN++ FS             N + +W            D  DG    I    GH +SV  
Sbjct: 404 VNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASVY- 447

Query: 358 FDLNPQIPW-----LVASAEEENILQVW 380
                Q+ W     L+ S  ++  L+VW
Sbjct: 448 -----QVAWSSDCRLLVSCSKDTTLKVW 470

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKC-PQPFNTLAFSHHSSN 265
           HS  I D  +H  N ++  T S D+ +   D+R++     +          + ++  + N
Sbjct: 113 HSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRRAFYSASVWSAGAAQVKWNFKNPN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           ++A+A  +  ++++DLR    PLH + GH ++VN+++FS               +  WD
Sbjct: 173 VMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWD 230

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 5/76 (6%)

Query: 129 QDPNIVATINGQGTVFLYSRSEGLQ--STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVA 186
           ++PN++A+ +    +F++   +G      LK H ++  ++ FS   +  ++S S+D TV 
Sbjct: 169 KNPNVMASAHSND-IFIWDLRKGCMPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVK 227

Query: 187 LWEVGSGGDPTKPVRT 202
            W+     +  +P+RT
Sbjct: 228 FWDYSV--NDKEPLRT 241

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/255 (21%), Positives = 113/255 (44%), Gaps = 38/255 (14%)

Query: 161 DNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
           D G + +  TLVK +  +GS++ ++ L  V + G P + +RT +   + + +  ++  F+
Sbjct: 187 DFGLSENLETLVKSQS-NGSEEDSI-LKIVDNAGKPGEVLRTMHVPGTTVTHTVRF--FD 242

Query: 221 KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLAAAGMDSYVYL 278
              FG+ S+D+ ++  D+R  +  I ++  P+     AF  S  ++ L         + L
Sbjct: 243 NYTFGSCSDDNTIRFWDIRTADKPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGVIKL 302

Query: 279 YDLRNMK----EPLHHMSGHE--------------DAVNNLEFSTHXXXXXXXXXXXNRL 320
           +D+R+++    +  H  +GH+              D+V +++FS               +
Sbjct: 303 WDIRSVEFATTDLTHRQNGHDPIQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGSGNV 362

Query: 321 MMWDLKQIGAEQTPDDAEDG----VPE------LIMVHAGH----RSSVNDFDLNPQIPW 366
             WD++   ++   DDA        PE      L   H G+    R+  N    +P I  
Sbjct: 363 YHWDMEFFFSQNDDDDAGATAKLPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPTIDD 422

Query: 367 LVASAEEENILQVWK 381
           LV + ++ +++ V+K
Sbjct: 423 LVCTVDDTSLISVYK 437

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 100/239 (41%), Gaps = 27/239 (11%)

Query: 163 GYALSFSTLVK-GRLLSGSDDHTVALWEVGSGGDPT--KPVRTWNDLHSDIINDNKWHNF 219
           GY L +S L+K G +L+G     V L +  +    T  +P    N+     I D +W   
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQPFTVGNNKS---IEDIQWSRA 343

Query: 220 NKDLFGTVSEDSLLKINDVRA--NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVY 277
              +F T   D  ++I D R+  +   +  +      N ++++     LL A+G DS  +
Sbjct: 344 EMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLL-ASGDDSGTW 402

Query: 278 -LYDLRNMKE-------PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIG 329
            ++DLR           P+   + H+ A+ ++ F+             N + +WDL    
Sbjct: 403 GVWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEA 462

Query: 330 -----AEQTPDDAE--DGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWK 381
                 +QT + AE     P+L+ VH   +  V D   + QIP  + S   +  L +WK
Sbjct: 463 DDEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDG-LNIWK 518

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 59/138 (42%), Gaps = 7/138 (5%)

Query: 247 TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFST 305
           TV   +    + +S     + A  G+D ++ ++D R+ K +P   +   +  VN + ++ 
Sbjct: 328 TVGNNKSIEDIQWSRAEMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNE 387

Query: 306 HXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIP 365
                           +WDL+Q  A+ T    E   P  +  +  H++++     NP   
Sbjct: 388 KIGYLLASGDDSGTWGVWDLRQFSAQNT----EKTTP--VAQYNFHKAAITSISFNPLDE 441

Query: 366 WLVASAEEENILQVWKCS 383
            ++A A E+N + +W  S
Sbjct: 442 SIIAVASEDNTVTLWDLS 459

>KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1120

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 55/122 (45%), Gaps = 2/122 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  +   + D+  T S D+ +   D+R+       T         + ++H   N
Sbjct: 113 HSRAITDINFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWNHSDVN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           ++A++  D  V+++DLRN   PL  +S HE +VN+++F+               +  WD 
Sbjct: 173 IMASSHGDD-VFIWDLRNGSTPLFKLSSHESSVNSIDFNRFRSTEIMSSSNDGTVKFWDY 231

Query: 326 KQ 327
            +
Sbjct: 232 SR 233

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 58/130 (44%), Gaps = 14/130 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + FS    ++LA   +D+YV+ +D+R+ + P +  S  + +   ++++ H          
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDMRSPQRPFYSTSSWKSSAAQVKWN-HSDVNIMASSH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            + + +WDL+            +G   L  + + H SSVN  D N      + S+  +  
Sbjct: 179 GDDVFIWDLR------------NGSTPLFKL-SSHESSVNSIDFNRFRSTEIMSSSNDGT 225

Query: 377 LQVWKCSHSL 386
           ++ W  S ++
Sbjct: 226 VKFWDYSRNV 235

>Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar to
           Ashbya gossypii AAR078W
          Length = 603

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 27/163 (16%)

Query: 153 QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSD-II 211
           Q     H D   +LS +   +  L S S D T+ LW++  G      VR+   +H+   +
Sbjct: 303 QHITTHHTDAVLSLSHNKQYRVVLASTSADQTIKLWDLNQG----TAVRSIASIHNGTTV 358

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANN----------TTIDTVKCPQPFNTLAFSH 261
           + ++WH  +  +  T + DS + ++DVR +N           T + V+C    N   F  
Sbjct: 359 SSSQWHPSDGSIILTGAYDSRVALSDVRISNDSEMSKYWSVMTGEEVECVSFVNDNEF-- 416

Query: 262 HSSNLLAAAGMDS-YVYLYDLRNMKE--PLHHMSGHEDAVNNL 301
                   AG DS  +Y +DLRN ++  PL  +  H+  ++++
Sbjct: 417 -------LAGTDSGNIYSFDLRNGEKSSPLWTLKAHDSGISSM 452

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 103/239 (43%), Gaps = 41/239 (17%)

Query: 156 LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            + H D   ALSF +     L+SGS D  +  W++ +G    K V+  + + +   ND K
Sbjct: 422 FELHSDEITALSFDSEA---LISGSKDRKILHWDLVTG----KCVQQLDLIVTPTYNDTK 474

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
                      VS  S        ANN+T   +    P       ++S+  LA+   D  
Sbjct: 475 -----------VSARS--------ANNST-SVLGSEAPMIGALQCYNSA--LASGTKDGV 512

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D + +L+F +            N + +WDL+      + A
Sbjct: 513 VRLWDLR-IGKPVRALEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSIIDVIA 568

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIV 389
              P  + D   +LI V A + + VN F++     W+  + E  N L+  + S  + IV
Sbjct: 569 YDLPITSLDFDDKLITVGA-NETGVNVFNMERDEHWM--TPEPPNSLKGDEASERIAIV 624

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 15/170 (8%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           L+S S D T  +W++ S    +  V+T    H   + D ++   +  LF +   D  +++
Sbjct: 248 LISSSIDTTCIVWDLQS----SNYVKTQLIAHDSEVYDVRFLTQSTQLFASCGGDGSVRV 303

Query: 236 NDVR--ANNTTI------DTVKCPQPFNTLAF--SHHSSNLLAAAGMDS-YVYLYDLRNM 284
            D+R  A++T I      D       F  L    S H  N++A    DS  + + D+RN 
Sbjct: 304 FDLRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSPHDPNVMATFAADSNKILILDMRNP 363

Query: 285 KEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTP 334
           + PL  + GH  +VN +++               +++ WDL +  A   P
Sbjct: 364 ESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQVLYWDLNKCTASSDP 413

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 35/88 (39%), Gaps = 3/88 (3%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKF---HKDNGYALSFSTLVKGRLL 177
           + R    P DPN++AT        L       +S L     H  +   + +  + +  LL
Sbjct: 332 LLRLEPSPHDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLL 391

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWND 205
           SG DD  V  W++      + PV T  D
Sbjct: 392 SGGDDCQVLYWDLNKCTASSDPVATTKD 419

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/217 (24%), Positives = 88/217 (40%), Gaps = 39/217 (17%)

Query: 156 LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            + HKD   ALSF +     L+SGS D  +  W++ +G    +    +   HSDI    +
Sbjct: 420 FELHKDEITALSFDSEA---LVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPAR 476

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
             N    L GT +                I  ++C   +N+          LA    D  
Sbjct: 477 SLNNGACLLGTEAP--------------MIGALQC---YNSA---------LATGTKDGI 510

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D + +L+F +            N + +WDL+      + A
Sbjct: 511 VRLWDLR-VGKPVRLLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSILDVIA 566

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWL 367
              P  + D   +LI V A +   VN F++     W+
Sbjct: 567 YDLPVSSLDFDGKLITVGA-NEGGVNVFNMERDEHWM 602

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 58/239 (24%), Positives = 95/239 (39%), Gaps = 41/239 (17%)

Query: 156 LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            + H D   ALSF +     L+SGS D  +  W++ +G    K V+  N + +   ND K
Sbjct: 423 FELHNDEITALSFDSEA---LISGSKDKKIFHWDLATG----KCVQELNLIFTPTHNDTK 475

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
                                  R+       +    P       ++S+  LA    D  
Sbjct: 476 --------------------TSTRSGKNGTYLLGTEAPMIGALQCYNSA--LATGTKDGV 513

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D + +L+F +            N + +WDL+      + A
Sbjct: 514 VRLWDLR-IGKPVRSLEGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSIVDVIA 569

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHSLPIV 389
              P  + D   +LI V A  R  VN F++     W+  + E  N L+  + S  + IV
Sbjct: 570 YDLPVTSLDFDDKLITVGANER-GVNIFNMERDEHWM--TPEPPNSLKRDELSERIAIV 625

>Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C
           (PRP46) - pre-mRNA splicing factor [contig 67] FULL
          Length = 433

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 65/125 (52%), Gaps = 8/125 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ SG    K   T + +    +  ++ H     L  + SED ++K  D
Sbjct: 139 TGSNDTTIKVWDMASG--KLKLTLTGHVMTVRSVAVSQRH----PLMFSASEDKMVKCWD 192

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        NT+   H + +L+A+AG D+ V L+D+R  + P+  ++GH+  
Sbjct: 193 LERNAAIRDYHGHFSGVNTVDV-HPTLDLIASAGRDAVVRLWDIRT-RLPVMTLAGHKSP 250

Query: 298 VNNLE 302
           +N ++
Sbjct: 251 INQVK 255

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 58/140 (41%), Gaps = 25/140 (17%)

Query: 250 CPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXX 309
           CP P +   F        A    D+ + ++D+ + K  L  ++GH   V ++  S     
Sbjct: 128 CPDPVDNAWF--------ATGSNDTTIKVWDMASGKLKLT-LTGHVMTVRSVAVS-QRHP 177

Query: 310 XXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVA 369
                     +  WDL++  A              I  + GH S VN  D++P +  L+A
Sbjct: 178 LMFSASEDKMVKCWDLERNAA--------------IRDYHGHFSGVNTVDVHPTLD-LIA 222

Query: 370 SAEEENILQVWKCSHSLPIV 389
           SA  + ++++W     LP++
Sbjct: 223 SAGRDAVVRLWDIRTRLPVM 242

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 110/274 (40%), Gaps = 72/274 (26%)

Query: 77  EINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAK-------YEHEEEITRARYMPQ 129
           E  LP+ +     P E A  EY  +L A +   R+ A+       Y H + +        
Sbjct: 21  ESQLPRNLDPELHPFERA-REYTKALNATKIE-RMFAQPFVGQLGYGHRDGVYAVAKHYH 78

Query: 130 DPNIVATINGQGTVFLY--SRSEGLQSTLKFHKDNGYALSFSTLVKGR------LLSGSD 181
           D N +AT +G G V  +  S SE L S  K H      L  S ++  +      +LS  D
Sbjct: 79  DLNKMATGSGDGVVKFWNMSSSEELCS-FKAHYGIVTGLCVSPVLASKNKNLQYMLSCGD 137

Query: 182 DHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN-KDLFGTVSED-SLLKINDVR 239
           D TV LW V +            D ++D+ +D    N N + L  T   D S   I+  R
Sbjct: 138 DKTVKLWSVDT------------DDYADVKDD---QNLNTRGLLKTFYGDHSFQGIDHHR 182

Query: 240 ANNTTI---------DTVKCPQPFN---------TLAFSHHSSNLLAAAGMDSYVYLYDL 281
           +N+  +         DT +     N         ++ F+ + SN+LA+ G D+ + LYDL
Sbjct: 183 SNSAFVTGGAQIQLWDTSRSKSTSNLSWGADNITSVKFNQNDSNILASTGSDNSIVLYDL 242

Query: 282 R-------------------NMKEPLHHMSGHED 296
           R                   N  EP + ++G+ED
Sbjct: 243 RTNSPTQKIVQQMRTNSLCWNPMEPFNFVTGNED 276

>SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1140

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           H   I D  +H  + ++  T S D+ +   D+R+       T +     + + ++  +SN
Sbjct: 113 HFRAITDINFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWNFRNSN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           ++A++  D +V ++DLR    PL+ + GHE +VNN++F+               +  WD
Sbjct: 173 IMASSHSD-HVCIWDLRKGCTPLYTLQGHEGSVNNIDFNKAKETEIMSSSNDGTVKFWD 230

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 53/129 (41%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F  H   +LA   +D+YV  +D+R+ + P +  S      + ++++            
Sbjct: 120 INFHPHHPEILATCSVDTYVLAWDMRSPQRPYYSTSEWRAGASQVKWN-FRNSNIMASSH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            + + +WDL++            G   L  +  GH  SVN+ D N      + S+  +  
Sbjct: 179 SDHVCIWDLRK------------GCTPLYTLQ-GHEGSVNNIDFNKAKETEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSVS 234

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 92/204 (45%), Gaps = 25/204 (12%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D ++ +W++ SG      ++     H   + D      +  +F + SED  +K  D
Sbjct: 140 TGSNDTSIKVWDLASG-----KLKLTLSGHIMTVRDLAISERHPYMF-SASEDKTIKCWD 193

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    +        +T++  H + +L+ +AG DS V L+D+R  + P+ ++ GH+  
Sbjct: 194 LEKNMVIRNYHGHLSGVHTVSL-HPTLDLVVSAGRDSVVKLWDMRT-RVPVMNLIGHKSP 251

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           +N +                N + +WD+              G    I+ H  H+ SV D
Sbjct: 252 INKVRCLPVDPQIISCSTDAN-IRLWDITA------------GKSAKILTH--HKRSVRD 296

Query: 358 FDLNPQIPWLVASAEEENILQVWK 381
           F L+P   + +ASA  ++I + WK
Sbjct: 297 FALHPS-EFSMASACTDDI-RSWK 318

>KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 437

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 8/125 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ SG            + S  I+          L  + SED L+K  D
Sbjct: 143 TGSNDTTIKVWDLASGKLKLTLAGHVMTVRSIAISQRH------PLMFSASEDKLVKCWD 196

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H + +L+A+AG D+ V L+D+R  + P+  ++GH+  
Sbjct: 197 LEKNTVVRDYHGHFSGVHTVDV-HPTLDLIASAGRDAVVRLWDIRT-RVPVMTLAGHKGP 254

Query: 298 VNNLE 302
           +N ++
Sbjct: 255 INQVK 259

>ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1147

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 98/242 (40%), Gaps = 30/242 (12%)

Query: 102 LPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLK-FHK 160
           L  P SN      ++H   IT   + PQ P+I+AT     ++  Y  +  L+S  + F+ 
Sbjct: 98  LAKPSSNAIEHVLHKHFRAITDINFSPQHPDILATC----SIDTYVHAWDLRSPQRPFYT 153

Query: 161 DNGYALSFSTLVK-----GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            +G+ LS ++ VK       +L+ +  + V +W++  G  P   +      H   +N   
Sbjct: 154 TSGW-LSGASQVKWSFNDQNVLASAHGNDVCIWDLRKGSTPLGKLVG----HGSSVNSVD 208

Query: 216 WHNFNKDLFGTVSEDSLLKINDV-RANNTTIDTVKCPQPF---NTLAFSHHSSNLLAAAG 271
           ++ F +    T S D  +K  D  ++ N  I T++   P      L F      + +  G
Sbjct: 209 FNRFKRTELMTGSNDGSVKFWDYSKSCNEPIKTIRTDFPIWRGRYLPFGEGCCLMPSVGG 268

Query: 272 MDSYVYLYDLRNMK----------EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM 321
            +S VY+  L              +P++   GH+D V +  + +             +L+
Sbjct: 269 FNS-VYVASLAKRDGVEEVNDSKLQPIYAFKGHDDRVTDFVWRSRSSCGSDGCDREFQLV 327

Query: 322 MW 323
            W
Sbjct: 328 TW 329

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 51/105 (48%), Gaps = 14/105 (13%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + FS    ++LA   +D+YV+ +DLR+ + P +  SG     + +++S +          
Sbjct: 120 INFSPQHPDILATCSIDTYVHAWDLRSPQRPFYTTSGWLSGASQVKWSFN-DQNVLASAH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLN 361
            N + +WDL++     TP      + +L+    GH SSVN  D N
Sbjct: 179 GNDVCIWDLRK---GSTP------LGKLV----GHGSSVNSVDFN 210

>KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.247
           YKR036C
          Length = 666

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 35/128 (27%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           L+SGS D T+  W++ +G    K ++  N           + N  K+L GTV        
Sbjct: 474 LVSGSRDKTIRQWDLKTG----KCIQILNI---------GFLNSQKELLGTV-------- 512

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
                     D ++ P P   L     +   LA  G D  V L+DLR + + +  +SGHE
Sbjct: 513 ----------DPIRSPPPIGALQCRDAA---LATGGQDGIVRLWDLR-IGKVVRSLSGHE 558

Query: 296 DAVNNLEF 303
           +A+  L+F
Sbjct: 559 NAITALKF 566

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 74/182 (40%), Gaps = 6/182 (3%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ P+  A  +        SR+  +  T    KD  Y+ SF +   G+LL   
Sbjct: 42  VTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRS--DGKLLCAG 99

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR- 239
           D     L  V    +P   + + N   +   +  K+H  +  +  T S+D + ++ D+  
Sbjct: 100 D--ATGLVSVYDSYNPRTILLSMN-ASTHPTHVTKFHTQDSKILATASDDRVTRLWDISN 156

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
           A    ++         TL+F   + +L+A    D  V LYD R+      +   H+  + 
Sbjct: 157 AYEPQLELTGATDYVRTLSFIPAAPHLIATGSYDGLVRLYDTRSSGSTPIYSLNHDQPIE 216

Query: 300 NL 301
           N+
Sbjct: 217 NV 218

>AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YJL112W (MDV1) and YKR036C
           (CAF4)
          Length = 715

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 72/172 (41%), Gaps = 36/172 (20%)

Query: 155 TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDN 214
           T   H D   ALSF       L+SGS D T+  W++ +G    K V+T +      IN  
Sbjct: 500 TFDSHIDEITALSFEA---NNLVSGSQDRTIRQWDLNNG----KCVQTLD------INFA 546

Query: 215 KWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
              N ++ + G+      L  N+   ++  I  ++C                LA    D 
Sbjct: 547 TGGNLSRSMIGS----GFLNTNN---DHPIIGAIQCYDA------------ALATGTKDG 587

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
            V L+DLR+ +  +  + GH DAV +L+F +            N + +WDL+
Sbjct: 588 IVRLWDLRSGR-VVRTLEGHSDAVTSLQFDS---LNLVTGSLDNSIRIWDLR 635

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 107/259 (41%), Gaps = 48/259 (18%)

Query: 134 VATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++  +  +   TL  H ++   + +    +G L SGS D TV +W++ S
Sbjct: 253 LASASKDGTIKIWDTARRVCLYTLSGHSNSVACVKWGG--EGLLYSGSHDKTVRVWDMNS 310

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN-----DVRANNTTIDT 247
                    T     S + N   W N       ++S D  L+I       V+ +      
Sbjct: 311 A--------TVGKCISILKNHAHWVNHL-----SLSTDYALRIGPFDHTGVKPSTPAEAK 357

Query: 248 VKCPQPFNTLAFSHHSSN-LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH 306
            +    ++ +A  + S+  L+  A  D  ++L++ + + +PL  M+GH+  VN++ FS  
Sbjct: 358 RRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSPD 417

Query: 307 XXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW 366
                      N + +W            D  DG  + +    GH +SV       Q+ W
Sbjct: 418 -GRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVY------QVAW 456

Query: 367 -----LVASAEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 457 SSDCRLLVSCSKDTTLKVW 475

>YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}
           RSA4WD-repeat protein involved in ribosome biogenesis;
           may interact with ribosomes; required for maturation and
           efficient intra-nuclear transport or pre-60S ribosomal
           subunits, localizes to the nucleolus
          Length = 515

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 105/262 (40%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV +W++ S
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDINS 308

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ 252
            G      R  N L S       W N       ++S D  L+I    A + T      P+
Sbjct: 309 QG------RCINILKSHA----HWVNHL-----SLSTDYALRIG---AFDHTGKKPSTPE 350

Query: 253 PFNTLAFSHH---------SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
                A  ++         S  ++  A  D  ++L++     +P+  M+GH+  VN++ F
Sbjct: 351 EAQKKALENYEKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAF 410

Query: 304 STHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQ 363
           S             N + +W            D  DG  + I    GH +SV       Q
Sbjct: 411 SP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVY------Q 449

Query: 364 IPW-----LVASAEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVW 471

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 93/237 (39%), Gaps = 35/237 (14%)

Query: 90  PQEEAGEEYQSSLPAPRSNIRI-------TAKYEHEEEITRARYMPQDPNIVATINGQGT 142
           P   + E+  + L  PR+  ++       +A   H   I  + + P   + + T  G  T
Sbjct: 108 PGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPV 200
             ++   ++    TLK H +  + L  S    G +++ GS D+T+ LW+  SG      +
Sbjct: 168 ARIWDCDTQTPMHTLKGHYN--WVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDAL 225

Query: 201 RTWNDLHSDIINDNKWHNF------NKDLFGTVSEDSLLKINDV--RANNTTI----DTV 248
           R     HS  I    W         +K    + S+D  +KI D   R    T+    ++V
Sbjct: 226 RG----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSV 281

Query: 249 KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            C               LL +   D  V ++D+ +    ++ +  H   VN+L  ST
Sbjct: 282 SC--------VKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLST 330

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 78/183 (42%), Gaps = 8/183 (4%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ  +  A  +        SR+  +  T    KD  Y+ SF     G+LL   
Sbjct: 42  VTHIAFNPQHTHDFAVTSSTRVQIFSSRTRQVVKTFSRFKDVVYSASFRN--DGKLLVAG 99

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR- 239
           D     L  V    +P   + + N + +  ++  K+H+ +     T S+D + ++ D+  
Sbjct: 100 D--ATGLVSVFDSYNPRTLLLSIN-VSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDISY 156

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNM-KEPLHHMSGHEDAV 298
           A   +++         TL F   + +L+A    D  V LYD RN   EP+  ++ HE  +
Sbjct: 157 AYEPSLELTGASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPVFSLN-HEQPL 215

Query: 299 NNL 301
            N+
Sbjct: 216 ENI 218

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 73/147 (49%), Gaps = 19/147 (12%)

Query: 210 IINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLL 267
           IIN+++    N  L  T +ED++ KI D+++N+  + T+K  +  PF +L   H    LL
Sbjct: 82  IINNDR---MNGSLIATAAEDAV-KIYDLKSNDC-VATLKNGKSAPFLSLDSRH---GLL 133

Query: 268 AA----AGMDSYVYLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMM 322
                 +G+D+ +++YD+R+ ++PL  +   H D + +++F                + +
Sbjct: 134 GCGTELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNI 193

Query: 323 WDLKQIGAEQTPDDAEDGVPELIMVHA 349
           +DL Q    Q  DDA   V     +H+
Sbjct: 194 YDLTQ----QEEDDALHQVINFASIHS 216

>NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/260 (21%), Positives = 110/260 (42%), Gaps = 46/260 (17%)

Query: 161 DNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
           D   +L   T+VK +     +D  + +  + + G P++ +RT +   + + +  ++  F+
Sbjct: 169 DFAVSLDGETVVKSQSNGSEEDSILKI--IDNAGKPSEILRTIHVPGTTVTHSVRF--FD 224

Query: 221 KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLAAAGMDSYVYL 278
             +F + S+D++L+  D R N+  +  +  PQ     +F  S  SS+L         + L
Sbjct: 225 NHMFASCSDDNVLRFWDTRTNDKPLWVLADPQNGRLTSFDASSVSSDLFVTGFSTGLIKL 284

Query: 279 YDLR-------------NMKEPL-------HHMSGHEDAVNNLEFSTHXXXXXXXXXXXN 318
           +D R             N +EP+       +H  G  D+V +++FS              
Sbjct: 285 WDARAVEAATLDFTNRQNGEEPIQKEIANFYHSGG--DSVVDVQFSPTSPTEVLTVGGSG 342

Query: 319 RLMMWDLKQIGAEQTPDDAEDGVPE----------LIMVHAG-------HRSSVNDFDLN 361
            +  WD++   +    DD ++ VP+          L  +H G        R   N    +
Sbjct: 343 NVYHWDMEYALSNYDADD-KNRVPQDACEKLQTESLKFLHTGGSRRSSKQRGKRNTVAWH 401

Query: 362 PQIPWLVASAEEENILQVWK 381
           P I  LVA+ ++++++ V+K
Sbjct: 402 PVIDELVATVDDDSLVSVYK 421

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 55/133 (41%), Gaps = 7/133 (5%)

Query: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMK-EPLHHMSGHEDAVNNLEFSTHXXXX 310
           Q    + +S   S + A +G D YV ++D R+ K +P          VN + ++      
Sbjct: 327 QSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYL 386

Query: 311 XXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVAS 370
                      +WDL+Q     +P ++E   P  +  +  HR  +     NP    +VA 
Sbjct: 387 LASGDDNGSWGVWDLRQF----SPANSEGVQP--VAQYDFHRGPITSISFNPLDDSVVAV 440

Query: 371 AEEENILQVWKCS 383
           A E+N + +W  S
Sbjct: 441 ASEDNTVTLWDLS 453

>TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {ON}
           Anc_8.316 YDR142C
          Length = 362

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/239 (22%), Positives = 98/239 (41%), Gaps = 38/239 (15%)

Query: 130 DPNIVATINGQGTVFLYSRSEGLQST--LKFHKDNGYALSFSTLVKGRLLSGSDDHTVAL 187
           +P  V    G GT+ L+  +  LQ     K H    ++ +++ L +   +SGS D  V +
Sbjct: 72  NPTQVLVAQGDGTLTLFDLTNKLQQIQIYKEHYSEVFSCNWNMLTRRTFISGSWDGKVKI 131

Query: 188 WE---------------VGSGGD--PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSED 230
           W+               +G  G+   TK ++  N  + D I    +   + ++    S +
Sbjct: 132 WDCARSESVLTLRNNRSLGHTGEHIETKALQR-NSKNKDCIYQALFSPHDPNMAMCCSGN 190

Query: 231 SLLKINDVRANNTTIDTVKCPQPFNTLA--FSHHSSNLLAAAGMDSYVYLYDLRNMKEPL 288
           S L   D+R  N   +++       TL+  ++ + S ++A+AG+D  + ++DLR +K   
Sbjct: 191 SYLTFFDLRQPNQQ-NSILAHSGLETLSCDYNKYRSYIVASAGVDKAIRIWDLRMIKNKP 249

Query: 289 HHM--------------SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMW-DLKQIGAEQ 332
           H+M              + HE A+  + +S H               +W DL   G  Q
Sbjct: 250 HNMFADISSYNCTNEVVNAHELAIRKILWSPHHSNYFLTTSYDLTCRVWQDLSHDGTRQ 308

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 94/242 (38%), Gaps = 26/242 (10%)

Query: 79  NLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRI-------TAKYEHEEEITRARYMPQDP 131
           NL + IL    P  +  E++ + +  PR+  ++       +A   H   I  + + P   
Sbjct: 100 NLYQSILK---PGLKTTEDFLTLVYTPRAIFKVKPVTRSSSAIAGHGSTILCSAFAPNTS 156

Query: 132 NIVATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLS-GSDDHTVALWE 189
           + + T  G  T  ++   ++    TL+ H +  + L  S    G L++ GS D+T+ LWE
Sbjct: 157 SRMVTGAGDNTACIWDCDTQTRMCTLQGHHN--WVLCCSWSPDGELIATGSMDNTIRLWE 214

Query: 190 VGSGGDPTKPVRTWNDLHSDIINDNKWHNF------NKDLFGTVSEDSLLKINDVRANNT 243
              G      +R     HS  I    W         +K    T S+D  +KI D      
Sbjct: 215 SSKGKPYGDALRG----HSKWITSLSWEPIHLVKPGDKPRLATASKDGTIKIWDTTRRVC 270

Query: 244 TIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
            +    C    +         N+L +   D  +  +D+    + ++ +  H   VN+L  
Sbjct: 271 LL--TLCGHTSSVSCVKWGGKNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSL 328

Query: 304 ST 305
           ST
Sbjct: 329 ST 330

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 66/327 (20%), Positives = 115/327 (35%), Gaps = 83/327 (25%)

Query: 107 SNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEG--LQSTLKFHKDNGY 164
           +  R+     H   +    + P D  ++AT +   T+ L+  S+G      L+ H     
Sbjct: 175 TQTRMCTLQGHHNWVLCCSWSP-DGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWIT 233

Query: 165 ALSFSTL------VKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDL-HSDIINDNKWH 217
           +LS+  +       K RL + S D T+ +W      D T+ V       H+  ++  KW 
Sbjct: 234 SLSWEPIHLVKPGDKPRLATASKDGTIKIW------DTTRRVCLLTLCGHTSSVSCVKWG 287

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTIDTVK------------CPQPFNTLAFSHHSSN 265
              K++  + S D  ++  D+  N   I+ +K                    AF H    
Sbjct: 288 G--KNVLYSGSHDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGET 345

Query: 266 ---------------------------LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAV 298
                                      L+  A  D  +YL++     +P+  M+GH+  V
Sbjct: 346 PASPEEAQQKALKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLV 405

Query: 299 NNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDF 358
           N++ FS             N + +W            D  DG  + +    GH +SV   
Sbjct: 406 NHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVY-- 448

Query: 359 DLNPQIPW-----LVASAEEENILQVW 380
               Q+ W     L+ S  ++  L+VW
Sbjct: 449 ----QVAWSSDCRLLVSCSKDTTLKVW 471

>Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 106/262 (40%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV +W++ S
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDMNS 308

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ 252
            G      R  N L S       W N       ++S D  L++    A + T      P+
Sbjct: 309 QG------RCINILKSHA----HWVNHL-----SLSTDYALRVG---AFDHTGQKPTSPE 350

Query: 253 PFNTLAFSHH---------SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
                A +++         S  ++  A  D  ++L++     +P+  M+GH+  VN++ F
Sbjct: 351 DAQKKALANYEKICKKNGNSEEMMVTASDDFTIFLWNPLKSTKPIARMTGHQKLVNHVAF 410

Query: 304 STHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQ 363
           S             N + +W            D  DG  + I    GH +SV       Q
Sbjct: 411 SP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVY------Q 449

Query: 364 IPW-----LVASAEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVW 471

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 93/237 (39%), Gaps = 35/237 (14%)

Query: 90  PQEEAGEEYQSSLPAPRSNIRI-------TAKYEHEEEITRARYMPQDPNIVATINGQGT 142
           P   + E+  + L  PR+  ++       +A   H   I  + + P   + + T  G  T
Sbjct: 108 PGHNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPV 200
             ++   ++    TLK H +  + L  +    G +++ GS D+T+ LW+  +G      +
Sbjct: 168 ARIWDCDTQTPMHTLKGHFN--WVLCVAWSPDGEVIATGSMDNTIRLWDPKTGECLGDAL 225

Query: 201 RTWNDLHSDIINDNKWHNF------NKDLFGTVSEDSLLKINDV--RANNTTI----DTV 248
           R     HS  I    W         +K    + S+D  +KI D   R    T+    ++V
Sbjct: 226 RG----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSV 281

Query: 249 KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            C               LL +   D  V ++D+ +    ++ +  H   VN+L  ST
Sbjct: 282 SC--------VKWGGQGLLYSGSHDRTVRVWDMNSQGRCINILKSHAHWVNHLSLST 330

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 73/157 (46%), Gaps = 14/157 (8%)

Query: 150 EGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVR--TWNDLH 207
           EG+  T  FH ++ +        K   ++G     + LW+     + +KP+   +W    
Sbjct: 163 EGIIKT--FHGEHAFQSLDHHRQKSNFVTGGAQ--IELWDT----NRSKPISNLSWG--- 211

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D IN  +++    D+  +   D+ + + D+R N+ T   V+  +  N++ ++   +   
Sbjct: 212 ADNINHVRFNQNEVDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT-NSICWNPVEAFNF 270

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
             A  D   Y YD+RNM + LH    H  AV +++FS
Sbjct: 271 VIANEDHNAYYYDMRNMSKALHVFKDHVSAVMDVDFS 307

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/182 (22%), Positives = 74/182 (40%), Gaps = 6/182 (3%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ P+  A  +        SR+  +  T    KD  Y+ SF +   G+LL   
Sbjct: 42  VTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRS--DGKLLCAG 99

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR- 239
           D     L  V    +P   + + N   +   +  K+H  +  +  T S+D + ++ D+  
Sbjct: 100 D--ATGLVSVYDSYNPRTILLSIN-ASTHPTHVTKFHTQDNKILATASDDRVTRLWDISN 156

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
           A    ++         TL+F   + +L+A    D  + LYD R+      +   H+  V 
Sbjct: 157 AYEPQLELTGATDYVRTLSFIPAAPHLVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPVE 216

Query: 300 NL 301
           N+
Sbjct: 217 NV 218

>KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly
           similar to uniprot|Q12021 Saccharomyces cerevisiae
           YDR030C RAD28 Protein involved in transcription- coupled
           repair nucleotide excision repair of UV-induced DNA
           lesions homolog of human CSA protein
          Length = 425

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 100/272 (36%), Gaps = 61/272 (22%)

Query: 85  LSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVF 144
           L N+  Q  AGE  +S  P+ R  + +TA+                     +  G+   F
Sbjct: 84  LVNKRIQFAAGESKESVNPSSR-RVHVTAR---------------------SPGGKAPRF 121

Query: 145 LYSRSEGLQSTLKFHKDNGYALSFSTLV-----KGRLLSGSDDHTVALW-----EVGSGG 194
           L S       +L+  ++  +A S +++       G   +GS+DH V +W     +V S  
Sbjct: 122 LTSVESRPPDSLQGPREASHAFSVTSVKWYGPDNGLFFTGSNDHKVKIWDTNTFQVASSI 181

Query: 195 DPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDT-VK---C 250
           D    V   + L               DL    SEDS  ++ D+R+ +  I   VK    
Sbjct: 182 DIAHRVAQLDTL--------------GDLLAVASEDSHPRLIDLRSMSAAISLGVKRSDM 227

Query: 251 PQPFNTLAFSHHSSN----LLAAAGMDSYVYLYDLR-------NMKEPLHHMSGHEDAVN 299
               N   FSH SS     LLA    D  V ++DLR       ++ E       H    N
Sbjct: 228 RHGINAAKFSHTSSGAKPLLLATGDDDGNVRVWDLRMGNRWLCDLTEADTLSKSHARCCN 287

Query: 300 NLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAE 331
           +L +               +  MWDL + GA+
Sbjct: 288 DLCWDPSGSLKLVTTGNDGKCKMWDLHEGGAK 319

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 74/156 (47%), Gaps = 10/156 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           LLSG  D+ V LW++ S  +  + +R     H+  ++  K H   + L  + S D    +
Sbjct: 230 LLSGGGDNLVKLWDMTS--NSFEELRG----HAGRVSRVKVHPSGR-LAASASFDLTWIL 282

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+             +   T+AF    + LLA+AG+D+   ++DLR+  EP+  + GH 
Sbjct: 283 WDLERKVELQLQEGHSKAVYTIAFQSDGA-LLASAGLDAVCAIWDLRS-GEPIMKLEGHA 340

Query: 296 DAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAE 331
            A++ +++S +             + +WD++ +G E
Sbjct: 341 GAISGVDWSPNGYQLATAGADGT-VRVWDIRNVGTE 375

>Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {ON}
           complement(40550..41851) [1302 nt, 434 aa]
          Length = 433

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 92/210 (43%), Gaps = 37/210 (17%)

Query: 178 SGSDDHTVALWEVGSG------GDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDS 231
           +GS D TV +W++ SG           PVR       DI   ++ H +   LF + SED 
Sbjct: 139 TGSTDTTVKVWDLVSGHLKLTLSGHVMPVR-------DITVSDR-HPY---LF-SASEDK 186

Query: 232 LLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHM 291
           L+K  D+  N    D         ++A  H + +L+A AG DS V L+D+R+  E +  +
Sbjct: 187 LVKCWDLEKNMAIRDYHGHLSGVYSVAI-HPTLDLIATAGRDSVVRLWDIRSRMEVM-TL 244

Query: 292 SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGH 351
            GH+  +N +  S               + +WD+              G    ++ H  H
Sbjct: 245 IGHKGPINKVR-SLPVDPQIISCSTDATVHLWDIVA------------GKSAKVLTH--H 289

Query: 352 RSSVNDFDLNPQIPWLVASAEEENILQVWK 381
           + SV D  LNP   + +ASA  ++I + W+
Sbjct: 290 KRSVRDIALNPS-EFSLASACTDDI-RSWR 317

>NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.356
           YLR196W
          Length = 607

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 71/148 (47%), Gaps = 9/148 (6%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWH 217
           H D   +LS +   +  L S S DHTV LW++ +        R+   +H++  ++ ++WH
Sbjct: 322 HTDAVLSLSHNKQFRAVLASTSADHTVKLWDLNTA----TAARSLASIHNNKNVSSSEWH 377

Query: 218 NFNKDLFGTVSEDSLLKINDVR-ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS-Y 275
             N  +  T   DS + ++DVR ++   +       P   +  +  +   +   G D+  
Sbjct: 378 VSNGSILLTGGYDSRIALSDVRISDEKQMSKYWSVMPGEEIECTTFADENIILCGTDAGN 437

Query: 276 VYLYDLRNMK--EPLHHMSGHEDAVNNL 301
           +Y +D+RN +  +P+  +  H+  +++L
Sbjct: 438 IYSFDIRNNENSKPVWTLKAHDAGISSL 465

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 80/206 (38%), Gaps = 9/206 (4%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ P+  A  +        SR+  +  T    KD  Y+ SF +   G+LL   
Sbjct: 42  VTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRS--DGKLLCAG 99

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV-R 239
           D     L  V    +P   + + N   +   +  K+H  +  +  T S+D + ++ D+  
Sbjct: 100 D--ATGLVSVYDSYNPRTILLSIN-ASTHPAHVTKFHTQDNKVLATASDDRVTRLWDISH 156

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVN 299
           A    ++         TL+F   + +++A    D  + LYD R+      +   H+  + 
Sbjct: 157 AYEPQLELTGATDYVRTLSFIPAAPHMVATGSYDGLIRLYDTRSSGSTPIYSLNHDQPIE 216

Query: 300 NLEFSTHXXXXXXXXXXXNRLMMWDL 325
           N+   T            N   +WDL
Sbjct: 217 NI---TAVSPTQIVSCGGNNFKVWDL 239

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 78/195 (40%), Gaps = 37/195 (18%)

Query: 134 VATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSG 193
           V   +G+      S+ +    T   H D   ALSFS      L+SGS D T+  W++ SG
Sbjct: 526 VNLFDGENISMEDSKEDACVYTFDAHVDEITALSFS---GDNLISGSQDRTIRQWDLNSG 582

Query: 194 GDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDS--LLKINDVRANNTTIDTVKCP 251
               K V+T        I+ N     N    GT+S  S  LL  N+       I  ++C 
Sbjct: 583 ----KCVQT--------IDINFASRVNSSTSGTLSSRSSTLLVPNE----QPVIGALQCY 626

Query: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXX 311
                          LA    D  V L+DLR+  + +  + GH DA+ +L+F +      
Sbjct: 627 DA------------ALATGTKDGLVRLWDLRS-GQVVRTLQGHTDAITSLQFDS---INL 670

Query: 312 XXXXXXNRLMMWDLK 326
                   + +WDL+
Sbjct: 671 ITGSIDRSIRIWDLR 685

>TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {ON}
           Anc_4.309 YLR429W
          Length = 642

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 70/168 (41%), Gaps = 24/168 (14%)

Query: 175 RLLSGSDDHTVALWEVGSG----------GD-----PTKPVRTWNDLHSDIINDNKWHNF 219
           R+ SGSDD  + +W++  G          GD     PTK +      HS  +    +H  
Sbjct: 96  RVASGSDDCKIGIWDIPEGYSFRNHIDENGDVIDIQPTKMLTG----HSRKVGHVLFHPV 151

Query: 220 NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLY 279
           ++++  + S D  ++I +V      I T+K P    +++FS +  N LA    D  + ++
Sbjct: 152 SQNVLASSSLDYTVRIWNVETGENLI-TLKHPDMVTSMSFS-YDGNHLATVARDKKLRVW 209

Query: 280 DLRNMK---EPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           D+RN K   E L H       V  L  S              ++ +WD
Sbjct: 210 DIRNNKIVSEGLAHAGAKNQRVVWLGNSDRLATTGFSKLSDRQIGIWD 257

>Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON}
           similar to Ashbya gossypii AGR067W
          Length = 1132

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           H   I D  +H  + +L  T S D+ +   D+R+       T       + + ++  ++N
Sbjct: 113 HFRAITDINFHPSHPELLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNAN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           +LA++  +S V+++D+R    PL+ +SG+  +VNN++F+               +  WD 
Sbjct: 173 VLASSHANS-VFIWDIRKGCTPLYKLSGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDY 231

Query: 326 KQIGAE 331
            +   E
Sbjct: 232 SKSSTE 237

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/120 (21%), Positives = 53/120 (44%), Gaps = 14/120 (11%)

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           LLA   +D+YV+ +D+R+ + P +  S      + ++++             N + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRSPQRPYYSTSDWSAGASQVKWNLQNANVLASSHA-NSVFIWDI 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSHS 385
           ++            G   L  + +G+ SSVN+ D N      + S+  +  ++ W  S S
Sbjct: 188 RK------------GCTPLYKL-SGNNSSVNNIDFNKVKENEIMSSSNDGTVKFWDYSKS 234

>Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429W
           (REAL)
          Length = 642

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALWE----------VGSGGDP--TKPVRTWNDLHSDIINDNKWHNFNKD 222
           R+ S SDD  + +W+          V   GDP   KPV+     H+  +    +H   K+
Sbjct: 96  RIASSSDDSKIGIWDVPENYKFHDHVDENGDPIDIKPVKFLTG-HARKVGHVLYHPVAKN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D  +K+ DV      I T+K P    +++FS +  N LA    D  + ++++R
Sbjct: 155 VLASSSGDYTVKLWDVETGKDVI-TLKHPDMVTSMSFS-YDGNHLATVARDKKLRVWNIR 212

Query: 283 NMK 285
           + K
Sbjct: 213 DEK 215

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 61/122 (50%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW++    + +KP+   +W    +D IN  K++  + ++ G+   D+ + + D+R N+
Sbjct: 198 INLWDI----NRSKPLSDLSWG---ADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNS 250

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N++ ++   +     A  D   Y YD+RNM   L+    H  AV +++
Sbjct: 251 ATQKIVQTMR-VNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 309

Query: 303 FS 304
            S
Sbjct: 310 IS 311

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 95/229 (41%), Gaps = 25/229 (10%)

Query: 77  EINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAK-------YEHEEEITRARYMPQ 129
           E  LP+ +     P E A  EY  +L A +   R+ AK       + H++ +        
Sbjct: 21  ESQLPRNLNPELHPFERA-REYTKALTATKLE-RMFAKPFVGQMGHGHQDGVYVLAKHYN 78

Query: 130 DPNIVATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLV---------KGRLLSG 179
           D N +A+ +G G +  +  S   Q ++ K H      L  +  V         +  +LS 
Sbjct: 79  DLNKIASGSGDGVIKYWDMSSREQIASFKAHYGTITGLCITPKVNIDSASSGNQNFVLSS 138

Query: 180 SDDHTVALWEVG----SGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGT--VSEDSLL 233
           SDD TV LW V     +  D  + + T N L      ++ +   +     +  V+    +
Sbjct: 139 SDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLDHSRMTSNFVTGGPRI 198

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
            + D+  +    D        NT+ F+ + +N+L +AG D+ + LYDLR
Sbjct: 199 NLWDINRSKPLSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLR 247

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 1/97 (1%)

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D ++  K++    D+F +   D+ + + D+R N+ T   V+  +  N L ++   +   
Sbjct: 214 ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPTQKFVQKMRT-NALCWNPMEAYNF 272

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
             A  D   Y YD+RN+   LH    H  AV +++FS
Sbjct: 273 VVANEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFS 309

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 55/262 (20%), Positives = 104/262 (39%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFLYSRSEGLQS-TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++  +  +   TL  H ++   + +    +G L SGS D T+  W++ +
Sbjct: 250 LASASKDGTIKIWDTTRRVCVLTLSGHTNSVSCVKWGG--RGILYSGSHDKTIRAWDMAA 307

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ 252
           GG     +++    H+  IN             +++ D  L++    A + T +    P+
Sbjct: 308 GGKCINILKS----HAHWINHL-----------SLNTDYALRVG---AFDHTGEKPSSPE 349

Query: 253 PFNTLAFSHHSS---------NLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
                A  ++            L+  A  D  +YL+D     +P+  M+GH+  VN++ F
Sbjct: 350 EARAKALKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAF 409

Query: 304 STHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQ 363
           S             N + +W            D  +G    I    GH +SV       Q
Sbjct: 410 SP-DGRYIVSASFDNSIKLW------------DGRNGT--FIATFRGHVASVY------Q 448

Query: 364 IPW-----LVASAEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 449 VAWSSDCRLLVSCSKDTTLKVW 470

>Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 105/262 (40%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++ + S   Q T+  H ++   + +    +G L SGS D TV +W++ S
Sbjct: 251 LASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDINS 308

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ 252
            G      R  N L S       W N       ++S D  L++    A + T      P+
Sbjct: 309 QG------RCINILKSHA----HWVNHL-----SLSTDYALRVG---AFDHTGKRPSTPE 350

Query: 253 PFNTLAFSHH---------SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
                A  ++         S  ++  A  D  ++L++     +P+  M+GH+  VN++ F
Sbjct: 351 DAQKKALENYEKICKKNGNSEEMMVTASDDFTMFLWNPLKSTKPVARMTGHQKLVNHVAF 410

Query: 304 STHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQ 363
           S             N + +W            D  DG  + I    GH +SV       Q
Sbjct: 411 SP-DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVY------Q 449

Query: 364 IPW-----LVASAEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 450 VAWSSDCRLLVSCSKDTTLKVW 471

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 93/237 (39%), Gaps = 35/237 (14%)

Query: 90  PQEEAGEEYQSSLPAPRSNIRI-------TAKYEHEEEITRARYMPQDPNIVATINGQGT 142
           P   + E+  + L  PR+  ++       +A   H   I  + + P   + + T  G  T
Sbjct: 108 PGYNSTEDQITLLYTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNT 167

Query: 143 VFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPV 200
             ++   ++    TLK H +  + L  S    G +++ GS D+T+ LW+  +G      +
Sbjct: 168 ARIWDCDTQTPMHTLKGHYN--WVLCVSWSPDGEVIATGSMDNTIRLWDPKTGECLGDAL 225

Query: 201 RTWNDLHSDIINDNKWHNF------NKDLFGTVSEDSLLKINDV--RANNTTI----DTV 248
           R     HS  I    W         +K    + S+D  +KI D   R    T+    ++V
Sbjct: 226 RG----HSKWITSLSWEPIHLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSV 281

Query: 249 KCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            C               LL +   D  V ++D+ +    ++ +  H   VN+L  ST
Sbjct: 282 SC--------VKWGGQGLLYSGSHDRTVRVWDINSQGRCINILKSHAHWVNHLSLST 330

>KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {ON}
           Anc_3.259 YDR030C
          Length = 369

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 13/133 (9%)

Query: 173 KGRLLSGSDDHTVALWEVGSGGDPT-----KPVRTWNDLHSDI--INDNKWHNFNKDLFG 225
           K   L+G+++ TV+LW + +    +     K  RT    HS +  IND KW++ +  +F 
Sbjct: 61  KTSFLAGNNNGTVSLWNLDNTLSTSHILNNKLARTSTKPHSHLFGINDMKWYSIDDGMFF 120

Query: 226 TVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYV-YLYDLRNM 284
           T   D  +K+ D    N  I+       FN+  F   ++N      +D Y   L DLRNM
Sbjct: 121 TCGNDKFVKLWDT---NKFINVQDL--EFNSNLFQMDTANQFILVTLDDYYPRLIDLRNM 175

Query: 285 KEPLHHMSGHEDA 297
              +     H ++
Sbjct: 176 NLGITIFGKHLNS 188

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 62/135 (45%), Gaps = 12/135 (8%)

Query: 172 VKGRLLSGSDDHTVALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSE 229
           VK   ++G    T+ LW+       +KP+   +W    +D I   K++    D+  +   
Sbjct: 184 VKTTFVTGGP--TIQLWDTAR----SKPLSNLSWG---ADNITSVKFNQTETDILASTGS 234

Query: 230 DSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLH 289
           D+ + + DVR N+ T   V+  +  N + ++   +     A  D   Y YD+RNM   L+
Sbjct: 235 DNSIVLYDVRTNSPTQKIVQRLRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALN 293

Query: 290 HMSGHEDAVNNLEFS 304
               H  AV +++F+
Sbjct: 294 VFKDHVSAVMDVDFA 308

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 88/204 (43%), Gaps = 25/204 (12%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D TV +W++ SG      ++     H   + D      +  LF + SED ++K  D
Sbjct: 133 TGSNDTTVKIWDLASG-----KLKLTLAGHVMTVRDVAISQRHPYLF-SASEDKMVKCWD 186

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H + +L+A+AG D  V L+D+R+ +  +  + GH+  
Sbjct: 187 LEKNQIIRDYHGHLSGVHTVDI-HPTLDLIASAGRDGVVKLWDIRS-RTAVMTLIGHKSP 244

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           +  +                  + +WD+              G    I+ H  H+ SV D
Sbjct: 245 ITKVH-CLPVNPQVVSSSTDATVRLWDVTA------------GKSYKILTH--HKRSVRD 289

Query: 358 FDLNPQIPWLVASAEEENILQVWK 381
           F L+P    +V++  ++  ++ WK
Sbjct: 290 FSLHPSEFSMVSACTDD--IRSWK 311

>AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR128W
          Length = 1125

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 56/119 (47%), Gaps = 2/119 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTI-DTVKCPQPFNTLAFSHHSSN 265
           H+  I D  +H  + +L  T S D+ +   D+R +      T       + + ++   +N
Sbjct: 113 HTRAITDINFHPIHPELLATCSIDTYVHAWDMRCSQRPFYGTSDWSSGASQVKWNFKDAN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           ++A++   S V+++D+R    PL+ ++G   +VNN++F+ +             +  WD
Sbjct: 173 IIASSHA-STVFIWDIRKGSVPLYRLNGSGSSVNNIDFNRNNECEIMSSYNDGTIKFWD 230

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 50/119 (42%), Gaps = 14/119 (11%)

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           LLA   +D+YV+ +D+R  + P +  S      + ++++             + + +WD+
Sbjct: 129 LLATCSIDTYVHAWDMRCSQRPFYGTSDWSSGASQVKWN-FKDANIIASSHASTVFIWDI 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVWKCSH 384
           ++             VP   +  +G  SSVN+ D N      + S+  +  ++ W   H
Sbjct: 188 RK-----------GSVPLYRLNGSG--SSVNNIDFNRNNECEIMSSYNDGTIKFWDYGH 233

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/189 (25%), Positives = 81/189 (42%), Gaps = 30/189 (15%)

Query: 224 FGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAA----AGMDSYVY 277
           F T SEDS+ KI D+R N   + TV+  +  PF +L   H    +LA     +G D+ ++
Sbjct: 74  FVTASEDSV-KIFDLRLNQC-VATVQNAKNSPFISLDSRH---GMLACGTELSGTDAEIH 128

Query: 278 LYDLRNMKEPLHHMS-GHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDD 336
           LYDL+ +  P+      H D + +++F                + ++DLKQ    Q  ++
Sbjct: 129 LYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ----QEEEE 184

Query: 337 AEDGVPELIMVHA------------GHRSSVNDFDLNPQIPWLVASAEEE--NILQVWKC 382
           A   V     +H+             H  + +  +LN +   LV     E  +I + W C
Sbjct: 185 ALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRKPWNC 244

Query: 383 SHSLPIVGG 391
            + + I  G
Sbjct: 245 DYVVDIFPG 253

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 60/286 (20%), Positives = 113/286 (39%), Gaps = 64/286 (22%)

Query: 117 HEEEITRARYMP------QDPNIVATINGQGTVFLY--SRSEGLQSTLKFHKDNGYALSF 168
           H + IT   + P       D   +A+ +  GT+ ++  SR   L  TL  H ++   + +
Sbjct: 228 HSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDASRRTCLY-TLSGHTNSVSCVKW 286

Query: 169 STLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVS 228
               +G L +GS D T+ +W++ +GG     +++    H+  +N             ++S
Sbjct: 287 GG--QGLLYTGSHDKTIRVWDIKAGGKCINILKS----HAHWVNHL-----------SLS 329

Query: 229 EDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSS---------NLLAAAGMDSYVYLY 279
            D  +++     +     +   PQ    +A  ++            L+  A  D  ++L+
Sbjct: 330 TDYAIRVGPFGPDGKASPS---PQEARDIAKKNYEKVVRKSGQVEELMVTASDDFTMFLW 386

Query: 280 DLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAED 339
           +     +PL  M+GH+  VN++ FS             N + +W            D  D
Sbjct: 387 NPLKSAKPLARMTGHQKLVNHVAFSPD-GRYIVSASFDNSIKLW------------DGRD 433

Query: 340 GVPELIMVHAGHRSSVNDFDLNPQIPW-----LVASAEEENILQVW 380
           G  + I    GH +SV       Q+ W     L+ S  ++  L+VW
Sbjct: 434 G--KFIATFRGHVASVY------QVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 84/214 (39%), Gaps = 25/214 (11%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++   S LK H +
Sbjct: 131 PITRSSAAIAG---HGSTILCSAFAPDTSSRMVTGAGDNTARIWDCATQTPLSVLKGHSN 187

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDL---HSDIINDNKWH 217
             + L  +    G L++ GS D+T+ LWE  +G    KP   W D    HS  I    W 
Sbjct: 188 --WVLCVAWSPDGELIATGSMDNTIRLWESKAG----KP---WGDAMKGHSKWITSLTWE 238

Query: 218 NF------NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAG 271
                   +K    + S+D  +KI D  A+  T          +          LL    
Sbjct: 239 PLHLVAAGDKPRLASASKDGTIKIWD--ASRRTCLYTLSGHTNSVSCVKWGGQGLLYTGS 296

Query: 272 MDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            D  + ++D++   + ++ +  H   VN+L  ST
Sbjct: 297 HDKTIRVWDIKAGGKCINILKSHAHWVNHLSLST 330

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 83/207 (40%), Gaps = 11/207 (5%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ P+  A  +        SR+  +  T    KD  Y+ SF     G+LL   
Sbjct: 42  VTHISFNPQHPHDFAVTSSTRVQIFSSRTRQVIKTFSRFKDVVYSASFRN--DGKLLCAG 99

Query: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV-R 239
           D     L  V    +P   + + N   +   +  K+H  +  +  T S+D + ++ D+  
Sbjct: 100 D--ATGLVSVYDSYNPRTILLSIN-ASTHPTHVTKFHTQDNKILATASDDRVTRLWDISH 156

Query: 240 ANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNM-KEPLHHMSGHEDAV 298
           A    ++         TL+F   + +L+A    D  + LYD R+    P++ ++ H+  +
Sbjct: 157 AYEPQLELTGATDYVRTLSFIPDAPHLVATGSYDGLIRLYDTRSSGSSPIYSLN-HDQPI 215

Query: 299 NNLEFSTHXXXXXXXXXXXNRLMMWDL 325
            ++   T            N   +WDL
Sbjct: 216 EDI---TAVSPTQIVSCGGNNFKVWDL 239

>KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {ON}
           Anc_8.631 YOR212W
          Length = 423

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 135 ATINGQGTVFLYSRSEGLQSTLK--FHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           A ++   TV+  S+   +Q  +   F    GY  S   L + ++LS S D T ALW++  
Sbjct: 153 AGLDNNCTVYKISKENRIQQNVITIFKGHTGYISSIDFLDERQILSASGDMTCALWDIPK 212

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKD--LFGTVSEDSLLKINDVRANNTTIDTVKC 250
                K +R + D   D++     HN N +  +F +   D  L I D R+          
Sbjct: 213 A----KRIREYTDHLGDVLALALPHNDNANGKIFASCGSDGYLYIWDTRSPANAQSFFIS 268

Query: 251 PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRN 283
               ++L F     N + A   +  + ++DLR+
Sbjct: 269 SSDASSLQF-FRDDNSIIAGSENGTISMFDLRS 300

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 90/205 (43%), Gaps = 31/205 (15%)

Query: 158 FHKDNGYALSFSTLVKGRLLSGSDDHTVAL--WEVGSGGDPTKPVRTWN----DLHSDII 211
           F  DN + L F  L    LL+   +  V L  WE         PVR +      ++S  +
Sbjct: 11  FGSDN-WCLKFQPLYNHGLLTSLSNGEVKLLDWET------LNPVRNFKIDQVSINSMKL 63

Query: 212 NDNKWHNFNKDLFGTVSEDSLLKINDVRANNT--TIDTVKCPQPFNTLAFSHHSSNLLAA 269
            +N ++N    LF T + +S+ KI D+++N+   TI   K   PF +L   H   ++LA 
Sbjct: 64  INNDYNN--ASLFATATLNSV-KIYDIKSNDCIATITNDK-KSPFLSLDSRH---DMLAC 116

Query: 270 A----GMDSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
                G+D+ +Y+YD+RN   P+   +  H D + +++F                  ++D
Sbjct: 117 GTELQGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYD 176

Query: 325 LKQIGAEQTPDDAEDGVPELIMVHA 349
           L Q    Q  DDA   V     +H+
Sbjct: 177 LTQ----QEEDDALYQVINYASIHS 197

>KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON} 
          Length = 426

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 57/260 (21%), Positives = 115/260 (44%), Gaps = 50/260 (19%)

Query: 164 YALSFS--TLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNK 221
           ++LSF   T+VK +  +G+++ ++ L  V + G P++ +RT     ++I +  ++  F+ 
Sbjct: 168 FSLSFDNETIVKSQS-NGTEEESI-LKIVDNAGKPSEILRTIRVPGTNITHTVRF--FDN 223

Query: 222 DLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLAAAGMDSYVYLY 279
            LF + S+D++L+  DVR  +  +  +  PQ     AF  S  ++NL         V L+
Sbjct: 224 HLFASCSDDNVLRFWDVRTGDKPLFILSDPQNGRLTAFDSSTVTNNLFVTGFSTGIVKLW 283

Query: 280 DLR-------------NMKEPL-------HHMSGHEDAVNNLEFSTHXXXXXXXXXXXNR 319
           D+R             N ++P+       +H  G  D V +++FS               
Sbjct: 284 DVRAVETATTDLTNRQNGEDPIQKEIANFYHSGG--DTVADVQFSYTSPYDVVTVGGSGN 341

Query: 320 LMMWDLKQIGAEQTPDDAEDG-VPE----------LIMVHAG-------HRSSVNDFDLN 361
           +  WD++   A    D+A+ G +P+          L  +H G        +   N    +
Sbjct: 342 IYHWDMEY--AMSNYDEADLGNLPQEASEELQAQTLKFLHTGGSRRTAQQKGFRNTVAYH 399

Query: 362 PQIPWLVASAEEENILQVWK 381
           P +  LV + +++ ++ ++K
Sbjct: 400 PVVDGLVGNVDDDGLISIYK 419

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/265 (21%), Positives = 106/265 (40%), Gaps = 50/265 (18%)

Query: 128 PQDPNIVATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVA 186
           P D   +A+ +  GT+ ++  S  +   TL  H ++   + +    +G L SGS D TV 
Sbjct: 245 PGDKPRLASASKDGTIKIWDTSRRVCIYTLSGHTNSVSCVKWGG--QGLLYSGSHDKTVR 302

Query: 187 LWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTID 246
           +W++  GG     +++    H+  +N             ++S +  L++       T   
Sbjct: 303 VWDMNVGGKCINILKS----HAHWVNHL-----------SLSTEYALRVGPFDHTATKFT 347

Query: 247 TV-----KCPQPFNTLAFSH-HSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300
           +      K  + +  +A  +  +  L+  A  D  ++L+D     +PL  ++GH+  VN+
Sbjct: 348 SAEEARKKALENYEKIAKRNGKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNH 407

Query: 301 LEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360
           + FS             N + +W            D  +G    I    GH +SV     
Sbjct: 408 VAFSP-DGRFIVSASFDNSIKLW------------DGRNGT--FISTFRGHVASVY---- 448

Query: 361 NPQIPW-----LVASAEEENILQVW 380
             Q+ W     L+ S  ++  L+VW
Sbjct: 449 --QVAWSSDCRLLVSCSKDTTLKVW 471

>Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429W
           (REAL)
          Length = 652

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALW----------EVGSGGDP--TKPVRTWNDLHSDIINDNKWHNFNKD 222
           R+ SGSDD  + +W           V   G+P   +PV+     H+  +    +H   K+
Sbjct: 96  RIASGSDDSKIGIWNIPESYKFHDHVNEDGEPIDIEPVKFLTG-HARKVGHVLYHPVAKN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D  +K+ DV      I T+K P    +++FS +  N LA    D  + ++++R
Sbjct: 155 VLASSSGDYTVKLWDVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIR 212

Query: 283 NMK 285
           + K
Sbjct: 213 DEK 215

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 39/77 (50%), Gaps = 8/77 (10%)

Query: 163 GYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKD 222
           G+ L +  + K  L S S D+TV LW+V +G D           H D++    + +++ +
Sbjct: 144 GHVL-YHPVAKNVLASSSGDYTVKLWDVETGKD------MITLKHPDMVTSMSF-SYDGN 195

Query: 223 LFGTVSEDSLLKINDVR 239
              TV+ D  L++ ++R
Sbjct: 196 YLATVARDKKLRVWNIR 212

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 1/83 (1%)

Query: 222 DLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDL 281
           D+  +   D+ + + D+R N+ T   V+  +  N L ++       A A  D   Y YD+
Sbjct: 230 DILASTGSDNSIVLYDLRTNSPTQKVVQRMRT-NALCWNPMEPFNFAIANEDHNAYYYDM 288

Query: 282 RNMKEPLHHMSGHEDAVNNLEFS 304
           RNM   LH    H  AV +++FS
Sbjct: 289 RNMSRALHVFKDHVSAVMDVDFS 311

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 44/189 (23%), Positives = 77/189 (40%), Gaps = 28/189 (14%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGD-----------------PTKPVR 201
           H+D  Y L+ +  V  +L SGS D  V  W + +  +                 PT    
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMATREELCSFRAHYGLVTGLCVTPTHLSP 125

Query: 202 TWNDLHSDIINDNK----WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTL 257
           T  D       D+K    W + N D F ++ +D+  KI     +   + T      F ++
Sbjct: 126 TKKDSFMLSCGDDKTIKLW-SVNSDDFNSIKDDT--KIVSDTGDGALLKTFYGEHAFQSI 182

Query: 258 AFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXX 317
              HH  N     G  + + L+D+ N K+PL ++S   D V+ + F+ +           
Sbjct: 183 --DHHRRNPNFVTG-GAQIQLWDV-NRKKPLSNLSWGVDNVSFVRFNQNEEDILASTGSD 238

Query: 318 NRLMMWDLK 326
           N ++++DL+
Sbjct: 239 NSIVLYDLR 247

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 185 VALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTT 244
           + LW+  S   PT  + +W    +D ++  K++    D+F +   D+ + + D+R N+ T
Sbjct: 195 INLWD-SSRSRPTANL-SWG---ADNVSTVKFNQNETDIFASAGSDNSVVLYDLRTNSPT 249

Query: 245 IDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
               +  +  N L ++   +     A  D   Y YD+RN+   LH    H  AV +++FS
Sbjct: 250 QKFTQRMRT-NALCWNPMEAYNFVVASEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFS 308

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 83/211 (39%), Gaps = 19/211 (9%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++   +TL  H +
Sbjct: 128 PVTRSSSAIAG---HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMATLTGHHN 184

Query: 162 NGYALSFSTLVKGRLL-SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
             + L  S    G L+ +GS D+TV LWE  +G    KP       H   I    W   +
Sbjct: 185 --WVLCVSWSPDGELIATGSMDNTVRLWESKTG----KPFGDALRGHGKWITSLSWEPIH 238

Query: 221 ------KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
                 +    T S+D  +KI D      T+         + + +     N L +   D 
Sbjct: 239 LVTPGERPRLATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWG--GQNFLYSGSHDK 296

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            V ++D++N    ++ +  H   VN+L  ST
Sbjct: 297 TVRVWDMKNSGRCINILKNHAHWVNHLSLST 327

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 58/259 (22%), Positives = 104/259 (40%), Gaps = 50/259 (19%)

Query: 134 VATINGQGTVFLYSRSEGLQS-TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +AT +  GT+ ++  +  + + TL  H  +   + +    +  L SGS D TV +W++ +
Sbjct: 248 LATSSKDGTIKIWDTTRRVCTMTLSGHTSSVSCVKWGG--QNFLYSGSHDKTVRVWDMKN 305

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV-----RANNTTIDT 247
            G      R  N L     N   W N       ++S D  L++        +     I  
Sbjct: 306 SG------RCINILK----NHAHWVNHL-----SLSTDYALRVGPFDYTGEQPATPEIAK 350

Query: 248 VKCPQPFNTLAFSH-HSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH 306
            K  + +  +A  +   + L+  A  D  ++L+D     +P+  M+GH+  VN++ FS  
Sbjct: 351 AKALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP- 409

Query: 307 XXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW 366
                      N + +W            D+ DG  + I    GH +SV       Q+ W
Sbjct: 410 DGRHIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASVY------QVAW 449

Query: 367 -----LVASAEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 450 SSDCRLLVSCSKDTTLKVW 468

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 63/138 (45%), Gaps = 17/138 (12%)

Query: 169 STLVKGRLLSGSDDHTVALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGT 226
           ST V G    G+  H   LW+     + +KP+   +W    +D I   K++    D+  +
Sbjct: 185 STFVTG----GAQIH---LWD----SNRSKPISNLSWG---ADNITSVKFNQNEVDILAS 230

Query: 227 VSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKE 286
              D+ + + D+R N+ T   ++  +  N + ++   +     A  D   Y YD+RNM  
Sbjct: 231 TGSDNAIVLYDLRTNSPTQKIIQTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSR 289

Query: 287 PLHHMSGHEDAVNNLEFS 304
            LH    H  AV +++FS
Sbjct: 290 ALHVFKDHVSAVMDVDFS 307

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+ G     +KPV   +W    +D +   K++    D+  +   D+ + + D+R N+
Sbjct: 195 IELWDTGR----SKPVSNLSWG---ADNVTSVKFNQNETDILASTGSDNSVVLYDLRTNS 247

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RNM   L+    H  AV +++
Sbjct: 248 PTQKIVQTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 303 FS 304
           FS
Sbjct: 307 FS 308

>Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429W
           (REAL)
          Length = 645

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALWEV----------GSGGDP--TKPVRTWNDLHSDIINDNKWHNFNKD 222
           R+ SGSDD  + +W +             G+P   KPV+     H+  +    +H   K+
Sbjct: 96  RIASGSDDSKIGIWNIPENYKFHDHADEDGEPIDIKPVKFLTG-HARKVGHILYHPVAKN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D+ +K+ DV      I T+K P    +++FS +  N LA    D  + ++++R
Sbjct: 155 VLASSSGDNTVKLWDVETGKDMI-TLKHPNMVTSMSFS-YDGNHLATVARDKKLRVWNIR 212

Query: 283 NMK 285
           + +
Sbjct: 213 DGR 215

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 84/195 (43%), Gaps = 21/195 (10%)

Query: 164 YALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWHNFNKD 222
           + L      K  LL+G  +  + L +  +G  P + +R      +D+ I D+ +   N  
Sbjct: 17  WCLKLQPAYKHGLLTGLSNGEICLLDWNTG-KPLQKIRASETAINDMKIIDSDFVAGN-- 73

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTV-KCPQPFNTLAFSHHSSNLLAAA----GMDSYVY 277
           L  + S DS+ K+ D+R+N+       +   PF +L   H    LLA      G+D+ ++
Sbjct: 74  LISSASIDSV-KVFDIRSNDCVAKINNETNSPFLSLDSRH---GLLACGTELQGIDAAIH 129

Query: 278 LYDLRNMKEPLHHM-SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDD 336
           +YD+R    PL  +   H D V  ++F                  ++DLKQ       DD
Sbjct: 130 IYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DD 182

Query: 337 AEDGVPELIMVHAGH 351
            ED + ++I   + H
Sbjct: 183 EEDALHQVINYASIH 197

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+       +KP+   TW    +D + + K++    D+  +   D+ + + D+R N+
Sbjct: 195 IQLWD----SSRSKPISNLTWG---ADNVTNVKFNQTETDILASTGSDNSIVLYDLRTNS 247

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RNM   L+    H  AV +++
Sbjct: 248 PTQKIVQSMRS-NAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 303 FS 304
           FS
Sbjct: 307 FS 308

>Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+YV+ +D+R+   P +  S    A + ++++ +          
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 177

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL++     TP          +    GH SSVN  D N      + S+  +  
Sbjct: 178 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 224

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 225 VKFWDYSKS 233

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 4/127 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  ++  + D+  T S D+ +   D+R+ +     T       + + +++   N
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 171

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  ++++DLR    PL  + GH  +VN+++F+               +  WD
Sbjct: 172 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWD 229

Query: 325 LKQIGAE 331
             +   E
Sbjct: 230 YSKSTTE 236

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSEGLQ--STLKFHKDNGYALSFSTLVKGRLLSG 179
           ++ ++  +DPN++A+ +G   +F++   +G     +LK H  +  ++ F+      ++S 
Sbjct: 161 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSS 219

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWN 204
           S+D TV  W+       +K   T N
Sbjct: 220 SNDGTVKFWDYSKSTTESKRTVTTN 244

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 10/172 (5%)

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTL-KFHKDNGYALSFSTLVKGR 175
           H+  +T  +Y   D + + + +  G + ++  +  +   +   H ++   ++FS+    +
Sbjct: 134 HDSAVTTMKY-SHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDSK 191

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W   +G    K  R  +  H D+     WH     L  + S+D+L+K+
Sbjct: 192 FVTCSDDNILKIWNFSNG----KQERVLSGHHWDV-KSCDWHP-EMGLIASASKDNLVKL 245

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
            D R+ N     +K         F     NLL A   D    ++D+R +MKE
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKE 297

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 174 GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
           G + S S D+ V LW+  SG   +  ++         +   ++     +L   +S+D   
Sbjct: 232 GLIASASKDNLVKLWDPRSGNCISSILK-----FKHTVLKTRFQPTKGNLLMAISKDKSC 286

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYD-LRNMKEPLHHMS 292
           ++ D+R +   +  V+    + TL +   + ++   A  D  +  +D L+N+ EP+  + 
Sbjct: 287 RVFDIRYSMKELMCVRDETDYMTLEWHPINESMFTLACYDGSLKHFDLLQNLNEPILTIP 346

Query: 293 -GHEDAVNNLEF 303
             H+  + +L +
Sbjct: 347 YAHDKCITSLSY 358

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/161 (26%), Positives = 71/161 (44%), Gaps = 5/161 (3%)

Query: 127 MPQDPNIVAT--INGQGTVFLYSRSEGLQSTLK--FHKDNGYALSFSTLVKGRLLSGSDD 182
           M  + N+VA+  +N   TV+  S+   +Q  +   F     Y      L   ++L+ S D
Sbjct: 142 MSPNGNLVASAGLNNNCTVYKVSKENRVQQNITSIFKGHTCYISDIDFLDNTQVLTASGD 201

Query: 183 HTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
            T ALW++      T+      D+ +  +  NK +N ++++F +   D    I D+R   
Sbjct: 202 MTCALWDIPKAKRVTEYTDHLGDVLALALPTNKNNNNDENIFASCGSDGYTYIWDIRTPG 261

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRN 283
           +  +     +  NTL F     N +A    D  V LYDLR+
Sbjct: 262 SVQNFFVSNRDVNTLQF-FKDGNSIATGSDDGMVNLYDLRS 301

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 90/218 (41%), Gaps = 39/218 (17%)

Query: 156 LKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNK 215
            + H D   ALSF +     L+SGS D  +  W++ +G    K ++  + + +   ND++
Sbjct: 439 FEIHDDEITALSFDSEA---LISGSKDKKILHWDMATG----KCIQQLDLIFAPTHNDSR 491

Query: 216 WHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
                       S +   ++ D  A    I  ++C +            + LA    D  
Sbjct: 492 --------ISAPSSNYSTRLLDTDA--PMIGALQCYK------------SALATGTKDGI 529

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK-----QIGA 330
           V L+DLR + +P+  + GH D + +L+F +            N + +WDL+      + A
Sbjct: 530 VRLWDLR-VGKPVRLLRGHTDGITSLKFDSE---KLVTGSMDNSVRIWDLRTSSVVDVIA 585

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLV 368
              P  + D   +LI V A  R  VN F++     W+ 
Sbjct: 586 YDLPVTSLDFDDKLIAVGANER-GVNVFNMELDEHWMT 622

>TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON}
           Anc_4.309 YLR429W
          Length = 595

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 58/136 (42%), Gaps = 18/136 (13%)

Query: 175 RLLSGSDDHTVALWEV-------------GSGGDPTKPVRTWNDL--HSDIINDNKWHNF 219
           R+ S SDD  V +WE+             G G   +K +     L  HS  +    +H  
Sbjct: 96  RIASASDDGKVGIWEIPKRYSFGRYRSISGGGFKLSKNITPLKMLVGHSKRVGHVLYHPL 155

Query: 220 NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLY 279
            KD+  + S D+ +KI  V      I T+  P    ++ FS   S L+  A  D  + ++
Sbjct: 156 AKDVLASSSFDNSIKIWRVDTGEDLI-TLLHPDLVTSMCFSFDGSYLVTVA-RDRMIRIW 213

Query: 280 DLRNMKEPLHHMSGHE 295
           D+R  K  + H  GHE
Sbjct: 214 DIRAQK-IISHSLGHE 228

>KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa]
           {ON} Anc_4.309 YLR429W
          Length = 620

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 60/123 (48%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALWE----------VGSGGDP--TKPVRTWNDLHSDIINDNKWHNFNKD 222
           R+ S SDD  +A+WE          V +  +P   KPV+ W   H   +    +H   ++
Sbjct: 96  RIASCSDDSKIAIWEIPEDYSFHKYVDADNEPKDVKPVK-WLAGHGRKVGHVLFHPVAEN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D  +KI +V      + T+K P    +++FS++ ++ LA  G D  + ++D+R
Sbjct: 155 ILASSSLDYTVKIWNVETGE-VVYTLKHPDMVTSMSFSYNGAH-LATVGRDKKLRVWDIR 212

Query: 283 NMK 285
             K
Sbjct: 213 AEK 215

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 104/259 (40%), Gaps = 50/259 (19%)

Query: 134 VATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++ S +   Q TL  H ++   + +    +G L SGS D TV +W++ S
Sbjct: 251 LASSSKDGTIKIWDSVNRVCQYTLSGHTNSVSCVKWGG--QGLLYSGSHDRTVRVWDMNS 308

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTV---- 248
            G      R  N L S       W N       ++S D  L++           T     
Sbjct: 309 QG------RCINILKSHA----HWVNHL-----SLSTDYALRVGAFDHTGKKPATSEEAQ 353

Query: 249 -KCPQPFNTLAFSHHSSN-LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH 306
            K  + +  +   + SS  ++  A  D  ++L++     +P+  M+GH+  VN++ FS  
Sbjct: 354 KKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLVNHVAFSP- 412

Query: 307 XXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW 366
                      N + +W            D  DG  + I    GH +SV       Q+ W
Sbjct: 413 DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVY------QVAW 452

Query: 367 -----LVASAEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 453 SSDCRLLVSCSKDTTLKVW 471

>NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 56/260 (21%), Positives = 108/260 (41%), Gaps = 46/260 (17%)

Query: 161 DNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
           D   +L   T+VK +     +D  + +  V + G P++ +RT +   + + +  ++  F+
Sbjct: 169 DFSLSLDNETIVKSQSNGSEEDSILKI--VDNAGKPSEILRTIHVPGTTVTHTVRF--FD 224

Query: 221 KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLAAAGMDSYVYL 278
             +F + S+D++L+  D R N+  +  +  PQ     +F  S  SS+L  A      + L
Sbjct: 225 NHMFASCSDDNVLRFWDTRTNDKPLWILSDPQNGRMTSFDASTVSSDLFVAGFSTGVLKL 284

Query: 279 YDLR-------------NMKEPL-------HHMSGHEDAVNNLEFSTHXXXXXXXXXXXN 318
           +D R             N +EP+       +H  G  D+V +++FS              
Sbjct: 285 WDARAVESATQDFTNRQNGEEPIQKEIANFYHSGG--DSVVDVQFSPTSPSEILTVGGSG 342

Query: 319 RLMMWDLKQIGAEQTPDDAEDGVPE----------LIMVHAG-------HRSSVNDFDLN 361
            +  WD++   +   P+D  + VP+          L  VH G            N    +
Sbjct: 343 NVYHWDMEYALSNYDPEDT-NRVPQDASEELQTESLRFVHRGGSRRNPQQHGKRNTVAWH 401

Query: 362 PQIPWLVASAEEENILQVWK 381
           P I   V + +E++++ V+K
Sbjct: 402 PVIDDFVGTVDEDSLVTVYK 421

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + ++ SDD+ + +W   +G    K  R  +  H D+     WH     L  + S+D+L+K
Sbjct: 193 KFVTCSDDNILKIWNFSNG----KQERVLSGHHWDV-KSCDWHP-EMGLIASASKDNLVK 246

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           + D R+ N     +K         F     NLL A   D    ++D+R +MKE
Sbjct: 247 LWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKE 299

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 64/304 (21%), Positives = 114/304 (37%), Gaps = 82/304 (26%)

Query: 130 DPNIVATINGQGTVFLYSRSEG--LQSTLKFHKDNGYALSFSTL------VKGRLLSGSD 181
           D  ++AT +   T+ L++   G  +  +L+ H     +L++  L       K RL S S 
Sbjct: 196 DAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPRLASASK 255

Query: 182 DHTVALWEVGSGGDPTKPVRTWN-DLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           D T+ +W      D T  V  +    H+  ++  +W   N  +  T S D  +++ D+ +
Sbjct: 256 DGTIKVW------DTTGRVCLYTLSGHTSSVSCVRWGGQN--MLYTGSHDKTIRVWDMNS 307

Query: 241 NNTTIDTVKCPQ-----------------PFN----------------------TLAFSH 261
           N   I+ +K                    PF+                       +  + 
Sbjct: 308 NGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKALKNYEKIVKKNG 367

Query: 262 HSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM 321
           H+  L+  A  D  ++L++     +PL  M+GH+  VN++ FS             N + 
Sbjct: 368 HTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP-DGRHIVSASFDNSIK 426

Query: 322 MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW-----LVASAEEENI 376
           +W            D  DG  + I    GH +SV       Q+ W     L+ S  ++  
Sbjct: 427 LW------------DGRDG--KFISTFRGHVASVY------QVAWSSDCRLLVSCSKDTT 466

Query: 377 LQVW 380
           L+VW
Sbjct: 467 LKVW 470

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 43/210 (20%), Positives = 81/210 (38%), Gaps = 17/210 (8%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  L+   ++   +TL  H +
Sbjct: 130 PVTRSSSAIAG---HGSTILCSAFAPNSSSRMVTGAGDNTARLWDCDTQTPMATLSGHSN 186

Query: 162 NGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN- 220
               +++S   +  + +GS D+T+ LW   +G    KP+      HS  I    W   + 
Sbjct: 187 WVLCVAWSPDAE-VIATGSMDNTIRLWNGING----KPIGDSLRGHSKWITSLAWEPLHL 241

Query: 221 -----KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSY 275
                K    + S+D  +K+ D                 + + +     N+L     D  
Sbjct: 242 VKVGQKPRLASASKDGTIKVWDTTGRVCLYTLSGHTSSVSCVRWG--GQNMLYTGSHDKT 299

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
           + ++D+ +    ++ +  H   VN+L  ST
Sbjct: 300 IRVWDMNSNGRCINILKSHAHWVNHLSLST 329

>KLTH0B00924g Chr2 complement(79302..81446) [2145 bp, 714 aa] {ON}
           similar to uniprot|P36037 Saccharomyces cerevisiae
           YKL213C DOA1 WD repeat protein required for ubiquitin-
           mediated protein degradation forms complex with Cdc48p
           plays a role in controlling cellular ubiquitin
           concentration also promotes efficient NHEJ in
           postdiauxic/stationary phase
          Length = 714

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 10/106 (9%)

Query: 174 GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
           G  L+ S D TV LWE        K ++T+++LH+D++        + D F + S D  +
Sbjct: 156 GFYLTASADGTVKLWE------GEKVLKTFSNLHTDVVRHLDISP-DGDQFASCSNDGTI 208

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLY 279
           KIND+  N  T+ T+K  + F      +     L + G D  V ++
Sbjct: 209 KINDMDGN--TLRTLKGHESF-VYCVKYTPCGGLVSCGEDRSVRVW 251

>Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W
           (REAL)
          Length = 1152

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+YV+ +D+R+   P +  S    A + ++++ +          
Sbjct: 120 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL++     TP          +    GH SSVN  D N      + S+  +  
Sbjct: 179 GNDIFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGT 225

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 226 VKFWDYSTS 234

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  ++  + D+  T S D+ +   D+R+ +     T       + + +++   N
Sbjct: 113 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 172

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  ++++DLR    PL  + GH  +VN+++F+               +  WD
Sbjct: 173 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSSSNDGTVKFWD 230

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSEGLQ--STLKFHKDNGYALSFSTLVKGRLLSG 179
           ++ ++  +DPN++A+ +G   +F++   +G     +LK H  +  ++ F+      ++S 
Sbjct: 162 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTEIMSS 220

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWN 204
           S+D TV  W+  +    +K   T N
Sbjct: 221 SNDGTVKFWDYSTSTTESKRTVTTN 245

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 33/153 (21%), Positives = 67/153 (43%), Gaps = 22/153 (14%)

Query: 235 INDVRANNTTID---TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEP---L 288
           IND   N+ T     ++K    FN ++ +    +++ A+     +Y+ DL +   P   L
Sbjct: 5   INDGPFNSPTFGKSLSLKVDGGFNAVSINPSGRDVVLASRQG--LYIIDLDDPFTPPRWL 62

Query: 289 HHMSGHEDAVNNLEFSTHXXXXXXXXXXXN-RLMMWDLKQIGAEQTPDDAEDGVPELIMV 347
           HH++  +  V ++++S H           N + ++W+L           A+     +  V
Sbjct: 63  HHITPWQ--VADVQWSPHPAKPYWIVSTSNQKAIIWNL-----------AKSSANAIEFV 109

Query: 348 HAGHRSSVNDFDLNPQIPWLVASAEEENILQVW 380
             GH  ++ D + NPQ P ++A+   +  +  W
Sbjct: 110 LHGHSRAITDINFNPQHPDVLATCSVDTYVHAW 142

>TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {ON}
           Anc_4.309 YLR429W
          Length = 588

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 58/123 (47%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALWE----------VGSGGDPT--KPVRTWNDLHSDIINDNKWHNFNKD 222
           +L S +DD  +A+WE          V   G+P   KPV+  +  H   +    +H   ++
Sbjct: 96  KLASSADDSKIAIWEIPEDYTLKSYVDEDGEPKVIKPVKILSG-HKRKVGHILYHPVAQN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D  +KI D+  N   + T+  P    +++FS++  N LA    D  + ++D+R
Sbjct: 155 VLASSSLDYTVKIWDIE-NEKDMLTLTHPDMVTSMSFSYN-GNFLATVARDKKLRVWDVR 212

Query: 283 NMK 285
             K
Sbjct: 213 EGK 215

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 54/126 (42%), Gaps = 2/126 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           H   I D  +H    ++  T S D+     D+R+       T         + ++H +SN
Sbjct: 113 HFRAITDINFHPLQPEILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWNHKNSN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           +LA +   + VY++D+R    PL  + GH  +VN+++F+               +  WD 
Sbjct: 173 VLATS-HSNIVYVWDVRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDY 231

Query: 326 KQIGAE 331
            ++  E
Sbjct: 232 NKVEDE 237

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/115 (21%), Positives = 49/115 (42%), Gaps = 14/115 (12%)

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           +LA + +D+Y   +D+R+ K+P    S        ++++ H           N + +WD+
Sbjct: 129 ILATSSIDTYALAWDMRSPKKPYFRTSNWRSGAAQVKWN-HKNSNVLATSHSNIVYVWDV 187

Query: 326 KQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVW 380
           ++            G   L ++  GH  SVN  D NP     + S+  +  ++ W
Sbjct: 188 RK------------GTSPLSVLE-GHSGSVNSIDFNPFNETEIMSSGNDGTVKFW 229

>CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa]
           {ON} similar to uniprot|P18851 Saccharomyces cerevisiae
           YOR212w STE4
          Length = 419

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 64/152 (42%), Gaps = 9/152 (5%)

Query: 135 ATINGQGTVFLYSRSEGLQSTLK--FHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           A +N   T++   R   +Q  +   F    GY      + + R+++ S D T ALW++  
Sbjct: 145 AGLNNNCTIYRMPRGSAVQQNVTSIFKGHTGYISGVEFVSESRVVTSSGDMTCALWDI-- 202

Query: 193 GGDPTKPVRTWNDLHSDIINDN-KWHNFNK-DLFGTVSEDSLLKINDVRANNTTIDTVKC 250
                K VR ++D   D++  +    N +K ++F +   D    I DVR+ +        
Sbjct: 203 --PKAKRVREYSDHLGDVLAISIPVTNLSKNNMFASCGSDGYTFIWDVRSPSAVQQFSIG 260

Query: 251 PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
               N L F     N +A    D  + L+DLR
Sbjct: 261 SCDSNCLKF-FPDGNSVAVGNDDGTISLFDLR 291

>KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]
           {ON} similar to uniprot|Q12417 Saccharomyces cerevisiae
           YPL151C PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 434

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 8/125 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ +G    K     + +    I  +K H +   +F + SED L+K  D
Sbjct: 140 TGSNDTTIKIWDLAAG--KLKITLIGHVMSVRDIAISKRHPY---MF-SASEDKLVKCWD 193

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +T+   H S +++A AG D+ V L+D+R+  E +  + GH+  
Sbjct: 194 LERNTAIRDFHGHLSGVHTVDV-HPSLDIIATAGRDAVVRLWDIRSRSE-IMVLPGHKSP 251

Query: 298 VNNLE 302
           +N ++
Sbjct: 252 INKVK 256

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 37/170 (21%), Positives = 67/170 (39%), Gaps = 29/170 (17%)

Query: 213 DNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGM 272
           DN+W       F T S D+ +KI D+ A    I  +        +A S     + +A+  
Sbjct: 134 DNEW-------FATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHPYMFSASE- 185

Query: 273 DSYVYLYDL-RNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM-MWDLKQIGA 330
           D  V  +DL RN    +    GH   V+ ++   H           + ++ +WD++    
Sbjct: 186 DKLVKCWDLERNT--AIRDFHGHLSGVHTVDV--HPSLDIIATAGRDAVVRLWDIRSRSE 241

Query: 331 EQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENILQVW 380
                         IMV  GH+S +N     P  P +++ + +  + ++W
Sbjct: 242 --------------IMVLPGHKSPINKVKCLPVDPQIISCSGDATV-RLW 276

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 77/172 (44%), Gaps = 10/172 (5%)

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTL-KFHKDNGYALSFSTLVKGR 175
           H+  +T  +Y   D + + + +  G + ++  +  +   +   H ++   ++FS+    +
Sbjct: 134 HDSAVTTMKY-SHDSDWMISGDADGMIKIWQPNFSMVKEIDAAHTESIRDMAFSS-NDSK 191

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W   +G    K  R  +  H D+     WH     L  + S+D+L+K+
Sbjct: 192 FVTCSDDNILKIWNFSNG----KEERVLSGHHWDV-KSCDWHP-EMGLIASASKDNLVKL 245

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
            D R+ N     +K         F     NLL A   D    ++D+R +MKE
Sbjct: 246 WDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKE 297

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 88/212 (41%), Gaps = 36/212 (16%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDL--FGTVSEDSLL 233
            +S  DD+T+ +W +    +  K + T  D H D +    +H   K+L    + S+D  +
Sbjct: 68  FVSAGDDYTIKVWSL----ETNKCLYTL-DGHLDYVRTVFFH---KELPWIISASDDQTI 119

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSG 293
           +I + + N   I  +     F   A  H + +L+ +A +D  V ++D+  ++E  H   G
Sbjct: 120 RIWNWQ-NRKEIACITGHNHFVMCAQFHPTEDLIVSASLDETVRVWDISKLREK-HSAPG 177

Query: 294 HEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRS 353
                 + E                       ++I A+Q   D   G   +  +  GH  
Sbjct: 178 RSAMPTSFE-----------------------EKIAAQQNLLDGGFGDCTVKFILEGHTR 214

Query: 354 SVNDFDLNPQIPWLVASAEEENILQVWKCSHS 385
            VN    +P +P +V+  ++  + ++WK S +
Sbjct: 215 GVNWASFHPTLPLIVSGGDDRQV-KLWKMSAT 245

>TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1124

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 57/117 (48%), Gaps = 11/117 (9%)

Query: 218 NFNK---DLFGTVSEDSLLKINDVRANN----TTIDTVKCPQPFNTLAFSHHSSNLLAAA 270
           NFN+   D+  T S D+ +   D+R+ +    TT D +      + + ++   SN+LA++
Sbjct: 121 NFNREHPDILATCSLDTYVHAWDLRSPSRPFYTTSDWISAA---SQVKWNFKDSNILASS 177

Query: 271 GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQ 327
             ++ V ++DLRN   PL  + GH   VN+++F+ +             +  WD  +
Sbjct: 178 HGNN-VCIWDLRNGSVPLKTLKGHTGGVNSVDFNRNKKTELMTCSNDGYVKFWDYSK 233

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 46/200 (23%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVK--- 173
           H   IT   +  + P+I+AT     ++  Y  +  L+S  +        +S ++ VK   
Sbjct: 113 HFRAITDINFNREHPDILATC----SLDTYVHAWDLRSPSRPFYTTSDWISAASQVKWNF 168

Query: 174 --GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDS 231
               +L+ S  + V +W++ +G  P K ++     H+  +N   ++   K    T S D 
Sbjct: 169 KDSNILASSHGNNVCIWDLRNGSVPLKTLKG----HTGGVNSVDFNRNKKTELMTCSNDG 224

Query: 232 LLKINDV-RANNTTIDTVKCPQPF---NTLAFSHHSSNLLAAAGMDSYVYLYDL------ 281
            +K  D  + N+  I +V    P      L F      ++   G D+ VYL  L      
Sbjct: 225 YVKFWDYSKQNDPCIKSVAANFPIWRGRYLPFGDGYC-IMPMVGGDNSVYLMKLSSETDD 283

Query: 282 ---RNMKEPLHHMSGHEDAV 298
               +  EP+  + GH D V
Sbjct: 284 SDNSDQIEPVSILKGHNDTV 303

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 38.9 bits (89), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+     + +KP+   TW    +D +   K++    D+  +   D+ + + D+R N+
Sbjct: 195 IQLWD----ANRSKPISNLTWG---ADNVTSVKFNQTETDILASTGSDNSIVLYDLRTNS 247

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   ++     N + ++   +     A  D   Y YD+RNM   L+    H  AV +++
Sbjct: 248 PT-QKIRQSMRTNAICWNPMEAFNFVIANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVD 306

Query: 303 FS 304
           FS
Sbjct: 307 FS 308

>TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON}
           Anc_8.651 YPL139C
          Length = 475

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 86/390 (22%), Positives = 154/390 (39%), Gaps = 78/390 (20%)

Query: 11  DEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFI------KQELIIGTH 64
           +EEY +WK +VP +Y  +S  R   P    +   T   E    F       K++ ++ T 
Sbjct: 12  NEEYKIWKKSVPFLYQHISSVR---PRFDSRVEDTSKFEKRLTFTDKVVPDKKKGLLTTS 68

Query: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHE------ 118
               + + +   + +LP      + P+ EA E    SLP P       A+ E E      
Sbjct: 69  VLYSQGSDIYEVDCDLPLGAFYRK-PEGEASE----SLPDPDYGDAF-ARAEKEAPAAKW 122

Query: 119 ----EEITRARYMPQ---DPNIVA-TINGQGTVF-------------LYSRSEGLQSTLK 157
               E IT+  YM     D N++A + NG    F             +        S   
Sbjct: 123 TFQGENITKLTYMSNGLADSNVLAMSTNGSLAWFRDGIKVPVHIMQEMMGPGTSFSSIHS 182

Query: 158 FHKDNGYALS-------FSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI 210
           F + +  A+S         TLVK +  +G ++ ++ L  V + G P + +R  N + + +
Sbjct: 183 FKRPDSLAVSDFALSDDCETLVKCQS-NGKEEESI-LKIVDNSGTPGEVLRRIN-VPATV 239

Query: 211 INDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLA 268
            +  ++  F+  LF T S+D++L+  D R    ++  +K P+    ++F  S     L A
Sbjct: 240 THSVRF--FDNHLFATCSDDNVLRFWDTRTEGKSLWELKDPKNGRIMSFDSSPVVDTLFA 297

Query: 269 AAGMDSYVYLYDLRNM-------------KEPL-------HHMSGHEDAVNNLEFSTHXX 308
                  V ++D+R +             ++P+       +H  G  D+V +++FS    
Sbjct: 298 TGTSTGIVKVWDVRAVAAATADYTNRQHGQDPVQNELINFYHSGG--DSVVDVQFSHTSS 355

Query: 309 XXXXXXXXXNRLMMWDLKQIGAEQTPDDAE 338
                      +  WDL    +E   D+A+
Sbjct: 356 SEFLTVGGSGNIYQWDLTYFFSEFDDDNAD 385

>YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coronin,
           cortical actin cytoskeletal component that associates
           with the Arp2p/Arp3p complex to regulate its activity;
           plays a role in regulation of actin patch assembly
          Length = 651

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 15/123 (12%)

Query: 175 RLLSGSDDHTVALWE----------VGSGGDP--TKPVRTWNDLHSDIINDNKWHNFNKD 222
           R+ SGSDD  + +W+          V   G+P   KPV+     H+  +    +H   ++
Sbjct: 96  RIASGSDDSKIGIWDIPENYKFHDHVDEDGEPIDIKPVKFLTG-HARKVGHVLYHPVAEN 154

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR 282
           +  + S D  +K+ +V      I T+K P    +++FS +  N LA    D  + ++++R
Sbjct: 155 VLASSSGDYTVKLWNVETGKDMI-TLKHPDMVTSMSFS-YDGNYLATVARDKKLRVWNIR 212

Query: 283 NMK 285
             K
Sbjct: 213 EEK 215

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 102/262 (38%), Gaps = 27/262 (10%)

Query: 59  LIIGTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRI------- 111
            ++     GE E  +   + NL   IL    P  +  E++ + +  PR+  ++       
Sbjct: 81  CMVAGKDKGESEQMIDIKD-NLYNSILK---PGLKTTEDFITLVYTPRAVFKVKPVTRSS 136

Query: 112 TAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKDNGYALSFST 170
           +A   H   I  + + P   + + T  G  T  ++   ++   STLK H +  + L  S 
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCNTQTPMSTLKGHFN--WVLCVSW 194

Query: 171 LVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN------KDL 223
              G L++ GS D+T+ LWE    G+  +PV      H   I    W   +      K  
Sbjct: 195 SPDGELIATGSMDNTIRLWE----GNKGQPVGDALRGHGKWITSLSWEPIHLVKPGQKPR 250

Query: 224 FGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRN 283
             + S+D  +KI D       I         + + +      +L +   D  +  +D+  
Sbjct: 251 LASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWG--GQGVLYSGSHDKTIRAWDMNL 308

Query: 284 MKEPLHHMSGHEDAVNNLEFST 305
             + ++ +  H   VN+L  ST
Sbjct: 309 GGKCINILKSHAHWVNHLSLST 330

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 105/267 (39%), Gaps = 57/267 (21%)

Query: 129 QDPNIVATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVAL 187
           Q P + A+ +  GT+ ++  +  +   TL  H  +   + +    +G L SGS D T+  
Sbjct: 247 QKPRL-ASASKDGTIKIWDTTRRVCLITLSGHTSSVSCIKWGG--QGVLYSGSHDKTIRA 303

Query: 188 WEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDT 247
           W++  GG     +++    H+  +N             ++S D  L+I    A + T + 
Sbjct: 304 WDMNLGGKCINILKS----HAHWVNHL-----------SLSTDYALRIG---AFDHTSEK 345

Query: 248 VKCPQPFNTLAFSHHSS---------NLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAV 298
              P+     A  ++            L+  A  D  +YL++     +P+  M+GH+  V
Sbjct: 346 PSTPEEAQKRALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLV 405

Query: 299 NNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDF 358
           N++ FS             N + +W            +  DG  + I    GH +SV   
Sbjct: 406 NHVAFSP-DGRHIVSASFDNSIKLW------------NGRDG--KFISTFRGHVASVY-- 448

Query: 359 DLNPQIPW-----LVASAEEENILQVW 380
               Q+ W     L+ S  ++  L+VW
Sbjct: 449 ----QVAWSSDCRLLVSCSKDTTLKVW 471

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 7/115 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + +S SDD+ + +W   +G    K  R  +  H D+     WH     L  + S+D+L+K
Sbjct: 177 KFVSCSDDNILKIWNFSNG----KLERVLSGHHWDV-KSCDWHP-EMGLIISASKDNLIK 230

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKEPL 288
           + D R+ N     +K       + F     N++AA   D    ++D+R +MKE L
Sbjct: 231 LWDPRSGNCVSTILKFKHTVLKVKFQPTGGNMIAAISKDKSCRVFDIRHSMKELL 285

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D I+  K++    D+  +   D+ L + D+R N+ T   V+  +  N + ++   +   
Sbjct: 213 ADNISTVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNF 271

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
             A  D   Y YD+RNM   L+    H  AV +++FS
Sbjct: 272 VVANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFS 308

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 46/223 (20%), Positives = 86/223 (38%), Gaps = 40/223 (17%)

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLF 224
           +  ++T+    ++S S D T  +W++ S    +  V+T    H   + D ++   +  LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQS----SHYVKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 225 GTVSEDSLLKINDVRA---------------------NNTTIDTVKCPQPFNTLAFSHHS 263
            +   D  +++ D+R+                       TT  +         L  S + 
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYD 363

Query: 264 SNLLAAAGMDS-YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMM 322
            N+LA    DS  + + D+RN + P+  + GH  +VN +++               +++ 
Sbjct: 364 PNVLATFAADSNKIIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLY 423

Query: 323 WDL------------KQIGAEQTPDDAEDGVPELIMVHAGHRS 353
           WDL            K  GA  TP +  DG  + +M   G  S
Sbjct: 424 WDLNNSFMEINGGSVKSPGASGTPLEDTDG--DTVMADGGEGS 464

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+V    +  KPV   +W    +D I   K++    D+  +   D+ + + D+R N+
Sbjct: 201 IQLWDV----NRVKPVSNLSWG---ADNITSVKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVIANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 303 FS 304
           FS
Sbjct: 313 FS 314

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 54/265 (20%), Positives = 106/265 (40%), Gaps = 22/265 (8%)

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTL-KFHKDNGYALSFSTLVKGR 175
           H+  +T  +Y      +++  +  GT+ ++  +  +   L + H +    ++FS     +
Sbjct: 123 HDTSVTTMKYSHAGDWMISG-DADGTIKIWQPNFNMVKELDRIHTEGIRDVAFSN-NDSK 180

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++ SDD+ + +W   +G    +  R  +  H D+     WH     L  + S+D+L+K+
Sbjct: 181 FVTCSDDNILKIWNFSNG----QQERVLSGHHWDV-RSCDWHP-ELGLIVSGSKDNLVKL 234

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D R+       +K         F     NLLAA   D    ++DLR     L  +    
Sbjct: 235 WDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNELMCVRDEV 294

Query: 296 DAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 355
           D +  LE+ST              L  +DL Q           D    + ++   H   +
Sbjct: 295 DFM-ELEWSTINESMFTVGCYDGSLKHFDLGQ-----------DTEKPIHIIPFAHEKCI 342

Query: 356 NDFDLNPQIPWLVASAEEENILQVW 380
           +    NP +  ++A+A ++  ++ W
Sbjct: 343 SAIAYNP-VGHILATAAKDRTIRFW 366

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 60/101 (59%), Gaps = 15/101 (14%)

Query: 210 IINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLL 267
           ++N+++ + F   L  T +EDS+ KI D+R+++T + T+K  +  PF +L   H    +L
Sbjct: 63  VLNNDRNNGF---LIATAAEDSV-KIFDLRSSDT-VATLKNEKSAPFLSLDSRH---GML 114

Query: 268 AA----AGMDSYVYLYDLRNMKEPLHHM-SGHEDAVNNLEF 303
           A     +G+D+ +++YD++   +PL  +   H D + N++F
Sbjct: 115 ACGTELSGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKF 155

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 7/113 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + ++ SDD+ + +W   +G    +  RT +  H DI     WH     L  + S+D+L+K
Sbjct: 188 KFVTCSDDNVLKIWNFSNG----QVERTLSGHHWDI-KSCDWHP-EMGLIVSASKDNLVK 241

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           + D R+       +K         F     NLLAA   D    ++D+R +MKE
Sbjct: 242 LWDPRSGQCISTIIKFKHTVLKTRFQPTRGNLLAAISKDKSCRVFDIRHSMKE 294

 Score = 30.8 bits (68), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 24/132 (18%), Positives = 60/132 (45%), Gaps = 7/132 (5%)

Query: 174 GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
           G ++S S D+ V LW+  SG   +  ++         +   ++     +L   +S+D   
Sbjct: 229 GLIVSASKDNLVKLWDPRSGQCISTIIK-----FKHTVLKTRFQPTRGNLLAAISKDKSC 283

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYD-LRNMKEPLHHMS 292
           ++ D+R +   +  V+    + TL ++  + ++      D  +  +D L++++ P H + 
Sbjct: 284 RVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMKYFDLLQDLEGPSHVIP 343

Query: 293 -GHEDAVNNLEF 303
             H+  V ++ +
Sbjct: 344 YAHDKCVTSMAY 355

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+V    +  KPV   +W    +D I   K++    D+  +   D+ + + D+R N+
Sbjct: 201 IHLWDV----NRLKPVSNLSWG---ADNITSVKFNQSETDILASTGSDNSIVLYDLRTNS 253

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 303 FS 304
           FS
Sbjct: 313 FS 314

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 87/219 (39%), Gaps = 47/219 (21%)

Query: 173 KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSL 232
           K  L SGS D TV +W++  GG     +++    H+  +N             ++S D  
Sbjct: 289 KNLLYSGSHDKTVRVWDMNLGGKCINILKS----HAHWVN-----------HLSLSTDYA 333

Query: 233 LKINDVRANNTTIDT-----VKCPQPFNTLAFSHHS-SNLLAAAGMDSYVYLYDLRNMKE 286
           L++           T      K  + +  +A  + S   L+  A  D  ++L++     +
Sbjct: 334 LRVGPFDHTGIMPATPEEARAKALKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTK 393

Query: 287 PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIM 346
           P+  M+GH+  VN++ FS             N + +W            D+ DG  + I 
Sbjct: 394 PISRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DSRDG--KFIT 438

Query: 347 VHAGHRSSVNDFDLNPQIPW-----LVASAEEENILQVW 380
              GH +SV       Q+ W     L+AS  ++  L+VW
Sbjct: 439 TFRGHVASVY------QVAWSSDCRLLASCSKDTSLKVW 471

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 83/217 (38%), Gaps = 31/217 (14%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++    TL  H +
Sbjct: 131 PITRSSAAIAG---HGSTILCSSFAPHTSSRMVTGAGDNTARIWDCDTQTPMVTLSGHTN 187

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
             + L  +    G L++ GS D+T+ LWE  +G    KP       H   I    W   +
Sbjct: 188 --WVLCVAWSPDGELIATGSMDNTIRLWEGKNG----KPFGEAMRGHQKWITSLSWEPLH 241

Query: 221 ------KDLFGTVSEDSLLKINDVRAN------NTTIDTVKCPQPFNTLAFSHHSSNLLA 268
                 +    T S+D  +K+ D          +  +++V C              NLL 
Sbjct: 242 LVKAGERPKLATSSKDGTIKVWDTGRRVCLYTLSGHVNSVSC--------VKWGGKNLLY 293

Query: 269 AAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
           +   D  V ++D+    + ++ +  H   VN+L  ST
Sbjct: 294 SGSHDKTVRVWDMNLGGKCINILKSHAHWVNHLSLST 330

>Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W
           (REAL)
          Length = 1151

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 29/129 (22%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+YV+ +D+R+   P +  S    A + ++++ +          
Sbjct: 119 INFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWN-YKDPNVLASSH 177

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL++     TP          +    GH SSVN  D N      + S+  +  
Sbjct: 178 GNDVFVWDLRK---GSTP----------LCSLKGHVSSVNSIDFNRFKSTELMSSSNDGT 224

Query: 377 LQVWKCSHS 385
           ++ W  S S
Sbjct: 225 VKFWDYSKS 233

 Score = 38.1 bits (87), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 30/127 (23%), Positives = 58/127 (45%), Gaps = 4/127 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  ++  + D+  T S D+ +   D+R+ +     T       + + +++   N
Sbjct: 112 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 171

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  V+++DLR    PL  + GH  +VN+++F+               +  WD
Sbjct: 172 VLASSHGND--VFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTELMSSSNDGTVKFWD 229

Query: 325 LKQIGAE 331
             +   E
Sbjct: 230 YSKSTTE 236

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSEGLQ--STLKFHKDNGYALSFSTLVKGRLLSG 179
           ++ ++  +DPN++A+ +G   VF++   +G     +LK H  +  ++ F+      L+S 
Sbjct: 161 SQVKWNYKDPNVLASSHGND-VFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKSTELMSS 219

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWN 204
           S+D TV  W+       +K   T N
Sbjct: 220 SNDGTVKFWDYSKSTTESKRTVTTN 244

>AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR429W
           (CRN1); 1-intron
          Length = 633

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 11/119 (9%)

Query: 172 VKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDS 231
            +G L S S DHTV LW V  G +P   V T    H D++    + ++      TV  D 
Sbjct: 152 AQGVLASSSLDHTVRLWNVEQGTNPI--VLT----HPDMVTSMSF-SYGGTYLATVCRDK 204

Query: 232 LLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGM----DSYVYLYDLRNMKE 286
           +L++ D+R      + +    P N       +S+ LA  G     D  + ++D  N+++
Sbjct: 205 MLRVWDIRKGEVVSEGMGHSGPKNQRVVWLGNSDRLATTGFSKLSDRQIAVWDAFNLEK 263

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 38.1 bits (87), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 52/91 (57%), Gaps = 12/91 (13%)

Query: 220 NKDLFGTVSEDSLLKINDVRANNT--TIDTVKCPQPFNTLAFSHHSSNLLAA----AGMD 273
           N DLF + S+DS+ KI DVR ++   T+   K   PF +L   H   ++LA     +G+D
Sbjct: 70  NSDLFASASKDSV-KIFDVRTSSCVATLHNDK-SAPFLSLDSRH---DMLACGTELSGVD 124

Query: 274 SYVYLYDLRNMKEPLH-HMSGHEDAVNNLEF 303
           + +++YD++ + +PL   +  H D + + +F
Sbjct: 125 AELHIYDIKKLSKPLRSFVDSHHDDITDTKF 155

>CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa]
           {ON} similar to uniprot|Q12206 Saccharomyces cerevisiae
           YOR229w WTM2 or uniprot|Q12363 Saccharomyces cerevisiae
           YOR230w WTM1
          Length = 435

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 43/198 (21%), Positives = 78/198 (39%), Gaps = 39/198 (19%)

Query: 219 FNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAAAGMDSYV 276
           F+  LF + S+D++++  D R ++  I  +  PQ     T   S  + NL A       +
Sbjct: 231 FDNHLFASCSDDNVIRFWDTRTDDKPIWILSEPQNGRLTTFDVSPITENLFATGFSTGLI 290

Query: 277 YLYDLRNMKEPLHHMSGHE------------------DAVNNLEFSTHXXXXXXXXXXXN 318
            L+D R   E    +S  +                  D+V +++FS              
Sbjct: 291 KLWDARATYEATQDLSYRQNGEDPIQVEMAKVFHSGGDSVVDIKFSETSSSEFVTVGGSG 350

Query: 319 RLMMWDLKQIGAEQTPDDAEDGVPEL---------------IMVHAGHRSSVNDFDLNPQ 363
            +  WD++ + + +  DD ED +P L                 V +G R++V    L+P 
Sbjct: 351 NIYHWDMEYLFS-RNDDDNEDYLPSLEPEELQSHCLKFCQPSRVKSGSRNTVA---LHPM 406

Query: 364 IPWLVASAEEENILQVWK 381
           +  L A+   +N + V+K
Sbjct: 407 VHDLSATISSKNSITVYK 424

>KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {ON}
           similar to uniprot|P53196 Saccharomyces cerevisiae
           YGL004C RPN14 Putative non-ATPase subunit of the 19S
           regulatory particle of the 26S proteasome localized to
           the cytoplasm
          Length = 410

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 7/98 (7%)

Query: 117 HEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGR 175
           H+ EIT  ++ P    +V + +    + ++S  +G    TLK HK  G   + + + +GR
Sbjct: 141 HKAEITDVKFFPSG-QVVLSSSMDMQLKVWSVLDGSNPRTLKGHK--GSITTSAIVDRGR 197

Query: 176 -LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIIN 212
            +LSGS D TV LWE GSG       R+ N   +D IN
Sbjct: 198 NVLSGSKDGTVKLWECGSGEAIHTFARSSN--RTDAIN 233

>KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8.672
           YPL151C
          Length = 398

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 62/129 (48%), Gaps = 8/129 (6%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++ SG      ++     H+  + D      +  +F + SED L+K 
Sbjct: 102 FVTGSNDTTLKVWDLASG-----KLKLTLSGHTMGVRDVAVSERHPYMF-SASEDKLVKC 155

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N    D        +T+   H + +L+A  G D+ V L+D+R  K  +  + GH+
Sbjct: 156 WDLEKNTAIRDYYGHLSGVHTVDI-HPTLDLIATGGRDAVVKLWDIRTRK-AVKTLVGHK 213

Query: 296 DAVNNLEFS 304
             +  ++ +
Sbjct: 214 APITKVKCT 222

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 38.1 bits (87), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 65/304 (21%), Positives = 112/304 (36%), Gaps = 82/304 (26%)

Query: 130 DPNIVATINGQGTVFLYSRSEG--LQSTLKFHKDNGYALSFSTL------VKGRLLSGSD 181
           D  ++AT +   T+ L+   +G  L   L+ H     +LS+  +       K RL S S 
Sbjct: 195 DGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASK 254

Query: 182 DHTVALWEVGSGGDPTKPVRTWN-DLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240
           D T+ +W      D T+ V  +    H+  ++  KW   N  +  + S D  ++  D+ A
Sbjct: 255 DGTIKIW------DTTRRVCIYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAA 306

Query: 241 NNTTIDTVKCPQ-----------------PFN---------------------TLAFSHH 262
               I+ +K                    PF+                      +A  + 
Sbjct: 307 GGKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNG 366

Query: 263 SSNLLAAAGMDSY-VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM 321
           +   L   G D + +YL++     +P+  M+GH+  VN++ FS             N + 
Sbjct: 367 TMEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIK 425

Query: 322 MWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW-----LVASAEEENI 376
           +W            D  DG  + I    GH +SV       Q+ W     L+ S  ++  
Sbjct: 426 LW------------DGRDG--KFIATFRGHVASVY------QVAWSSDCRLLVSCSKDTT 465

Query: 377 LQVW 380
           L+VW
Sbjct: 466 LKVW 469

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 47/211 (22%), Positives = 81/211 (38%), Gaps = 19/211 (9%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++    TLK H +
Sbjct: 129 PVTRSSSAIAG---HGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSN 185

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
             + L  +    G +++ GS D T+ LW+   G      +R     H+  I    W   +
Sbjct: 186 --WVLCVAWSADGEVIATGSMDATIRLWDSEKGQSLGDALRG----HTKWITSLSWEPIH 239

Query: 221 ------KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
                 K    + S+D  +KI D       I T+      +         N+L +A  D 
Sbjct: 240 LVKPGEKPRLASASKDGTIKIWDT-TRRVCIYTLS-GHTSSVSCIKWGGRNVLYSASHDR 297

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            V  +D+    + ++ +  H   VN+L  ST
Sbjct: 298 TVRCWDMAAGGKCINILKSHAHWVNHLSLST 328

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (44%), Gaps = 7/114 (6%)

Query: 174 GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
            + ++ SDD+ + +W   +G    K  R  +  H D+     WH     L  + S+D+L+
Sbjct: 190 SKFVTCSDDNILKIWNFSNG----KQERILSGHHWDV-KSCDWHP-EMGLIASASKDNLV 243

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           K+ D R+ N     +K         F     NLL A   D    ++D+R +M+E
Sbjct: 244 KLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMRE 297

>Kpol_1065.30 s1065 complement(61425..62993) [1569 bp, 522 aa] {ON}
           complement(61425..62993) [1569 nt, 523 aa]
          Length = 522

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 37/150 (24%), Positives = 64/150 (42%), Gaps = 10/150 (6%)

Query: 140 QGTVFLYSRSEGL-QSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTK 198
           QG++ +Y   E      L  H+     L  +T  K  LLS SDDHT+ +W  G+  +P+ 
Sbjct: 329 QGSIVVYQTDEAKPLGRLLGHQRAISVLEMNTTSK-LLLSASDDHTIRIWR-GNSSNPSN 386

Query: 199 PVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLA 258
                   HS  +    W   N D   + S D  +++     N     ++    P  +  
Sbjct: 387 CFYG----HSQSVISASW--LNDDKIISTSMDGSIRVWSHNTNTLVAVSIFDGVPIFSSK 440

Query: 259 FSHHSSNLLAAAGMDSYVYLYDLRNMKEPL 288
            SH+ +   A   MD  V ++D++++ E +
Sbjct: 441 LSHNRTK-FAVGFMDGQVTVFDMKSLLEKI 469

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 37.7 bits (86), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 76/198 (38%), Gaps = 27/198 (13%)

Query: 164 YALSFSTLVKGRLLSGSDDHTVAL--WEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNK 221
           + L      K  LL+G  +  + L  W  G      K   T        IND K    + 
Sbjct: 17  WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASET-------AINDMKVIGSDF 69

Query: 222 DLFGTVSEDSL--LKINDVRANNTTIDTV-KCPQPFNTLAFSHHSSNLLAAA----GMDS 274
                VS  S+  +K+ D+R N+       +   PF +L   H    LLA      G+D+
Sbjct: 70  SAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRH---GLLACGTELQGIDA 126

Query: 275 YVYLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQT 333
            VY+YD+R    PL  +   H D V  ++F                  ++DLKQ      
Sbjct: 127 AVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ------ 180

Query: 334 PDDAEDGVPELIMVHAGH 351
            D+ ED + ++I   + H
Sbjct: 181 -DEEEDALHQVINYASIH 197

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + ++ SDD+ + +W   +G    +  R  +  H D+     WH     L  + S+D+L+K
Sbjct: 179 KFVTCSDDNILKIWNFSNG----QQERVLSGHHWDV-KSCDWHP-QMGLIASASKDNLVK 232

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           + D R+       +K         F     NL+AA   D    ++DLR +MKE
Sbjct: 233 LWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKE 285

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + ++ SDD+ + +W   +G    +  R  +  H D+     WH     L  + S+D+L+K
Sbjct: 179 KFVTCSDDNILKIWNFSNG----QQERVLSGHHWDV-KSCDWHP-TMGLIASASKDNLIK 232

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           + D R+ N     +K         F     NLL A   D    ++D+R +MKE
Sbjct: 233 LWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKE 285

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+V    +  KPV   +W    +D I   K++    D+  +   D+ + + D+R N+
Sbjct: 201 IHLWDV----NRLKPVSDLSWG---ADNITSLKFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RN+   L+    H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVD 312

Query: 303 FS 304
           FS
Sbjct: 313 FS 314

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 37.7 bits (86), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 50/222 (22%), Positives = 84/222 (37%), Gaps = 53/222 (23%)

Query: 173 KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSL 232
           +G L SGS D TV +W++  GG     ++          N   W N       ++S D  
Sbjct: 289 QGVLYSGSHDKTVRVWDMNLGGKCINILK----------NHAHWVNHL-----SLSTDYA 333

Query: 233 LKINDVRANNTTIDTVKCPQPFNTLAFSHH---------SSNLLAAAGMDSYVYLYDLRN 283
           L+        T + +   P+     A  ++         +  L+  A  D  ++L++   
Sbjct: 334 LRRGPFDHTGTKMAS---PEEAREKALKNYEKVVKKNGTTEELMVTASDDFTMFLWNPLK 390

Query: 284 MKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPE 343
             +PL  M+GH+  VN++ FS             N + +W            D  DG  +
Sbjct: 391 SNKPLARMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW------------DGRDG--K 435

Query: 344 LIMVHAGHRSSVNDFDLNPQIPW-----LVASAEEENILQVW 380
            +    GH SSV       Q+ W     L+ S  ++  L+VW
Sbjct: 436 FLSTFRGHVSSVY------QVAWSSDCRLLVSCSKDTTLKVW 471

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 86/217 (39%), Gaps = 31/217 (14%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++   +TL  H++
Sbjct: 131 PVTRSSSAIAG---HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMTTLTGHQN 187

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
             + L  S    G +++ GS D+T+ LWE   G    +P+R     H   I    W   +
Sbjct: 188 --WVLCVSWSPDGEIIATGSMDNTIRLWESDRGKPLGEPLRG----HLKWITSLSWEPLH 241

Query: 221 ------KDLFGTVSEDSLLKINDV--RANNTTI----DTVKCPQPFNTLAFSHHSSNLLA 268
                 K    + S+D  +KI D   R    T+    ++V C               +L 
Sbjct: 242 LVKAGEKPRLASASKDGTIKIWDTVRRVCVYTLSGHTNSVSC--------VKWGGQGVLY 293

Query: 269 AAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
           +   D  V ++D+    + ++ +  H   VN+L  ST
Sbjct: 294 SGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLST 330

>YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subunit
           of the SEA (Seh1-associated) complex, a coatomer-related
           complex that associates dynamically with the vacuole;
           has N-terminal WD-40 repeats and a C-terminal RING
           motif; mtc5 is synthetically sick with cdc13-1
          Length = 1148

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 58/127 (45%), Gaps = 4/127 (3%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSN 265
           HS  I D  ++  + D+  T S D+ +   D+R+ +     T       + + +++   N
Sbjct: 113 HSRAITDINFNPQHPDVLATCSVDTYVHAWDMRSPHRPFYSTSSWRSAASQVKWNYKDPN 172

Query: 266 LLAAA-GMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA++ G D  ++++DLR    PL  + GH  +VN+++F+               +  WD
Sbjct: 173 VLASSHGND--IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSSSNDGTVKFWD 230

Query: 325 LKQIGAE 331
             +   E
Sbjct: 231 YSKSTTE 237

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/85 (23%), Positives = 43/85 (50%), Gaps = 3/85 (3%)

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSEGLQ--STLKFHKDNGYALSFSTLVKGRLLSG 179
           ++ ++  +DPN++A+ +G   +F++   +G     +LK H  +  ++ F+      ++S 
Sbjct: 162 SQVKWNYKDPNVLASSHGND-IFVWDLRKGSTPLCSLKGHVSSVNSIDFNRFKYSEIMSS 220

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWN 204
           S+D TV  W+       +K   T N
Sbjct: 221 SNDGTVKFWDYSKSTTESKRTVTTN 245

>ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL151C (PRP46)
          Length = 425

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 87/204 (42%), Gaps = 25/204 (12%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ +G      ++     H   + D      +  +F + S+D L+K  D
Sbjct: 131 TGSNDSTIRVWDLATG-----KLKVTLQGHIMTVRDICISARHPYMF-SASQDKLVKCWD 184

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +++   H S +L+ +AG DS V ++D+R+ +  +  ++GH   
Sbjct: 185 LERNTVVRDFHGTLSGVHSVDL-HPSLDLIVSAGRDSVVRVWDIRS-RSCVLTLAGHRGP 242

Query: 298 VNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVND 357
           +N +                  + +WDL              G P   + H  H+ +V D
Sbjct: 243 INKVR-CLPVDPQIVSCSTDATVKLWDLVA------------GKPMKTLTH--HKRNVRD 287

Query: 358 FDLNPQIPWLVASAEEENILQVWK 381
              NP   +  ASA  ++I + WK
Sbjct: 288 LAFNP-TEFSFASACTDDI-RSWK 309

>TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa]
           {ON} Anc_1.247 YKR036C
          Length = 589

 Score = 37.7 bits (86), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 73/185 (39%), Gaps = 27/185 (14%)

Query: 154 STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPT-----KPVRTWNDLHS 208
           +TLK HK +  AL    L    ++SGS D TV LW+  S  D T      P+      H 
Sbjct: 291 TTLKSHKSSLTALQ---LDDHLIVSGSKDATVKLWDTKSLADTTNSNINSPLLHTFSSHK 347

Query: 209 DIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQP--------FNTLAFS 260
           D I       F   L  T S D  ++  D+  N   I T+  P P         NTL   
Sbjct: 348 DEITAISL--FQSSLI-TTSLDKTIRHWDLNTNK-NIQTIPLPSPVSVYTSPIINTLQCF 403

Query: 261 HHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRL 320
             +   LA    D  V L+DLR + + +     H D +  L+F+             N +
Sbjct: 404 DAA---LATGSRDGIVRLWDLR-IGKIVRSFEKHNDEITGLKFNNK---QLVSTSLDNSI 456

Query: 321 MMWDL 325
            +WDL
Sbjct: 457 KIWDL 461

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 51/113 (45%), Gaps = 7/113 (6%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + ++ SDD+ + +W   +G    K  RT +  H D+     WH     L  + S+D+L+K
Sbjct: 184 KFVTCSDDNILKIWNFSNG----KQERTLSGHHWDV-KSCDWHP-EMGLIVSASKDNLIK 237

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLR-NMKE 286
           + D R+       +          F     NLLAA   D    ++D+R +MKE
Sbjct: 238 LWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKE 290

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 74/367 (20%), Positives = 131/367 (35%), Gaps = 84/367 (22%)

Query: 2   ENQEKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELII 61
           E+    L V    DL+K      +D V+E  + +P   +QW+P+  +          L I
Sbjct: 130 EDSRNKLQVIHSPDLFK------WDNVAECDVIYPVSNIQWMPSAFRSRKIATASDSLRI 183

Query: 62  GTHTSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEI 121
            +  +  EEN L+  ++NL       + P  +A     S +P   S++  +   E    I
Sbjct: 184 WSLNT--EENKLE-EQLNLSLCKFHKQHPNNKAFVGL-SQIPTKTSDVNPSVLGEFPP-I 238

Query: 122 TRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSD 181
           T   + P D NI                                          L+S S 
Sbjct: 239 TSFHWNPVDTNI------------------------------------------LISSSI 256

Query: 182 DHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVR-- 239
           D T  +W++ S    +  V+T    H   + D ++   +  LF +   D  +++ D+R  
Sbjct: 257 DTTCIVWDLQS----SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCL 312

Query: 240 ANNTTIDTVKCPQPFN------------------TLAFSHHSSNLLAAAGMDSY-VYLYD 280
           A++T I      +P                     L  S H  N+LA   + S  + + D
Sbjct: 313 AHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILD 372

Query: 281 LRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQ------IGAEQTP 334
           +RN   PL  ++GH  ++N +++               +++ WD+        +    TP
Sbjct: 373 MRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDISSYFDQGAVSHTTTP 432

Query: 335 DDAEDGV 341
             A  G 
Sbjct: 433 RPAASGA 439

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 75/198 (37%), Gaps = 37/198 (18%)

Query: 107 SNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFH------- 159
           SN   T    H+ E+   R++ Q   + A+  G G+V ++       ST+ +        
Sbjct: 268 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPPASEPG 327

Query: 160 KDNGYALSFSTLVKGRLL-----SGSDDHTVALWEVGSG-------GDPTKPVRTWNDLH 207
             N  + S ST      L     S  D + +A + + S         +P  P+   N  H
Sbjct: 328 TGNNSSRSDSTDENSHALLRLEPSPHDPNVLATFAIASNEILILDMRNPDSPLVVLNG-H 386

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           S  IN  KWH   K+   + S+D  +   D+ +             F+  A SH ++   
Sbjct: 387 SASINQIKWHPTKKNTLISCSDDCQVLFWDISSY------------FDQGAVSHTTTPRP 434

Query: 268 AAAGMDSYV-----YLYD 280
           AA+G    V     Y YD
Sbjct: 435 AASGASMEVDSEGDYSYD 452

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 83/187 (44%), Gaps = 28/187 (14%)

Query: 159 HKDNGYALSFSTLVKGRLLSGSDDH-TVALWEVGSGGD----PTKPVRTWNDLHSDIIND 213
           HK +   L F+T     L+SGSD +  + +W++ +       P  P+   N++ S   N 
Sbjct: 110 HKGSVKTLKFNTKQSNLLVSGSDKNGEILIWDLNNLDKTPLTPGMPMTPTNEITSLAWNK 169

Query: 214 NKWHNFNKDLFGTVSEDSLLKINDVRANNTTI--------DTVKCPQPFNTLAFSHHSSN 265
           +  H     +F   S  S + I D++A    I        + VK    F+ + +   +S 
Sbjct: 170 SLSH-----VFSCSSNTSNVSIFDLKAKKEVIHLNYTNPVNNVKS--LFSVVEWHPKNST 222

Query: 266 LLAAAGMDS------YVYLYDLRNMKEPLHHMS--GHEDAVNNLEFSTHXXXXXXXXXXX 317
            +A A +++       ++++DLRN   PL  +S  GH + + +L++ +            
Sbjct: 223 RIATATLNNDSTESDSIFIWDLRNSHTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRD 282

Query: 318 NRLMMWD 324
           N +M+W+
Sbjct: 283 NSVMLWN 289

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 37.4 bits (85), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 8/122 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++ SG      ++     H   + D      +  +F + SED L+K  D
Sbjct: 132 TGSNDSTIKVWDLASG-----KLKVTLQGHIMTVKDIAISTRHPYMF-SASEDKLVKCWD 185

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D         ++   H + +L+ +AG DS V ++D+R+ +  +  ++GH+  
Sbjct: 186 LEKNMVIRDFYGTLSGVYSVDV-HPTLDLIVSAGRDSVVRIWDIRS-RTCVMTLAGHKGP 243

Query: 298 VN 299
           +N
Sbjct: 244 IN 245

>Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON}
           (40266..43685) [3420 nt, 1140 aa]
          Length = 1139

 Score = 37.7 bits (86), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 218 NFNK---DLFGTVSEDSLLKINDVRA-NNTTIDTVKCPQPFNTLAFSHHSSNLLAAA-GM 272
           NFN+   D+  T S D+ +   D+R+ N     T +     + + ++    N+LA++ G 
Sbjct: 121 NFNRQHPDILATCSIDTYIHAWDLRSPNRPYYSTSEWRSGASQVKWNFIDPNILASSHGN 180

Query: 273 DSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           D  V ++DLRN   PL  + GH  +VN+++F+               +  WD
Sbjct: 181 D--VCIWDLRNGSTPLCKLLGHTSSVNSVDFNRFKKSEIMTCSNDGTVKFWD 230

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 25/124 (20%), Positives = 51/124 (41%), Gaps = 14/124 (11%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+Y++ +DLR+   P +  S      + ++++            
Sbjct: 120 INFNRQHPDILATCSIDTYIHAWDLRSPNRPYYSTSEWRSGASQVKWN-FIDPNILASSH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N + +WDL+            +G   L  +  GH SSVN  D N      + +   +  
Sbjct: 179 GNDVCIWDLR------------NGSTPLCKL-LGHTSSVNSVDFNRFKKSEIMTCSNDGT 225

Query: 377 LQVW 380
           ++ W
Sbjct: 226 VKFW 229

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 3/71 (4%)

Query: 130 DPNIVATINGQGTVFLYSRSEGLQSTLKF--HKDNGYALSFSTLVKGRLLSGSDDHTVAL 187
           DPNI+A+ +G   V ++    G     K   H  +  ++ F+   K  +++ S+D TV  
Sbjct: 170 DPNILASSHGND-VCIWDLRNGSTPLCKLLGHTSSVNSVDFNRFKKSEIMTCSNDGTVKF 228

Query: 188 WEVGSGGDPTK 198
           W+     D  K
Sbjct: 229 WDYSVNSDTCK 239

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 249 KCPQPFNTLAFSHHS-SNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHX 307
           K  +P  T    HH  +NLLA    D  V ++DL + K  L +++GH  A+  L+F T  
Sbjct: 102 KSSKPAETTFLQHHKETNLLAVGYNDGVVKVWDLYS-KTVLCNLNGHSSAITALKFDTSG 160

Query: 308 XXXXXXXXXXNRLMMWDL 325
                     N +++WDL
Sbjct: 161 TRLISGSRDSN-IIVWDL 177

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 37.4 bits (85), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 1/97 (1%)

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D I   K++    D+F +   D+ + + D+R N+ T   V+  +  N + ++   +   
Sbjct: 213 ADNITTVKFNQNETDIFASAGSDNSIVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNF 271

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
                D   Y YD+RNM   ++    H  AV +++FS
Sbjct: 272 VIGNEDHNAYYYDMRNMSRAINVFKDHVSAVMDVDFS 308

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 95/241 (39%), Gaps = 52/241 (21%)

Query: 77  EINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAK-------YEHEEEITRARYMPQ 129
           E  LP+ +     P E A  EY  +L A +   R+ AK       Y H + +       +
Sbjct: 21  ESQLPRNLNPELHPFERA-REYTKALTATKME-RMFAKPFVGQLGYGHRDGVYVIAKNYR 78

Query: 130 DPNIVATINGQGTVFLY---SRSEGLQSTLKFHKDNGYALSFSTLVKGR----LLSGSDD 182
           + N +AT +  G +  +   +R E       +    G  ++   L K +    +LS SDD
Sbjct: 79  NLNKLATGSADGVIKYWNMSTRDEVCSFKAHYGLITGLCVTPEHLSKNKNDNFMLSCSDD 138

Query: 183 HTVALWEVGSGGDPTKPVRTWNDLHSDIIN--DNKWHNFNKDLFGTVSEDSLLK-INDVR 239
            TV LW V S                D +N  D++  N    L  T   D   + I+  R
Sbjct: 139 KTVKLWSVNS---------------EDYVNLKDDEQLNTTSGLLKTFYSDIAFQGIDHHR 183

Query: 240 ANNTTIDTVKCPQPFN------------------TLAFSHHSSNLLAAAGMDSYVYLYDL 281
           +N+  +      Q ++                  T+ F+ + +++ A+AG D+ + LYDL
Sbjct: 184 SNSNFVTGGAQIQLWDSNRSTPLSNLSWGADNITTVKFNQNETDIFASAGSDNSIVLYDL 243

Query: 282 R 282
           R
Sbjct: 244 R 244

>CAGL0B02013g Chr2 (184252..187614) [3363 bp, 1120 aa] {ON} highly
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128w
          Length = 1120

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 27/129 (20%), Positives = 55/129 (42%), Gaps = 15/129 (11%)

Query: 257 LAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
           + F+    ++LA   +D+YV+ +DLR+   P +  S      + ++++ H          
Sbjct: 120 INFNFQHPDILATCSIDTYVHAWDLRSTSRPFYTTSAWRSGASQVKWN-HMNSNILASSH 178

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEENI 376
            N L +WD+++            G   L  + A   SS+N+ D N      + ++     
Sbjct: 179 GNELFIWDIRK------------GCIPLKKLDAS--SSINNIDFNRFNETEIMTSGNNGE 224

Query: 377 LQVWKCSHS 385
           +++W  S S
Sbjct: 225 VRIWDYSKS 233

>TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8.288
           YDR128W
          Length = 1134

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 54/119 (45%), Gaps = 2/119 (1%)

Query: 207 HSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVK-CPQPFNTLAFSHHSSN 265
           H   I D  +++ + D+  T S D+ +   D+R+ +    T +      + + +S    N
Sbjct: 113 HFRAITDINFNHQHPDILATCSIDTYVHAWDMRSPSRPFYTTREWVAGASQVKWSFKDQN 172

Query: 266 LLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA+A  +  V ++DLR    PL  + GHE  VN+++F+               +  WD
Sbjct: 173 VLASAHGNE-VSIWDLRKGSTPLGKLLGHESGVNSIDFNRFKNDEIMTGSNDGTVKFWD 230

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 58/134 (43%), Gaps = 15/134 (11%)

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAAA----GMDSYV 276
           LF T + +S+ KI D+ +NN  I T+   +  PF +L   H    LLA      G+D+ +
Sbjct: 77  LFSTATAESV-KIFDINSNNGPIATLHNDKNVPFLSLDSRH---GLLAMGTELQGVDAQI 132

Query: 277 YLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPD 335
            +YD+R    PL  +   H D V  L+F                  ++DL Q    Q  D
Sbjct: 133 NIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVYDLTQ----QDED 188

Query: 336 DAEDGVPELIMVHA 349
           DA   V     +H+
Sbjct: 189 DALHQVMNYASIHS 202

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 37.4 bits (85), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 68/172 (39%), Gaps = 41/172 (23%)

Query: 155 TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDN 214
           T   H D   A+S+ T+    L+SGS D T+  W++ SG    K V+T        I+ +
Sbjct: 499 TFSSHLDELTAISYDTI---NLVSGSQDKTIRQWDLLSG----KCVQT--------IDLS 543

Query: 215 KWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
              + N D +           N +      +  ++C                LA    D 
Sbjct: 544 FIKSRNNDFYS----------NQLLGEKPLVGAIQCFDA------------ALATGTKDG 581

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
            V L+DLR+   P+  + GH DAV  L+F +             ++ +WDL+
Sbjct: 582 IVRLWDLRS-GVPVRTLEGHTDAVTALKFDS---SSIVTASSDKQVRIWDLR 629

>NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672
          Length = 434

 Score = 37.0 bits (84), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 89/206 (43%), Gaps = 25/206 (12%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
            ++GS+D T+ +W++  G      ++     H+  + D      +  +F + SED L+K 
Sbjct: 138 FVTGSNDATIKIWDLAKGH-----LKLTLAGHAMTVRDIAISERHPYMF-SASEDKLVKC 191

Query: 236 NDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHE 295
            D+  N    D        +++   H + +L+A AG DS V L+D+R  +  +  + GH+
Sbjct: 192 WDLEKNTAIRDYHGHLSGVHSVDI-HPTLDLIATAGRDSVVRLWDIR-ARVSVMTLIGHK 249

Query: 296 DAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSV 355
             +N +                  + +WD+              G    ++ H  H+ SV
Sbjct: 250 SPINKVH-CLPVDPQIVSCSTDATIRLWDIIA------------GKSRKVLTH--HKKSV 294

Query: 356 NDFDLNPQIPWLVASAEEENILQVWK 381
            D   +P+   +V+++ ++  ++ W+
Sbjct: 295 RDMSFHPREFSMVSASTDD--IRSWR 318

>Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229W
           (REAL)
          Length = 469

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 78/202 (38%), Gaps = 42/202 (20%)

Query: 219 FNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAF--SHHSSNLLAAAGMDSYV 276
           FN  LF + S+D++L+  D R  +  + T+  PQ     +F  S  + NL         +
Sbjct: 257 FNNHLFASCSDDNILRFWDTRTADKPLWTLSEPQNGRLTSFDSSQVTENLFVTGFSTGVI 316

Query: 277 YLYDLR-------------NMKEP-------LHHMSGHEDAVNNLEFSTHXXXXXXXXXX 316
            L+D R             N +EP       L H  G  D+V ++ FS            
Sbjct: 317 KLWDARAVQLATTDLTHRQNGEEPIQNEIAKLFHSGG--DSVVDILFSQTSATEFVTVGG 374

Query: 317 XNRLMMWDLKQIGAEQTPDDAEDGV----PE------LIMVH-AGHRSSVNDFD------ 359
              +  WD+ +    +  DD ED V    PE      L   H  G R S N F       
Sbjct: 375 TGNVYHWDM-EYSFSRNDDDNEDEVQVAAPEELQGQCLKFFHTGGTRRSSNQFGKRNTVA 433

Query: 360 LNPQIPWLVASAEEENILQVWK 381
           L+P I   V + + ++++  +K
Sbjct: 434 LHPVINDFVGTVDSDSLVTAYK 455

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 37.0 bits (84), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 9/183 (4%)

Query: 121 ITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180
           +T   + PQ P+  A  +        SR+     T    KD  Y+ S+     G+LL   
Sbjct: 42  VTHVAFNPQKPHDFAVTSSTRVQVFSSRTRQAIKTFSRFKDVVYSASYRK--DGKLLCAG 99

Query: 181 DDHTVALWEVGSGGDP-TKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDV- 238
           D     L  V    +P T  V      H   +   K+H+ +     + S+D + ++ D+ 
Sbjct: 100 D--ATGLVSVYDSYNPRTLLVSVAASQHPTHVT--KFHDHDLKTLVSASDDRVTRVWDIS 155

Query: 239 RANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAV 298
            A    ++         TL F   + +L+     D  + LYD R   +P H +  H+  V
Sbjct: 156 HAYEPQLELTGAADYVRTLCFVPAAPHLVVTGSYDGALRLYDTRAGSKPQHTLV-HDQPV 214

Query: 299 NNL 301
            N+
Sbjct: 215 ENV 217

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 37.0 bits (84), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 44/212 (20%), Positives = 82/212 (38%), Gaps = 17/212 (8%)

Query: 175 RLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLK 234
           + +S SDD+ + +W   +G    +  R  +  H D+     WH     L  + S+D+L+K
Sbjct: 179 KFVSCSDDNVLKIWNFSNG----QQERVLSGHHWDV-KSCDWHP-KMGLIVSGSKDNLIK 232

Query: 235 INDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGH 294
             D R+ +     +       +  F     NLL+    D    +YD+R   + L  +   
Sbjct: 233 FWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKVYDIRQQAKELFSVRDD 292

Query: 295 EDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSS 354
            D +  L++                +  +DL Q   E  P+     +P        H   
Sbjct: 293 VDYM-TLQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPTHNIP------YAHEKC 342

Query: 355 VNDFDLNPQIPWLVASAEEENILQVWKCSHSL 386
           V     +P I  ++ASA ++  ++ W  S ++
Sbjct: 343 VTSLAYSP-IGHIMASASKDRTIRFWTRSRAV 373

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 57/135 (42%), Gaps = 9/135 (6%)

Query: 174 GRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLL 233
           G ++SGS D+ +  W+  SG      V T       II+  K+     +L   +S+D   
Sbjct: 220 GLIVSGSKDNLIKFWDPRSGS----CVSTMLGFKHTIIS-TKFQPKQGNLLSVISKDKTC 274

Query: 234 KINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKE---PLHH 290
           K+ D+R     + +V+    + TL +      +      D  +  +DL    +   P H+
Sbjct: 275 KVYDIRQQAKELFSVRDDVDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHN 334

Query: 291 MS-GHEDAVNNLEFS 304
           +   HE  V +L +S
Sbjct: 335 IPYAHEKCVTSLAYS 349

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 46/219 (21%), Positives = 83/219 (37%), Gaps = 47/219 (21%)

Query: 173 KGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSL 232
           +G + +GS D T+  W++ +GG     +++    H+  +N             ++S D  
Sbjct: 316 QGVIYTGSHDRTIRCWDMNAGGKCINILKS----HAHWVN-----------HLSLSTDYA 360

Query: 233 LKINDVRANNTTIDTVKCPQPFNTLAFSHHSSN------LLAAAGMDSYVYLYDLRNMKE 286
           LK+       +   T +  Q      +   +        L+A A  D  +YL++     +
Sbjct: 361 LKVGAFDHTYSRPATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTK 420

Query: 287 PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIM 346
           PL  M+GH+  VN++ FS             N + +W              E    + I 
Sbjct: 421 PLTRMTGHQKLVNHVAFSP-DGRYIVSASFDNSIKLW--------------EGSSGKFIS 465

Query: 347 VHAGHRSSVNDFDLNPQIPW-----LVASAEEENILQVW 380
              GH +SV       Q+ W     L+ S  ++  L+VW
Sbjct: 466 TFRGHVASVY------QVAWSSDCRLLVSCSKDTTLKVW 498

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 41/211 (19%), Positives = 80/211 (37%), Gaps = 19/211 (9%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T +G     ++   ++    TLK H +
Sbjct: 158 PVTRSSSAIAG---HSSTILCSTFAPHTSSRMVTGSGDNNARIWDCDTQTPIYTLKGHTN 214

Query: 162 NGYALSFSTLVKGRLL-SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNF- 219
             + L  +    G ++ +GS D+T+ LW+  +G      +R     HS  I    W    
Sbjct: 215 --WVLCVAWSADGEVIATGSMDNTIRLWDAQTGDSKGDALRG----HSKWITSMSWEPIH 268

Query: 220 -----NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
                NK    + S+D  +K+ D       +         + + +      ++     D 
Sbjct: 269 LVTPGNKPRIASASKDGTIKVWDTVRRQCILTLSGHTSSVSCIKWG--GQGVIYTGSHDR 326

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            +  +D+    + ++ +  H   VN+L  ST
Sbjct: 327 TIRCWDMNAGGKCINILKSHAHWVNHLSLST 357

>NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {ON}
           Anc_4.309 YLR429W
          Length = 629

 Score = 37.0 bits (84), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 175 RLLSGSDDHTVALWE------------VGSGGDP--TKPVRTWNDLHSDIINDNKWHNFN 220
           R++S SDD  + +WE            V   G P   KPV+     HS  +    +H   
Sbjct: 96  RIVSSSDDSKIGIWEIPQDYSFHNYKDVDESGSPIDIKPVKFLTG-HSRKVGHVLFHPVA 154

Query: 221 KDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYD 280
            ++  + S D  +K+ ++      I T+K P    +++FS+  S+ LA    D  + ++D
Sbjct: 155 ANVLASSSLDYTVKLWNLETGEAVI-TLKHPDMVTSMSFSYDGSH-LATVSRDKKLRVWD 212

Query: 281 LRNMK 285
           +R  K
Sbjct: 213 IREGK 217

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 57/135 (42%), Gaps = 17/135 (12%)

Query: 223 LFGTVSEDSLLKINDVRANNTTIDT-VKCPQPFNTLAFSHHSSNLLAAA----GMDSYVY 277
           L  + S D++ K+ D+R N        +   PF +L   H    LLA      G+D+ VY
Sbjct: 74  LVSSASIDAV-KVFDIRTNACVAKIHNEANSPFISLDSRH---GLLACGTELQGIDAAVY 129

Query: 278 LYDLRNMKEPLHH-MSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDD 336
           +YD+R    PL   +  H D V  ++F                  ++DLKQ       D+
Sbjct: 130 IYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQ-------DE 182

Query: 337 AEDGVPELIMVHAGH 351
            ED + ++I   + H
Sbjct: 183 EEDALHQVINYASIH 197

>CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa]
           {ON} highly similar to uniprot|Q12417 Saccharomyces
           cerevisiae YPL151c PRP46 Pre-mRNA splicing factor PRP46
          Length = 427

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W + SG      ++     H   + D    N +  +F +VSED  +K  D
Sbjct: 133 TGSNDKTIKIWNLASG-----KLKVTLKAHDMTVRDLAISNRHPYMF-SVSEDKTVKCWD 186

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    +        +T+   H + +++  AG DS V ++D+R  + P+  + GH+  
Sbjct: 187 LEKNTAIRNYHGHLSGVHTVDI-HPTVDVVVTAGRDSVVKVWDIRT-RLPVMTLPGHKGP 244

Query: 298 VNNLE 302
           +  + 
Sbjct: 245 ITKVR 249

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 37.0 bits (84), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 68/160 (42%), Gaps = 18/160 (11%)

Query: 180 SDDHTVALWEVGSGGDPTKPVRTWNDLHSDI-INDNKWHNFNKDLFGTVSEDSLLKINDV 238
           S D ++ LW + +  D  KP+ +   L  D   ND  W + NK + G +   +L   +  
Sbjct: 37  STDSSLELWSLLTT-DSEKPMAS---LQVDSKFNDLDWSHNNKTIAGALDNGTLELYSIG 92

Query: 239 RANNTTIDTVKC---PQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKE--------- 286
            A++T + T K         T+ F+    N+LA+ G +  ++++D+    E         
Sbjct: 93  DAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLT 152

Query: 287 PLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
           P   MS   D VN+L ++             N   +WDLK
Sbjct: 153 PGQSMSS-VDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

>NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340
          Length = 515

 Score = 37.0 bits (84), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 60/262 (22%), Positives = 104/262 (39%), Gaps = 56/262 (21%)

Query: 134 VATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++  S  +   TL  H ++   + +    +G L SGS D TV  W++ S
Sbjct: 251 LASASKDGTIKIWDTSRRVCLYTLSGHTNSVSCIKWGG--QGILYSGSHDKTVRAWDMNS 308

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ 252
            G      R  N L S       W N       ++S D  L++     ++T ++    P+
Sbjct: 309 EG------RCINVLKSHA----HWVNHL-----SLSTDYALRVGPF--DHTGVEPTS-PE 350

Query: 253 PFNTLAFSHHSS---------NLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
                A  ++            L+  A  D  ++L++     +PL  M+GH+  VN++ F
Sbjct: 351 DARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQKLVNHVAF 410

Query: 304 STHXXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQ 363
           S             N + +W            D  DG  + I    GH +SV       Q
Sbjct: 411 SPD-GRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVY------Q 449

Query: 364 IPW-----LVASAEEENILQVW 380
           + W     L+ S  ++  L+VW
Sbjct: 450 VAWSADCRLLVSCSKDTTLKVW 471

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 119/328 (36%), Gaps = 79/328 (24%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + + T  G  T  ++   ++  ++TL  H +
Sbjct: 131 PVTRSSSAIAG---HGSTILCSAFAPNSSSRMVTGAGDNTARIWDCDTQTPKATLTGHTN 187

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
             + L  S    G +++ GS D+T+ LWE  SG    KPV      H   I    W   +
Sbjct: 188 --WVLCVSWCPNGEVIATGSMDNTIRLWEGKSG----KPVGDALRGHLKWITSLAWEPIH 241

Query: 221 ------KDLFGTVSEDSLLKINDV--RANNTTI----DTVKCPQPFNTLAFSHHSSNLLA 268
                 +    + S+D  +KI D   R    T+    ++V C               +L 
Sbjct: 242 LVKAGEQPRLASASKDGTIKIWDTSRRVCLYTLSGHTNSVSC--------IKWGGQGILY 293

Query: 269 AAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQI 328
           +   D  V  +D+ +    ++ +  H   VN+L  ST              L +      
Sbjct: 294 SGSHDKTVRAWDMNSEGRCINVLKSHAHWVNHLSLSTDYA-----------LRVGPFDHT 342

Query: 329 GAEQT-PDDAED-------------GVPELIMVHA----------------------GHR 352
           G E T P+DA D             G  E +MV A                      GH+
Sbjct: 343 GVEPTSPEDARDKALKNYEKVVKKNGRVEELMVTASDDFTMFLWNPLKSTKPLGRMTGHQ 402

Query: 353 SSVNDFDLNPQIPWLVASAEEENILQVW 380
             VN    +P   ++V SA  +N +++W
Sbjct: 403 KLVNHVAFSPDGRYIV-SASFDNSIKLW 429

>TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON} 
          Length = 384

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 51/134 (38%), Gaps = 23/134 (17%)

Query: 204 NDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI-----------NDVRANNTTIDTVKCPQ 252
           N +H   I    W N +   F +  ED ++K+           N + A+   I  VK   
Sbjct: 137 NSIHRGKITGLDW-NVDGKSFASGGEDGIVKLFSFENEKIQESNSIEAHEARITAVK--- 192

Query: 253 PFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXX 312
                   H  ++LLA +  DS   L+DL  M E      GH   + NL+F         
Sbjct: 193 -------YHGCASLLATSSFDSTWKLWDLAKMTELYLQEGGHSTEIFNLDFHPDGSLLSS 245

Query: 313 XXXXXNRLMMWDLK 326
                N  ++WDL+
Sbjct: 246 VGGDGN-CVLWDLR 258

>KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {ON}
           conserved hypothetical protein
          Length = 309

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 64/152 (42%), Gaps = 13/152 (8%)

Query: 158 FHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWH 217
           +H  N    +   L     ++GS D  +AL ++ +G    + +R     H  ++N  +  
Sbjct: 55  YHHGNAAITALDALGDRCAVTGSSDTRLALCDLETG----QLLRGLAG-HRRVVNQVR-- 107

Query: 218 NFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVY 277
              +  F +V +D  LK+ D       +       P   +A    + +L+ A+G++  + 
Sbjct: 108 ALGESRFASVGDDGALKVWDASGAKRPVWQAASEFPLFAVAQDPQNEHLVYASGLEPVIR 167

Query: 278 LYDLRNMKEPLHHMS----GHEDAVNNLEFST 305
            YDLR   +  H  S     H DAV +L+ S 
Sbjct: 168 AYDLRRSAD--HAFSSWPAAHSDAVTSLDVSA 197

>NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8.316
           YDR142C
          Length = 398

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 6/80 (7%)

Query: 259 FSHHSSNLLAAAGMDSYVYLYDLR----NMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXX 314
           FS H  N++A     SY+ L+DLR    N++  +   SG+E     L+F+ +        
Sbjct: 202 FSPHDPNIVACCSGTSYLTLFDLRQPTPNVQRGILTQSGYETLT--LDFNKYRSHIIATS 259

Query: 315 XXXNRLMMWDLKQIGAEQTP 334
                + MWD++ I +  +P
Sbjct: 260 GVDKAIKMWDMRFIPSTFSP 279

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 256 TLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEF 303
           +L F  +S NLL + G D+ V ++D  + +  L    GH  A+N+L+F
Sbjct: 160 SLTFLPNSGNLLLSGGNDNIVKVWDFYHKRNLLRDYKGHSKAINSLDF 207

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 44/227 (19%), Positives = 89/227 (39%), Gaps = 34/227 (14%)

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLF 224
           +  ++T+    ++S S D T  +W++ S    +  V+T    H   + D ++   +  LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQS----SHYVKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 225 GTVSEDSLLKINDVRA-------------------NNTTIDTVKCPQPFNTLAFSHHSSN 265
            +   D  +++ D+R+                      T  ++K       L  S +  N
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPN 363

Query: 266 LLAAAGMDS-YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA    DS  + + D+RN + P+ ++ GH  +VN +++               + + WD
Sbjct: 364 VLATFAADSNKIIILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWD 423

Query: 325 LKQIGAEQTPDDA----------EDGVPELIMVHAGHRSSVNDFDLN 361
           L     E    D+          ED   + +M   G +++  +  LN
Sbjct: 424 LNNSFMEINGSDSKSPTASGASLEDSDGDTVMADGGAKANQQEDPLN 470

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 76/181 (41%), Gaps = 24/181 (13%)

Query: 165 ALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLF 224
           +  ++T+    ++S S D T  +W++ S    +  V+T    H   + D ++   +  LF
Sbjct: 248 SFDWNTVDTNLIISSSIDTTCIVWDLQS----SHYVKTQLIAHDSEVFDVRFLTKSTQLF 303

Query: 225 GTVSEDSLLKINDVRA---------------NNTTIDTV----KCPQPFNTLAFSHHSSN 265
            +   D  +++ D+R+               +  T  T+    K       L  S +  N
Sbjct: 304 ASCGGDGSVRVFDLRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPN 363

Query: 266 LLAAAGMDS-YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWD 324
           +LA    DS  + + D+RN + P+ ++ GH  +VN +++               +++ WD
Sbjct: 364 VLATFAADSNKIIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWD 423

Query: 325 L 325
           L
Sbjct: 424 L 424

>Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W
           (WTM2) - Transcriptional modulator [contig 67] FULL
          Length = 381

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 102/262 (38%), Gaps = 34/262 (12%)

Query: 77  EINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHE-EEITRARYM--PQDPNI 133
           +  LP  + SN +   E   +Y ++        R+ AK+ ++ E IT+  Y+  P+   I
Sbjct: 13  DFQLPLGLHSNSEELPEP--QYSAAFAQASEGGRLEAKWTYQGETITKLEYVGGPEVDAI 70

Query: 134 VATINGQGTVFLYSRSEGLQSTLKFHKD-NGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           V T  G    F     EG +  +   ++  G A SFS +       GS +  +A + V  
Sbjct: 71  VMTSTGSLAWF----KEGCKVPVYVMEELVGPATSFSRINN----KGSGNAILADFAVSE 122

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND-VRANNTTIDTVKCP 251
             D    V++   + +                GT  E SLLKI D  ++    I ++  P
Sbjct: 123 --DTETVVKSQQSMAT----------------GTGEEHSLLKIVDNSQSPGRLIRSICIP 164

Query: 252 QPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSG-HEDAVNNLEFSTHXXXX 310
               T     H +++ +    D+ +  YD R   +PL  +   H+  +   + S      
Sbjct: 165 GTTVTHTIKFHDNHMFSTCSDDNKIRFYDTRGDGKPLWEVCDPHDGRLTCFDVSPALETL 224

Query: 311 XXXXXXXNRLMMWDLKQIGAEQ 332
                    L +WDL+ + A Q
Sbjct: 225 FVTGSDTGVLKLWDLRSVIAAQ 246

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 47/97 (48%), Gaps = 1/97 (1%)

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D + + K++    D+  +   D+ + + D+R N+ T   V+  +  N+L ++   +   
Sbjct: 212 ADNVTNVKFNQNEHDILASTGSDNSIVLYDLRTNSPTQKIVQTMRT-NSLCWNPMEAFNF 270

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
             A  D   Y YD+R M   L+    H  AV +++FS
Sbjct: 271 VTANEDQNSYYYDMRYMSRALNVFKDHVSAVMDVDFS 307

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 208 SDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLL 267
           +D I   K++    D+  +   D+ + + D+R N+ T   V+  +  N + ++       
Sbjct: 219 ADNITSLKFNQSETDIVASAGSDNSVVLYDLRTNSPTQKIVQSMRT-NAICWNPMEPFNF 277

Query: 268 AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS 304
             A  D   Y YD+RNM   L+    H  AV +++FS
Sbjct: 278 VVANEDHNAYYYDMRNMSRSLNVFKDHVSAVMDVDFS 314

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 178 SGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIND 237
           +GS+D T+ +W++  G    K     + +    I  +K H +   LF + SED L+K  D
Sbjct: 137 TGSNDTTIKIWDLAKG--KLKVTLAGHIMTVRDIAISKRHPY---LF-SASEDKLVKCWD 190

Query: 238 VRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
           +  N    D        +++   H + +L+A AG DS V L+D+R  +  +  + GH++ 
Sbjct: 191 LEKNMAIRDYHGHLSGVHSVDI-HPTLDLIATAGRDSVVRLWDIR-ARVAVMTLIGHKNP 248

Query: 298 VNNL 301
           +N +
Sbjct: 249 INKV 252

>CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072c
          Length = 517

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 103/259 (39%), Gaps = 50/259 (19%)

Query: 134 VATINGQGTVFLYSRSEGLQ-STLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGS 192
           +A+ +  GT+ ++  S  +   TL  H ++   + +    +G L SGS D TV  W++  
Sbjct: 253 LASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGG--EGILYSGSHDKTVRAWDMKQ 310

Query: 193 GGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKIN-----DVRANNTTIDT 247
            G     +++    H+  +N             ++S D  L++       V+  N     
Sbjct: 311 NGKCINILKS----HAHWVNHL-----------SLSTDYALRVGAFDYTGVKPANAKEAR 355

Query: 248 VKCPQPFNTLAFSHHS-SNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH 306
            K  Q +  +A  +     L+  A  D  ++L++     +P+  M+GH+  VN++ FS  
Sbjct: 356 DKALQNYEKVARKNGKHEELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSP- 414

Query: 307 XXXXXXXXXXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPW 366
                      N + +WD    G E T           +    GH +SV       Q+ W
Sbjct: 415 DGKYIVSASFDNSIKLWD----GKEGT----------FLSTFRGHVASVY------QVAW 454

Query: 367 -----LVASAEEENILQVW 380
                L+ S  ++  L+VW
Sbjct: 455 SSDCRLLVSCSKDTTLKVW 473

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 84/211 (39%), Gaps = 19/211 (9%)

Query: 103 PAPRSNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLY-SRSEGLQSTLKFHKD 161
           P  RS+  I     H   I  + + P   + V T  G  T  ++   ++  + TL  H++
Sbjct: 133 PITRSSSAIAG---HGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRN 189

Query: 162 NGYALSFSTLVKGRLLS-GSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNF- 219
             + L  S    G +++ GS D+T+ LW+  SG    KP+      HS  I    W    
Sbjct: 190 --WVLCVSWSADGEVIATGSMDNTIRLWDAESG----KPLGDALRGHSKWITSLTWEPIH 243

Query: 220 -----NKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
                +K    + S+D  ++I D       +         + + +      +L +   D 
Sbjct: 244 LVEPGSKPRLASASKDGTIRIWDSSRRVCLMTLGGHTNSVSCVKWG--GEGILYSGSHDK 301

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFST 305
            V  +D++   + ++ +  H   VN+L  ST
Sbjct: 302 TVRAWDMKQNGKCINILKSHAHWVNHLSLST 332

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 19/136 (13%)

Query: 223 LFGTVSEDSLLKINDVRANNTTIDTVK--CPQPFNTLAFSHHSSNLLAAA----GMDSYV 276
           L  + S D++ K+ D+R N + I T++     PF +L   H    LLA      G+D+ V
Sbjct: 74  LVSSASIDAV-KVFDIRTN-SCIATIQNESNSPFLSLDSRH---GLLACGTELQGIDAAV 128

Query: 277 YLYDLRNMKEPLHHM-SGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLKQIGAEQTPD 335
           ++YD+R    PL  +   H D V  ++F                  ++DLKQ       D
Sbjct: 129 HIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ-------D 181

Query: 336 DAEDGVPELIMVHAGH 351
           + ED + ++I   + H
Sbjct: 182 EEEDALHQVINYASIH 197

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/170 (20%), Positives = 70/170 (41%), Gaps = 24/170 (14%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           ++S S D T  +W++ S    +  V+T    H   + D ++   +  LF +   D  +++
Sbjct: 259 IISSSIDTTCIVWDLQS----SHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRV 314

Query: 236 NDVRA-------------------NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS-Y 275
            D+R+                    +TT    K       L  S +  N+LA    +S  
Sbjct: 315 FDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNK 374

Query: 276 VYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           + + D+RN + P+ ++ GH  +VN +++               +++ WDL
Sbjct: 375 IIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 74/152 (48%), Gaps = 20/152 (13%)

Query: 162 NGYALSFSTLVKGRLLSGSDDHTVAL--WEVGSGGDPTKPVRT-WNDLHSDIINDNKWHN 218
           N + L F  L    LL+   +  +++  W+     D  K   T  ND   +I+N+N    
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDF--EIVNNN---- 67

Query: 219 FNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAA----AGM 272
           +N       + +  +KI D+++N+  I T+   +  PF +L   H   N++A     +G+
Sbjct: 68  YNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLH---NMMACGTELSGV 123

Query: 273 DSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEF 303
           D+ +Y+YD+R+   P+   +  H D + +++F
Sbjct: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKF 155

>SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [1326
           bp, 441 aa] {ON} weakly similar to uniprot|Q12206
           YOR229W Saccharomyces cerevisiae WTM2 WD repeat
           containing transcriptional modulator 2
          Length = 441

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 107/253 (42%), Gaps = 45/253 (17%)

Query: 164 YALSF--STLVKGR-LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFN 220
           +ALS    T+VK +  ++GS++ ++ L  V +   P + +RT N   + + +  K+HN  
Sbjct: 178 FALSHDTETVVKTQSRIAGSEESSI-LKIVDNSDKPGELLRTINIPGTTVSHTVKFHN-- 234

Query: 221 KDLFGTVSEDSLLKINDVRAN----------NTTIDTVKCPQPFNTLAFSHHSSNLL--- 267
             LF T S+D+ L+  DVR++          N ++         +TL  +  S+ +L   
Sbjct: 235 NHLFSTCSDDNRLRFWDVRSDKPVWSLSDPKNGSLTCFDVSPVIDTLFVTGTSTGVLKLW 294

Query: 268 ------AAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLM 321
                 A++G D      D       L+H  G  D+V +++F                + 
Sbjct: 295 DLRAVAASSGHDD-----DCTTEIVSLYHSGG--DSVADVQFGFTSPTQFLSVGGSGNVY 347

Query: 322 MWDLKQIGAEQTPDDAEDGVPE------LIMVH-AGHRSSVNDFDLNPQIPW------LV 368
            WDL+ + A  + +D E    E      L  +H  G R S+ + +    + W      +V
Sbjct: 348 HWDLEYLFASGSGEDDEVLDSEELQQQCLKFMHTGGGRRSIGNLNKRGTVSWHEIIDDVV 407

Query: 369 ASAEEENILQVWK 381
              + + +L V+K
Sbjct: 408 GCVDADGLLTVYK 420

>ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR103W
           (SIF2)
          Length = 501

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 73/174 (41%), Gaps = 10/174 (5%)

Query: 124 ARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDH 183
           A ++ QD   +  I G   VF    S+ +   L+ H      ++++   K  LLS SDD+
Sbjct: 288 ATWIDQDKFAIPGIQGSILVFNIGISKPI-GKLRGHSKTLTTIAYNEHNK-LLLSASDDN 345

Query: 184 TVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANNT 243
           T+ +W  G   +P+         HS  I    W   + D   + S D  +++  + +N+T
Sbjct: 346 TLRVWR-GGNLNPSHVFYG----HSQSITSAHW--VDDDTIISTSMDGSIRVWSLASNST 398

Query: 244 TIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDA 297
                    P  T A S       A   +D  V +YD++ + + L+H   H  A
Sbjct: 399 VASATVDGVPNFTGALSPDQGK-FATGTLDGEVMVYDIQKLLQQLNHNGYHGTA 451

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/163 (20%), Positives = 68/163 (41%), Gaps = 17/163 (10%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           L+S S D T  +W++ S       V+T    H   + D ++   +  LF +   D  +++
Sbjct: 264 LISSSIDTTCIIWDLESSNY----VKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRV 319

Query: 236 NDVRANNTTIDTVKCPQPFN------------TLAFSHHSSNLLAAAGMDS-YVYLYDLR 282
            D+R+   +    + P   +             L  S H  N++A    DS  + + D+R
Sbjct: 320 FDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMR 379

Query: 283 NMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDL 325
           N + P+  + GH  ++N +++               +++ WDL
Sbjct: 380 NPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 54/136 (39%), Gaps = 12/136 (8%)

Query: 107 SNIRITAKYEHEEEITRARYMPQDPNIVATINGQGTVFLYSRSEGLQSTLKFHKDNGYAL 166
           SN   T    H+ E+   R++ Q   + A+  G G+V ++       ST+ +        
Sbjct: 281 SNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDGSVRVFDLRSLAHSTIIYEPPAQMDP 340

Query: 167 SFSTLVKGRLL----SGSDDHTVALWEVGSGG-------DPTKPVRTWNDLHSDIINDNK 215
           S S      LL    S  D + VA +   S         +P  PV T    HS  +N  K
Sbjct: 341 SSSAAASNALLRLEPSPHDPNIVATFAADSNKIIILDMRNPETPVLTLQG-HSSSLNQIK 399

Query: 216 WHNFNKDLFGTVSEDS 231
           WH   +++  + ++D 
Sbjct: 400 WHPTERNILLSCADDC 415

>CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly
           similar to uniprot|P20484 Saccharomyces cerevisiae
           YKL021c MAK11 involved in cell growth and replication of
           M1 dsRNA virus
          Length = 388

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 24/126 (19%)

Query: 263 SSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFS--------THXXXXXXXX 314
           S   L +   D ++ +YDL+  KE L  +  H+ ++ NL+FS        +         
Sbjct: 50  SKRYLVSGSNDEHIRIYDLQKRKE-LGTLLAHQGSITNLKFSKVSDQEPKSTSGKWLLSA 108

Query: 315 XXXNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDLNPQIPWLVASAEEE 374
              N++++W +K         D E+          GH + +ND D++P    +VAS  E+
Sbjct: 109 SEDNKIIVWRVK---------DWEN-----FGTLKGHTARINDMDIHPS-NRVVASVSED 153

Query: 375 NILQVW 380
           + +++W
Sbjct: 154 HSIRLW 159

>NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.534
           YKL213C
          Length = 725

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 151 GLQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDI 210
            LQ +L+ H+ + +     ++ +   ++ S D TV LW+        K ++T++ +HSD+
Sbjct: 132 ALQWSLEGHQASVWDAKIISVEENTFITASADRTVKLWK------ENKLLKTFSGIHSDV 185

Query: 211 INDNKWHNFNKDLFGTVSEDSLLKINDVRAN 241
           I + +  +  K++  T S D  +KI+D+  N
Sbjct: 186 IRNIEVLSSGKEI-ATCSNDGTIKISDLDGN 215

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 56/122 (45%), Gaps = 10/122 (8%)

Query: 185 VALWEVGSGGDPTKPVR--TWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRANN 242
           + LW+V    +  KP+   +W    +D I   +++    D+  +   D+ + + D+R N+
Sbjct: 201 IHLWDV----NRLKPISNLSWG---ADNITSVRFNQNETDILASTGSDNSIVLYDLRTNS 253

Query: 243 TTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLE 302
            T   V+  +  N + ++   +     A  D   Y YD+RN+   L     H  AV +++
Sbjct: 254 PTQKIVQTMRT-NAICWNPMEAFNFVTANEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVD 312

Query: 303 FS 304
           FS
Sbjct: 313 FS 314

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 52/126 (41%), Gaps = 30/126 (23%)

Query: 176 LLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKI 235
           +LS SDD TV LW +             +D  +   +DN      + L  T   +S  + 
Sbjct: 136 MLSCSDDKTVKLWSINV-----------DDYSNKRSSDNDSVTNEEGLVRTFDGESAFQG 184

Query: 236 NDVRANNTTIDT---------VKCPQPFNTLA----------FSHHSSNLLAAAGMDSYV 276
            D    N+T  T         V   +P + L+          F+ + +++LA+ G D+ +
Sbjct: 185 IDSHRENSTFATGGAKIHLWDVNRLKPISNLSWGADNITSVRFNQNETDILASTGSDNSI 244

Query: 277 YLYDLR 282
            LYDLR
Sbjct: 245 VLYDLR 250

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 68/172 (39%), Gaps = 36/172 (20%)

Query: 155 TLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDN 214
           T   H D   ALSF +   G L+SGS D TV  W++ SG    K ++T            
Sbjct: 493 TFDSHVDEITALSFDS---GHLVSGSQDRTVRQWDLTSG----KCLQT------------ 533

Query: 215 KWHNFNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDS 274
                +    G +S+ S    + +  +  T   +   Q F+           LA    D 
Sbjct: 534 ----IDLSFAGRLSQTSSNSGSGLLTSTDTSPIIGALQCFDA---------ALATGTRDG 580

Query: 275 YVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTHXXXXXXXXXXXNRLMMWDLK 326
            V L+DLR+ K  +  + GH  AV +L+F +              + +WDL+
Sbjct: 581 AVRLWDLRSGK-IIRTLEGHTGAVTSLKFDSKNLITGSLDRS---VRIWDLR 628

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,961,147
Number of extensions: 2253743
Number of successful extensions: 8070
Number of sequences better than 10.0: 560
Number of HSP's gapped: 7714
Number of HSP's successfully gapped: 737
Length of query: 401
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 289
Effective length of database: 40,638,807
Effective search space: 11744615223
Effective search space used: 11744615223
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)