Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YEL055C (POL5)6.7ON1022102245610.0
Smik_5.326.7ON1020102238400.0
Skud_5.346.7ON1019102237750.0
Suva_5.136.7ON1023102536540.0
NCAS0F001806.7ON1018103722960.0
KAFR0L003306.7ON1028105820540.0
KNAG0E009706.7ON1004103419250.0
TPHA0J002506.7ON1024105417590.0
KLLA0D00792g6.7ON1020105117460.0
ACR020C6.7ON1002104516600.0
NDAI0K029106.7ON106373916410.0
ZYRO0F00440g6.7ON103971116260.0
TDEL0G046406.7ON101772215880.0
TBLA0A072106.7ON1041105615520.0
Kpol_1045.806.7ON101970614880.0
KLTH0C11594g6.7ON1006105114810.0
SAKL0E00770g6.7ON104773413351e-167
CAGL0B03553g6.7ON102171712161e-149
Ecym_30096.7ON102773411871e-145
Kwal_56.223346.7ON100872410881e-131
KLLA0C02541g1.92ON27076761.7
TBLA0A018006.157ON209106724.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YEL055C
         (1022 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...  1761   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...  1483   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...  1458   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...  1412   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   889   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   795   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   746   0.0  
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   682   0.0  
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   677   0.0  
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   644   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   636   0.0  
ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...   630   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   616   0.0  
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   602   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   577   0.0  
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   575   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   518   e-167
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   473   e-149
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   461   e-145
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   423   e-131
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    34   1.7  
TBLA0A01800 Chr1 (439946..440575) [630 bp, 209 aa] {ON} Anc_6.15...    32   4.5  

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
            POL5DNA Polymerase phi; has sequence similarity to the
            human MybBP1A and weak sequence similarity to B-type DNA
            polymerases, not required for chromosomal DNA
            replication; required for the synthesis of rRNA
          Length = 1022

 Score = 1761 bits (4561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 889/1022 (86%), Positives = 889/1022 (86%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN
Sbjct: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
            SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE
Sbjct: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RGI            NEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP
Sbjct: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300
            GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG
Sbjct: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300

Query: 301  NGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA 360
            NGKLENTSHIS          VQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA
Sbjct: 301  NGKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA 360

Query: 361  FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN 420
            FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN
Sbjct: 361  FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTLFAL 480
            AMLFGPHGSINFDKLTKSGTVSKLIAIKELPST               KKGVLSHTLFAL
Sbjct: 421  AMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQLQDKKGVLSHTLFAL 480

Query: 481  DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL 540
            DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL
Sbjct: 481  DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL 540

Query: 541  TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS 600
            TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS
Sbjct: 541  TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS 600

Query: 601  RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEIXXXXXXXXXX 660
            RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEI          
Sbjct: 601  RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEILLSLLAQKKA 660

Query: 661  XXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXXXXXXXXXXXNDAXXX 720
                   IIWQQFIEEVGLEELQILLDILKARENKQGFAQLF            NDA   
Sbjct: 661  LLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFEGEEEFEEIKEENDASED 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALVKALNLPDNIVNDKGEV 780
                                           ILNIDKEATSALVKALNLPDNIVNDKGEV
Sbjct: 721  ESKTGSESESESESDSDDADEKDEEDEANEDILNIDKEATSALVKALNLPDNIVNDKGEV 780

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQS 840
                                             SEIFKRRKEALSSISTGNQRKFEVKQS
Sbjct: 781  DLDQLEGLSDDGGDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKFEVKQS 840

Query: 841  RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD 900
            RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD
Sbjct: 841  RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD 900

Query: 901  RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS 960
            RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS
Sbjct: 901  RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS 960

Query: 961  TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020
            TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD
Sbjct: 961  TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020

Query: 1021 KE 1022
            KE
Sbjct: 1021 KE 1022

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
            YEL055C (REAL)
          Length = 1020

 Score = 1483 bits (3840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 744/1022 (72%), Positives = 824/1022 (80%), Gaps = 2/1022 (0%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            MTGKVNRDLFFKLASDL+EERLHAAVALI+DLSAL+LP DAEEW YVLNRL+KGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
            SARLGFSLCLTEVINLA+NMP GQRPKGLESTN+FL+TLS++L+VNVN+G KKS+KGKDE
Sbjct: 61   SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RGI            NEPLFSEIF+K+ E GNT+FFIRFTE+LIDLALKKNWIKEPCFFT
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            LFQT+KMLLPF+DES A KILLIYDKY++TLTNEGLSTYLLLKY GD++LIPS LDLKN 
Sbjct: 181  LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYGGDKNLIPSTLDLKNL 240

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300
            GWK +DPLARGNLPLLTKVLR+SSVIPD +G  ++TKKQKNTNWNPRLHFVW +LLPLFG
Sbjct: 241  GWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDILLPLFG 300

Query: 301  NGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA 360
            +GKLENT H+S          VQNSIQFPEFWKMA+DESFFNEKASSERKYLGFLIIDAA
Sbjct: 301  SGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFLIIDAA 360

Query: 361  FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN 420
            FK VPGSYIG CFSQNVMRTLINQSIDSQRVLNKI+Q+TL SIVKACEED  N+LVPCLN
Sbjct: 361  FKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTLFAL 480
            +MLFGPHGS+NFDKLTKS TVSKLIAIKELPST                K  L+HT F L
Sbjct: 421  SMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQLQQSKRDLTHTHFIL 480

Query: 481  DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL 540
            DSILHI+RAHKVEI+DMD+MKP+L PI+YMAFFK  +DD +LEQLHELAKERL+SILGEL
Sbjct: 481  DSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERLFSILGEL 540

Query: 541  TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS 600
            T+NKEI  +DPEINSWQ+LTLKLILD+E SH G LINPLDENLE  K EAIS L+++ RS
Sbjct: 541  TMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAISSLAEISRS 600

Query: 601  RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEIXXXXXXXXXX 660
             TAQ+WGLSTLLSMCL+QLYAG+TDSISVIEELCEFSK +NNSMVGITEI          
Sbjct: 601  STAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKDKNNSMVGITEILLSLLAQKKA 660

Query: 661  XXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXXXXXXXXXXXNDAXXX 720
                   IIWQQFIE+VGLEELQ+LLD+LKARENKQGFAQLF                  
Sbjct: 661  LLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQLFEGEGEFEEIKEE--ESAS 718

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALVKALNLPDNIVNDKGEV 780
                                           ++NIDKEATSALVKALNLPDNIVNDKGEV
Sbjct: 719  EDESKSEGDSESESNSDDADEKDEEDDANEEVVNIDKEATSALVKALNLPDNIVNDKGEV 778

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQS 840
                                             SEIFKRRKEALS+ISTGNQRK EVK+S
Sbjct: 779  DIDQLEGLSDDDEDDEDEESMDDEKMMELDGQLSEIFKRRKEALSNISTGNQRKVEVKES 838

Query: 841  RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD 900
            RENVISFKHR+VDML VYVKYCEKL LANKSE S+++G  LSKLVYFIIP+LKC+NETLD
Sbjct: 839  RENVISFKHRIVDMLTVYVKYCEKLALANKSEDSSSIGSPLSKLVYFIIPILKCINETLD 898

Query: 901  RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS 960
            RPLADKISKLLKGKIFKIKV AFK+M+K+IE+MDLLK THK++LTSKPGQH AVFYS CS
Sbjct: 899  RPLADKISKLLKGKIFKIKVNAFKEMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSACS 958

Query: 961  TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020
            TSSLFLSKLYVEI GNDKLDELIDLY ATTKEW  +GK G N+FIDFINWLSSKKQ V D
Sbjct: 959  TSSLFLSKLYVEIHGNDKLDELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKKQNVED 1018

Query: 1021 KE 1022
            ++
Sbjct: 1019 EK 1020

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
            YEL055C (REAL)
          Length = 1019

 Score = 1458 bits (3775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1022 (71%), Positives = 812/1022 (79%), Gaps = 3/1022 (0%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            MTGKVNRDLFFKLASDL+EERLHAAVALIKDLSAL+LP DAEEWSYVLNRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
            SARLGFSLCLTEV+NL +NMP GQRPKGLES NEFL TLS+IL++ VN+G+KK +KGKDE
Sbjct: 61   SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RGI            NEPLFSEIFV D++KGNTEF IRF EQLIDLAL+KNWI+EPC F+
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            LFQT+KMLLPFM+ES+A KILLIYDKYDLTLTNEGLSTYL+LKYE DESLIPS LDL+N 
Sbjct: 181  LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVLKYESDESLIPSTLDLRNS 240

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300
            GWK+NDPLARGNLPLLTKVLR+SSV+PD NG L++ KKQKN NWNPRLHFVW VLLPLFG
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVLLPLFG 300

Query: 301  NGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAA 360
            +GKLENT HI+          VQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 
Sbjct: 301  SGKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAT 360

Query: 361  FKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLN 420
            FK VPGS IG CFSQNVMRTLINQSIDSQR+LNKI+Q+TL+SIVKACEED   +LVPCLN
Sbjct: 361  FKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKLVPCLN 420

Query: 421  AMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTLFAL 480
            AMLFGPHGSINFDKLTKS  +SKLIAIKELPS                K+G L HT F L
Sbjct: 421  AMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQLQEKRGDLPHTHFIL 480

Query: 481  DSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL 540
            DS+LHI+RAHKVEIND+ I+KPVL PI++MAFFKH +D+ + EQLHELAKERLYSILGEL
Sbjct: 481  DSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLYSILGEL 540

Query: 541  TINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCRS 600
            TINKE+  +DP+INSWQYLTL LILDIE S+  DLINPLDE+LE IKNEAIS L+++ +S
Sbjct: 541  TINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSLAEISKS 600

Query: 601  RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEIXXXXXXXXXX 660
             T QSWGLSTLLSMCL+QLYAG+TDSISVIEELCEF+KH+NNSMVGITEI          
Sbjct: 601  NTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTKHDNNSMVGITEILLSFLAQKKA 660

Query: 661  XXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXXXXXXXXXXXNDAXXX 720
                   IIWQQFIE+VGLEELQILLD+LKARENKQGFAQLF                  
Sbjct: 661  LLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLFEGEGEFEEINEE--ENAN 718

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALVKALNLPDNIVNDKGEV 780
                                           ++NIDKEAT AL+KAL+LPDNIVNDKGEV
Sbjct: 719  EGDSKSESESESESDSDESNEKDEEDEANEDVVNIDKEATGALIKALHLPDNIVNDKGEV 778

Query: 781  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQS 840
                                             SEIFKRRKEALS+ISTGNQRK EVK+S
Sbjct: 779  -DMNQLGGLSDDDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVKES 837

Query: 841  RENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLD 900
            RENVISFKHR+VDML VYVKYCEKL +ANK E+S+NL G LSKLVYFI+PMLKC+ ETLD
Sbjct: 838  RENVISFKHRIVDMLTVYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLD 897

Query: 901  RPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCS 960
            +PLADKISKLLKGKIFKIK   FK ++K+IELM+LLK TH+LMLTSKPGQHA+VF+S CS
Sbjct: 898  KPLADKISKLLKGKIFKIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACS 957

Query: 961  TSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020
            TSSLFLSKLY EIGGN+ LDELIDLY ATTKEWM KGK   N+FIDF NWLSSKKQ V+D
Sbjct: 958  TSSLFLSKLYFEIGGNNALDELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQNVLD 1017

Query: 1021 KE 1022
            K+
Sbjct: 1018 KK 1019

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
            YEL055C (REAL)
          Length = 1023

 Score = 1412 bits (3654), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/1025 (69%), Positives = 801/1025 (78%), Gaps = 6/1025 (0%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            MTGKVNRDLFFKLASDL+EERLHAAVALIKDLSAL+LP D+EEWSYVLNRLIKGL+SDRN
Sbjct: 1    MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
            SARLGFSLCLTEVINLA+NMP GQRPKGLES N+FL TLS IL++NVNE  KK +KGKDE
Sbjct: 61   SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RGI            NEPLFS IFV+DL++GNTEF IRF EQLIDLAL+KNWIKEPC ++
Sbjct: 121  RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            LFQT+KMLLP M+ES+A +ILL YDKYDLTLTNEGLSTYLLLKYE D+ L+PS L LKN 
Sbjct: 181  LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKDLVPSTLGLKNL 240

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKE-TKKQKNTNWNPRLHFVWSVLLPLF 299
            GWK+NDPLARGNLPLLTKVLR+S+V PD NG  ++ TKKQKNTNWNPRLHFVW++LLPLF
Sbjct: 241  GWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNILLPLF 300

Query: 300  GNGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDA 359
            G+GKLEN  HIS          V +SIQFPEFW+MAVDESFFNEKASSERKYLGFLIIDA
Sbjct: 301  GSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGFLIIDA 360

Query: 360  AFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCL 419
             FK VPGS IG+CFS+NVMRTLINQSIDSQR+LNKI+Q+TLDSI+KACEED  N+LVPCL
Sbjct: 361  TFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNKLVPCL 420

Query: 420  NAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTLFA 479
            +AMLFGPHGSINFDKLTK+   SKLIAIKELP+T               KK  L HT F 
Sbjct: 421  SAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQLQEKKDDLPHTHFV 480

Query: 480  LDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGE 539
            LDS+LHI+RAHK EIND++I+KPVL PIVYMAFFKH +DD + EQLHELAKERLYSILGE
Sbjct: 481  LDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERLYSILGE 540

Query: 540  LTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCLSKVCR 599
            LTINKE+R +DP+INSWQ+LTL+LILD+E SH GDL NPLDE LE  KNEAIS L+++ +
Sbjct: 541  LTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISSLTEISK 600

Query: 600  SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNSMVGITEIXXXXXXXXX 659
            S T+QSWGLSTLLSMCL+QLYAG+TDSISVIEELCEF+K EN+SMVGITEI         
Sbjct: 601  SNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKDENSSMVGITEILLSLLAQKK 660

Query: 660  XXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXXXXXXXXXXXNDAXX 719
                    IIWQQFI +VGL+ELQILLD+LK RENKQGFA LF              A  
Sbjct: 661  ALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALLFEGEGEFEEVDEEESA-- 718

Query: 720  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALVKALNLPDNIVNDKGE 779
                                            ++NIDKEATSAL+KALNLPDNIVNDKGE
Sbjct: 719  VEDESKSESESDSDSESNDDEERDEEDEANEDVVNIDKEATSALIKALNLPDNIVNDKGE 778

Query: 780  VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXSEIFKRRKEALSSISTGNQRKFE 836
            V                                    SEIFKRRKEALSSISTGNQRK E
Sbjct: 779  VDMDQLEGISDDGDGGDDDEDEESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKVE 838

Query: 837  VKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVN 896
            VK+SRENVI+FKHR+VDML +YVK+CEKL +ANK E S  +GG LS LVYFIIPM+KC+ 
Sbjct: 839  VKESRENVIAFKHRIVDMLTIYVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIK 898

Query: 897  ETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFY 956
            ETLDRPLADKISKLLKGKIFKI+ +AFKD++K IEL+DLLK  HK MLTSKPGQHA VF+
Sbjct: 899  ETLDRPLADKISKLLKGKIFKIRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFF 958

Query: 957  SMCSTSSLFLSKLYVEIGGNDKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQ 1016
            S CSTSSLFLSKLYV+I GNDK D+LIDLY +TTK+W QKGK G NIFIDFINWLSSKK+
Sbjct: 959  SACSTSSLFLSKLYVDINGNDKFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018

Query: 1017 TVMDK 1021
             V  K
Sbjct: 1019 GVEKK 1023

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
            YEL055C
          Length = 1018

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1037 (48%), Positives = 656/1037 (63%), Gaps = 41/1037 (3%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            M  KVNRDLF+KLASDL+EER  AA++L+K+L+ L LPD+ EEW+YV+NRLIKGL+SDR+
Sbjct: 1    MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVN---EGTKKSMKG 117
            SARLGFSLCLTEVINLA++M     P+GL++ ++FL  LS  L+++ N   +G  K  KG
Sbjct: 61   SARLGFSLCLTEVINLALSMKENA-PEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKG 119

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSEIFV--KDLEKGNTEFFIRFTEQLIDLALKKNWIKE 175
            +DERG+            NEP+FS +F+  KD +   T F  +F  +++DLALKKNWIKE
Sbjct: 120  RDERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKE 179

Query: 176  PCFFTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKY--EGDESLIPS 233
             C FTLFQT++ LLP+ ++ +   IL + D ++L+LT+EGL+ YL + Y    D  L  S
Sbjct: 180  SCLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLDTS 239

Query: 234  VLDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWS 293
             ++ KNPGWK+NDPL+RGNLPLLT+VLR+SSV   + G  + +KKQ  +NWNPRLHFVW 
Sbjct: 240  SIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEG-YENSKKQNASNWNPRLHFVWD 298

Query: 294  VLLPLFGNGK---LENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERK 350
            +LLP+  +GK     NT HIS           ++ I+FPEFW+M VDESFFNEKASSERK
Sbjct: 299  ILLPILISGKHTTASNTQHISKKRKKNNNELPKH-IEFPEFWQMVVDESFFNEKASSERK 357

Query: 351  YLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEED 410
            YLGFLI     K V  + +  CFS N MR+LINQS DS+R+L+K+SQ  L++I++ C+ED
Sbjct: 358  YLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQED 417

Query: 411  SANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKK 470
            S+N+LV C+NAM+FGP GSINFDKLTKS T+SKLI+I  L                  K 
Sbjct: 418  SSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKS 477

Query: 471  GVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAK 530
                   + LD++LHIVR HK  +    I+ P+L P++  AFF   +     E L+ELAK
Sbjct: 478  ENKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKEN-----EPLNELAK 532

Query: 531  ERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEA 590
            ER  SIL ELT    +  K+P  +SWQY  L +IL  E +   +L+N LDENL  IKN+A
Sbjct: 533  ERFSSILAELT---SVIPKEPH-HSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDA 588

Query: 591  ISCLSKVCRS-RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH-----ENNSM 644
               + K+ +S ++ Q  GL +LLSMCL+QL++G+T+S+S IEEL EF K      E+ S+
Sbjct: 589  CDVIVKIIKSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSL 648

Query: 645  VGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXX 704
            VGITEI                 ++W+QFI  VG EEL ILLD+LKARENKQGFA LF  
Sbjct: 649  VGITEILLSLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFEG 708

Query: 705  XXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALV 764
                       +                                   + NIDKEATSAL 
Sbjct: 709  ADEYEEIEDEQEGESNQSEEKDVSGEESEESEESEIDDEDDSLDTAEVNNIDKEATSALA 768

Query: 765  KALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----XXSEIFKRR 820
            KALNLP+NIVNDKGEV                                     SEIFKRR
Sbjct: 769  KALNLPENIVNDKGEVDVAKLEALSDSDMDDDDDDSDEESMDDEKMMLLDDQLSEIFKRR 828

Query: 821  KEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGS 880
            KEALS+ STGNQRK E K+SRENVI+FK RVVD+L VYVKY EKL  A+ S+   N    
Sbjct: 829  KEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTVYVKYVEKLQTADHSQKFVN---- 884

Query: 881  LSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELMDLLKKTH 940
               L+ F+ PM+ CV +TLD+ LADK+SKLLK +IFKIK + FK+    +E+++ LKK H
Sbjct: 885  ---LISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKIKSSTFKNSANPVEVLEYLKKLH 941

Query: 941  KLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND--KLDELIDLYTATTKEWMQKGK 998
            + +LT KPGQH  ++Y++ S++SLF SK+YV    ++    ++LID Y+ TTK WM K K
Sbjct: 942  EKLLTEKPGQHPQLYYTLSSSASLFFSKIYVASSTDETNAYNKLIDQYSNTTKSWMSKSK 1001

Query: 999  CGPNIFIDFINWLSSKK 1015
             GPN F DF NWL+S+K
Sbjct: 1002 FGPNFFADFFNWLASRK 1018

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
            Anc_6.7 YEL055C
          Length = 1028

 Score =  795 bits (2054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/1058 (45%), Positives = 636/1058 (60%), Gaps = 75/1058 (7%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            M+GKVNRDLF+KLAS+L EERL AAV++I++LSAL LPD  EEW+YVL RLIKGLSSDR 
Sbjct: 4    MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61   SARLGFSLCLTEVINLAVNMP-PGQRPKGLESTNEFLSTLSTILNVNV-NEGTKKSMKGK 118
             ARLGFSLCLTEVINLA+++   G     L + +++L+ LS  L+++  N+   K MKGK
Sbjct: 64   GARLGFSLCLTEVINLAIDLAGKGVELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKGK 123

Query: 119  DERGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCF 178
            DERG+            NEPLFS+ F+ + +K  + F  RF  +L+DLA +KNWI+EPC 
Sbjct: 124  DERGLLFGKMFGLKALLNEPLFSKTFLPN-KKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 179  FTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIP-----S 233
            FTLFQT++ LLPF D    + +L + D +  TLTNEGL+ YLLL ++G E          
Sbjct: 183  FTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLHKGPEKGKEFNDKIK 242

Query: 234  VLDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQK--NTNWNPRLHFV 291
            +L LKN  WK NDPLARGNLP LT+VLR SS+         E KK +  + NW PRLHFV
Sbjct: 243  LLVLKNSSWKLNDPLARGNLPRLTQVLRESSLAS-------EEKKVEVMSANWQPRLHFV 295

Query: 292  WSVLLPLFGNGKLENTS---HISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSE 348
            W +LLP      +E+ S   H+S              I+FPEFW+M VDESFFNEKASSE
Sbjct: 296  WDILLPTVST--IESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSE 353

Query: 349  RKYLGFLIIDAAFKAVPGS-YIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKAC 407
            RKYLGF I + A   V    +   CFSQN MR+LINQS D+ R+L+KIS   +++IVKAC
Sbjct: 354  RKYLGFSIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKAC 413

Query: 408  EEDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXX 467
            EE  + +L+P ++++LF  +GS NFDKLTKS TVSKLI+I  L  T              
Sbjct: 414  EESPSTKLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGL--TLHTLLQLFDMLTSQ 471

Query: 468  XKKGV---LSHTLFALDSILHIVRAHKVEINDMD--------IMKPVLRPIVYMAFFKHT 516
             K G       T F LDS+LHIVR+HK +I D          I+K  + P+V +AFF  T
Sbjct: 472  IKVGTSEDFKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQT 531

Query: 517  S----DDLKLEQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHV 572
                 +D    Q+ ELAKERL+S+L ELT        + +++SWQY TL  I+D EN + 
Sbjct: 532  DIAKKEDESDNQVDELAKERLFSVLSELTT-----TTNKQLHSWQYYTLLEIIDRENENP 586

Query: 573  GDLINPLDENLENIKNEAISCL----SKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSIS 628
              LIN +D++L+ +++ AI  +    SK  ++ ++   GL +LLSMCL+QLY+GD DS++
Sbjct: 587  NSLINKMDDDLKTVRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVA 646

Query: 629  VIEELCEFSK-----HENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQ 683
             IEEL  F        E  +MVGITEI                 ++W+QF+ E+  + L 
Sbjct: 647  TIEELITFYNASRDVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLN 706

Query: 684  ILLDILKARENKQGFAQLFXXXXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXX 743
            +LLD+L ARENKQGFA+LF             +                           
Sbjct: 707  LLLDVLPARENKQGFAELFENADEYEEDDEEENEYKEENESDDESSSDDEDDEEGDEDDE 766

Query: 744  XXXXXXXXILNIDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXX 803
                    I  IDKEATSAL KALNLPD+I+N+ GEV                       
Sbjct: 767  GAEGGNEAIAKIDKEATSALAKALNLPDDIINENGEV---NFDDLSDGSDISSDEESLDD 823

Query: 804  XXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCE 863
                      +EIFKRRKEALSS+STGNQRK EVK+SRE+VI+FKHRV D+L++Y+K+ E
Sbjct: 824  EKMMELDDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSIYIKHAE 883

Query: 864  KLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAF 923
               L  K              + FI PM+KCV +TLD+ LADKISKLLK K++K+K    
Sbjct: 884  DSELPAKYA------------ILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKLKTKNM 931

Query: 924  KDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKLD--- 980
            +++  + ++ D +   H+ +LTSKPGQ+   FYS+CS++S+FLSKL + +  NDK +   
Sbjct: 932  EEITAE-QVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLV-SNDKEEAYG 989

Query: 981  ELIDLYTATTKEWMQK-GKCGPNIFIDFINWLSSKKQT 1017
            +++D+Y+ TTK+W+ K  K G NIFIDF NWLSSKK T
Sbjct: 990  KIVDIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKKST 1027

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
            YEL055C
          Length = 1004

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1034 (42%), Positives = 614/1034 (59%), Gaps = 50/1034 (4%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            MTGKVNRD F+KLASDL EERL AAV+LIK+LS+L LP   +EWSYV+NRLIKGLSSDRN
Sbjct: 1    MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
             ARLGFSLCLTEV++LA+ M   + P+ L+S + FL  LS   +++  +  KK    + E
Sbjct: 61   GARLGFSLCLTEVVDLAIKMDDDKAPEELKSMDSFLHLLSKTFSIDPQDEKKKRKGKE-E 119

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RG+            NEPLFS+IF+KD     T+F  +F ++L++LA +KNWIK+PC FT
Sbjct: 120  RGLMFGKLFALQALLNEPLFSDIFIKD--GKITKFTTKFIDELVNLASRKNWIKQPCLFT 177

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            L+QT++ LLP+ D+S  + ++ + D    TLTNEGL+ YLL   +G  S + S+ ++ N 
Sbjct: 178  LYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSI-NVTNK 236

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300
            GWK N+PL +GNL L+++V+R S+V+ D N    ETK   N NW+P+LHFVW +LLP+  
Sbjct: 237  GWKYNNPLLKGNLSLVSEVVRESAVVVDDN----ETKTN-NANWHPKLHFVWDILLPILY 291

Query: 301  NGKLENT---SHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357
            N   E                      +I+FPEFWK  VDE++F++KASSERK+LG LI 
Sbjct: 292  NDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKFLGLLIF 351

Query: 358  DAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVP 417
              A   VP  +I  CFSQN+MR LINQ  DS+R L+KI++  L SIVK CE D  ++LVP
Sbjct: 352  LKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADPGHKLVP 411

Query: 418  CLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKG-VLSHT 476
             + A+LFG +GSINFD+LTKS TV+KLIA K L                  +K   + H 
Sbjct: 412  VVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQKNEAVLH- 470

Query: 477  LFALDSILHIVRAHKVEINDMDI----MKPVLRPIVYMAFFK--HTSDDLKLEQLHELAK 530
             F LD++LHI+R+HK+ +    I    M  +L P+V + FF    TS + K+  + E+A+
Sbjct: 471  -FILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKI-NVSEIAR 528

Query: 531  ERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEA 590
            ER+YSIL EL+          + +SWQ+  L  +  +EN     L N LDE+L  +K+  
Sbjct: 529  ERIYSILSELS-----SVPTGDAHSWQFHILNELTTVENELT--LTNALDEDLTTVKDTG 581

Query: 591  ISCLSKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENN-----SMV 645
            +S +  +       S G+ +LL+MCL+QLY+G+ DS++ I+E+C++   E +     S+V
Sbjct: 582  LSVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLV 641

Query: 646  GITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXX 705
            GITEI                 ++W+Q IE+VG +EL ++LD+L ARENK+GF+ LF   
Sbjct: 642  GITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGA 701

Query: 706  XXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNIDKEATSALVK 765
                      +                                   + NID++   AL K
Sbjct: 702  EEYEKVSGDENE----VAPEEESASSDTSDSSSDSDDESEEADNKDVTNIDRQTACALAK 757

Query: 766  ALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEIFKRRKEALS 825
            AL LP+N+VN+ GEV                                 ++IFKRRK+ALS
Sbjct: 758  ALKLPENVVNEDGEV---KFNEIDDLEDESSDDESMDDEAMMALDGQLADIFKRRKDALS 814

Query: 826  SISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSNNLGGSLSKLV 885
             + TGN RK EV+ SRE+VI+FK R++DML +YVKY EKL L +K    + +   L  + 
Sbjct: 815  HVPTGNMRKIEVRDSRESVINFKQRMIDMLTIYVKYVEKLDLEDK----DVMKEKLQTVS 870

Query: 886  YFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKV-TAFKDMNKDIELMDLLKKTHKLML 944
             F+ PMLKCV  TLDRPLADKI KLLK KIFK+K+  + +D  + +E +  +  T+  +L
Sbjct: 871  TFVEPMLKCVQRTLDRPLADKIFKLLKAKIFKVKIPVSAEDGERFVESLQRIHGTY--LL 928

Query: 945  TSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKL--DELIDLYTATTKEWMQKGKCGPN 1002
              K GQ+ A++YS+CS++S+F  KL +E   N     +E+ID+Y  TTK+WM K K   +
Sbjct: 929  AEKSGQYQAIYYSLCSSASIFFCKLLIESRDNKDAAHNEVIDIYAETTKKWMDKKKFPTS 988

Query: 1003 IFIDFINWLSSKKQ 1016
            +F DF NWLSSK+Q
Sbjct: 989  VFFDFYNWLSSKRQ 1002

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
            YEL055C
          Length = 1024

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1054 (38%), Positives = 601/1054 (57%), Gaps = 75/1054 (7%)

Query: 4    KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAE-EWSYVLNRLIKGLSSDRNSA 62
            +V+RDLF+KLASD+ EER+ + V ++ +L  L + D+ E EW YV++RL+KGL S+RNSA
Sbjct: 2    RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63   RLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNV--NEGTKKSMKGKDE 120
            RLGFS+CLTE ++L ++    +RP+ L+   ++L  + +   ++       K  +KGKDE
Sbjct: 62   RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RG             NEPLFS +F       + +F I F E++I L   KNW+ EPCFF+
Sbjct: 122  RGTLFGRLFAYKVLLNEPLFSLLF-------DQKFLIEFQERVIQLGSMKNWLLEPCFFS 174

Query: 181  LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNP 240
            L+Q ++ LLP +D+  A+  +   D++ LT+TNEGLS YLLL     +    S   L+N 
Sbjct: 175  LYQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLLA----KKFTLSDFTLENS 230

Query: 241  GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLPLFG 300
             WK NDPL +GNL ++ KV+ +++V    +G    T    N NW PRLH++W ++L  F 
Sbjct: 231  AWKANDPLQKGNLSVMAKVMLDTNV----DGANSNT----NKNWAPRLHYIWDIILREFF 282

Query: 301  NGKLE--NTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIID 358
            + +    +  H+            Q  ++F  FW+  VDESFFN+KAS ERKY G+LI  
Sbjct: 283  DNEQHGSDAKHVYQKKKHDKSKNPQR-VEFKSFWQAVVDESFFNDKASPERKYQGYLIFQ 341

Query: 359  AAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPC 418
             A ++VP S + +CF+QN+MR++INQ+ DS+R+LNK+SQ TL+++V  CE + A +L P 
Sbjct: 342  KAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLTPV 400

Query: 419  LNAMLFGPHGSINFDKLTKSGTVSKLIAIKE-----LPSTXXXXXXXXXXXXXXXKKGVL 473
            L A+LF   GS+NFD LTKS TVS+L+A K+     L +                +   L
Sbjct: 401  LTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELEEL 460

Query: 474  SHTL-FALDSILHIVRAHKVEI-NDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKE 531
            +  L F LDS+L+++R+ K  +  D +I+  +L   + +AFF+  +     E ++ +AKE
Sbjct: 461  NPRLKFILDSLLNLIRSQKALLETDKEIVMEILESTIQLAFFQKDN-----EYINNIAKE 515

Query: 532  RLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAI 591
            RL S+L EL +   +   D    SW YL L++I+  E S    LI+ LD++L  +K E++
Sbjct: 516  RLSSMLAELIV---LPSTD---GSWPYLALEIIVTKEKSET--LIDSLDDSLVAVKAESL 567

Query: 592  SCLSKVC--RSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF----SKHENNSMV 645
              L K+   +S+++Q  G+ +L+SM L+QLY+GD +SI +IE+L  F    S HE  +  
Sbjct: 568  DILKKISELKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFT 627

Query: 646  GITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLFXXX 705
            G+TEI                 ++W+QFI+++G EE+ +LL+ L ARENK+GF+ LF   
Sbjct: 628  GVTEILLSLLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENE 687

Query: 706  XXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX----------XXILNI 755
                     NDA                                            I  I
Sbjct: 688  GDYEVVDSENDAEGEEDDENNEKDNDDSDEDSDDDVSDDDDASLSSSDTDNADDEKISQI 747

Query: 756  DKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-- 813
            DKE TSAL KALNLPDNI+N+ GEV                                   
Sbjct: 748  DKETTSALAKALNLPDNIINENGEVNINMLEGMDEDDDDDSSSAEDDDESMDDEKMMELD 807

Query: 814  ---SEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTL--- 867
               SEIFKRRK+ALS++STGNQRK +VK+SRENVI+FKHR++DML +Y+K+ E+L+L   
Sbjct: 808  DQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEIYIKHIEQLSLNRA 867

Query: 868  -ANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDM 926
               K   +     +L+ ++  +     CV +TLD+PL +KI KL KG+  KI+ T F+D+
Sbjct: 868  DGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKGRFSKIRFTLFEDI 927

Query: 927  NKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLY----VEIGGNDKLDEL 982
                E+M+ L++ H  + T+KPGQ +A +Y  CS++SL+L +      VE       ++L
Sbjct: 928  ETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDTTVEAEKTKMFEKL 987

Query: 983  IDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQ 1016
            +D+Y ATTK WMQ+GK G  IF+DF NWL+SKKQ
Sbjct: 988  VDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
            uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1051 (41%), Positives = 579/1051 (55%), Gaps = 74/1051 (7%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDL---PDDAEEWSYVLNRLIKGLSS 57
            +  +VNRDLFFK+AS+L +ERL AA+ LI ++S +D     D   EW YV+ RL+KGL+S
Sbjct: 6    VVSRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLAS 65

Query: 58   DRNSARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKG 117
            +R  ARLGFS+CLTEVI LA+     +R   L S   FL+ L   L      GT     G
Sbjct: 66   NRGGARLGFSMCLTEVIALAL-----ERRDILPSIYAFLNQLEQTLPA----GTAFK-NG 115

Query: 118  KDERGIXXXXXXXXXXXXNEPLFSEIFVK-DLEKGNTEFFIRFTEQLIDLALKKNWIKEP 176
            K+ERG+            NEP+FS++F+  D    N EF + +  +LI LAL K W++EP
Sbjct: 116  KEERGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREP 175

Query: 177  CFFTLFQTMKMLLP--FMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSV 234
            C ++++QT++      F D ++   IL + D+  LTLTNEGLS YL+   + D     S 
Sbjct: 176  CLYSVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMFNAQRDT--YSSS 233

Query: 235  LDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSV 294
            L + N GWK+NDPL++GN+ LL  VL++  V+P     LK    QK T W PRLH+VW +
Sbjct: 234  LVIHNSGWKNNDPLSKGNVQLLASVLKD--VVPVEKSDLK----QKGT-WAPRLHYVWDI 286

Query: 295  LLPLF---GNGKLENTSHISXXXXXXXXXXVQ---NSIQFPEFWKMAVDESFFNEKASSE 348
            LLPL    G+      SHIS                 IQFP+FW+  VDESFFNEK+S+E
Sbjct: 287  LLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNE 346

Query: 349  RKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACE 408
            RKYLGFLI++ A K      I    SQN++R +INQS DSQR+LNKIS   L SIV  CE
Sbjct: 347  RKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECE 406

Query: 409  EDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPS---TXXXXXXXXXXXX 465
               A ++VP +    FG +GSINFDKL KS  V+ LI+   L                  
Sbjct: 407  RSPA-KVVPLVEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQ 465

Query: 466  XXXKKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQL 525
                K   + T F  D+ LHI RAHK  + +   +KP+L  I+  AFF  + +     +L
Sbjct: 466  DQSTKDSFNLTRFIFDTFLHITRAHKTRL-ESHWVKPLLSAIIKAAFFNESDNS----KL 520

Query: 526  HELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLEN 585
             ELAKERLYSILGEL    E      +I++W Y+ L++IL IE S     I+ LDE+LE+
Sbjct: 521  SELAKERLYSILGELI--SEPSKSSGDISTWPYIALQIILKIEGSGSTLSID-LDEDLES 577

Query: 586  IKNEAISCL----SKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH-- 639
            ++  AI  L    S    +   +  GL  LLS+ ++QLYAGD +S+S++++L  F +   
Sbjct: 578  VRKSAIKSLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECD 637

Query: 640  -ENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGF 698
             E+  +VGITEI                 I+W+ F+ ++G  EL +LL  L ARENKQGF
Sbjct: 638  KESTDLVGITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGF 697

Query: 699  AQLFXXXXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILN-IDK 757
            A LF                                                  L  I+K
Sbjct: 698  ADLFEGDEEEDDEDAVERGTDDDDDEDDEDNDDDDEPSAEDSEDDVSEEDKDAALEKIEK 757

Query: 758  EATSALVKALNLPDNIVNDKGEVX------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 811
            EATSAL KALNLPD+IV + G+V                                     
Sbjct: 758  EATSALAKALNLPDSIVGEHGDVQLGNNEEEDSDEDSDEDDDFSGEDESMDDEAMMQLDD 817

Query: 812  XXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKS 871
              SEIFKRRKEAL S+ TGN+RK EV++SRENVISFKHRVVDML +YVK  ++    N +
Sbjct: 818  QLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYVKSFDRAVARNNT 877

Query: 872  -----EHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDM 926
                 E  NNL          I+P+LKC+  TLD+ LADK +KL+K ++ K+K T  K+ 
Sbjct: 878  SIITVEEWNNLSS-------IILPLLKCLQHTLDKALADKCAKLMKLRLCKVKATIAKE- 929

Query: 927  NKDI--ELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKLDELID 984
             K +  E+  LL+K HKL++T+KPGQ   +F+S CS +SLFLSKLY+  GG+   + LID
Sbjct: 930  EKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGGSH--ENLID 987

Query: 985  LYTATTKEWMQKGKCGPNIFIDFINWLSSKK 1015
            LY  T+K WM+ GKC  N FIDF NWL +K+
Sbjct: 988  LYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YEL055C
            (POL5)
          Length = 1002

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1045 (39%), Positives = 579/1045 (55%), Gaps = 76/1045 (7%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            M  +VNRDLF+KL SDL +ER+ +A+ALI +L+ L + ++ +EW YVL RL++GL+S   
Sbjct: 1    MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
            SARLGFSLCLTEV   A  +  G     + S  E+L  L   L V+      K   GK+E
Sbjct: 61   SARLGFSLCLTEVA--AAALENGH----IGSAEEYLERLEAALPVD------KVKNGKEE 108

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RG             NEPLFS +FV    +    F  +F ++L+ LAL K W+++PC FT
Sbjct: 109  RGQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFT 168

Query: 181  LFQTMKMLLP-FMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEG-------DESLIP 232
            L+Q ++ L P   D      +L + D+++LT T+EGL+ YL L+ +        DE+ I 
Sbjct: 169  LYQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIF 228

Query: 233  SVLDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVW 292
              L L    WK ++PLA+GN   L  VL++ ++I + +G      KQK   W PRLHFVW
Sbjct: 229  DALPLVK-RWKADNPLAKGNAKALASVLKDDALI-EGDG-----PKQKGV-WTPRLHFVW 280

Query: 293  SVLLPLFGNGKLENTSHISXXXXXXXXXXVQNS----IQFPEFWKMAVDESFFNEKASSE 348
             +LLPL    K+   +H+            +++    + F EFW++ VDESFF+EKASSE
Sbjct: 281  DLLLPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSE 340

Query: 349  RKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACE 408
            RKYLG LI++ A ++VP S +   FS+N +RTLINQS ++ R L+K+S   L +IV ACE
Sbjct: 341  RKYLGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACE 400

Query: 409  EDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXX 468
             D A+++VP L A+ FGP+G+INFDKLTKS T   L+  K L +T               
Sbjct: 401  TD-ASKVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQLVTLLLQQLEH 459

Query: 469  KKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFF---KHTSDDLKLEQL 525
            +   +S   F LD++LH++RAHK + + +    P+L  +V  AFF    H S+  + E++
Sbjct: 460  ENTDISKIKFILDTLLHVIRAHKWKAH-LSWTNPLLLALVRYAFFSAPSHLSE--QSEEI 516

Query: 526  HELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLEN 585
              L++ERL+S+LGEL     +   D    SW Y TL+L+L  +  H   L   LD  LE 
Sbjct: 517  ITLSRERLFSVLGELI---PLSKHDMGAPSWAYATLELLLQEKEKH--PLALQLDAELET 571

Query: 586  IKNEAISCLSKVCRSRT------AQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF--- 636
            + + A+  L K+    T       Q +GL  LLS+ ++Q++AGD DS S +EEL  F   
Sbjct: 572  VTSNALKILRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYES 631

Query: 637  -SKHENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENK 695
             ++  +N +VGITEI                 ++W+ FI++VG EEL++LL+ L ARENK
Sbjct: 632  ATQGADNGLVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENK 691

Query: 696  QGFAQLFXXXXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILNI 755
             GFAQLF             +                                   +  I
Sbjct: 692  AGFAQLF------EGADEYEELGSDEAGTDNEDQSSESNEDSSDEVSDQEDYSDEDVAKI 745

Query: 756  DKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSE 815
            DKEATSAL  AL LPDNI+++ G V                                 SE
Sbjct: 746  DKEATSALAHALRLPDNILDEDGNV------GFEEMDDEEEEEESMDDEAMMELDGQLSE 799

Query: 816  IFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHSN 875
            IFKRRK+AL+ I TGNQRK E K+SR++VI+FKHRVVDML +Y K  E+    NK     
Sbjct: 800  IFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLEIYCKNVERSVTKNK----- 854

Query: 876  NLGGSLSK-LVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDI---E 931
             L  ++S  ++    PM+K + +TLDRPLA+KISKLLK  + K+K  A+K+   +I    
Sbjct: 855  KLSATMSANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCKMKPAAYKEFTSEINEES 914

Query: 932  LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKLDE-LIDLYTATT 990
            ++  L+  H  +L+ KPGQ   +F+S CS++SLFLSK+ + +  +    E +I +Y+ T 
Sbjct: 915  ILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMKDDPSTSEQVIGIYSTTM 974

Query: 991  KEWMQKGKCGPNIFIDFINWLSSKK 1015
            K W   GK GPN FIDFINWL+SKK
Sbjct: 975  KHWNVSGKFGPNFFIDFINWLASKK 999

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/739 (48%), Positives = 472/739 (63%), Gaps = 45/739 (6%)

Query: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
           M GKVNRDLF+KLASDL EERL +AV+LIK+LS L++PDD EEW+YVLNRLIKGL+SDRN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNV------NEGTKKS 114
           SARLGFSLCLTE INLA+ M     P+G++S NEFL  LS  L ++       N+   K 
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNA-PQGVQSINEFLDLLSKTLPIDSNTVATENKTALKK 119

Query: 115 MKGKDERGIXXXXXXXXXXXXNEPLFSEIFV-KDLEKGNTEFFIRFTEQLIDLALKKNWI 173
            KG+DERGI            NEPLFS IF+ +D +K ++  FIR+ ++L  L  KKNWI
Sbjct: 120 KKGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWI 179

Query: 174 KEPCFFTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEG------D 227
           +E CFFTL+QT++ LLP+ D    + +L + DKY+LTL+ EGL+ YLL+ Y        +
Sbjct: 180 RESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE 239

Query: 228 ESLIPSVLDLKNPGWKDNDPLARGNLPLLTKVLRNSSV--IPDANGGLKETKKQKNTNWN 285
           ++L  S + L N  WK N+PLARGNLP LT +LR+S+V    D      +  KQ   NW 
Sbjct: 240 KTL--SDIQLSNSHWKSNNPLARGNLPALTNILRDSNVTEFQDHEKPPTKNNKQPPANWA 297

Query: 286 PRLHFVWSVLLPLF---GNGKLENTSHISXXXXXXXXXXVQNS---IQFPEFWKMAVDES 339
           PRLHFVW +LLP+       +  N+               Q+S   I+FPEFW+MA+DES
Sbjct: 298 PRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDES 357

Query: 340 FFNEKASSERKYLGFLIIDAAFKAVP---GSYIGFCFSQNVMRTLINQSIDSQRVLNKIS 396
           FFNEKASSERKYLGFLI     +++       I  CF++N MR+LINQS D++R+L+K+S
Sbjct: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417

Query: 397 QLTLDSIVKACEEDSANRLVPCLNAMLFGPH--GSINFDKLTKSGTVSKLIAIKELPSTX 454
           Q+ +D+IVK CE+D +N+L+PCL+A+LF  +  GSINFDKLTKS TVSKLI+IK L S+ 
Sbjct: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSST 477

Query: 455 XXXXXX---XXXXXXXXKKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMA 511
                            +K +     FALD+ILH+VR+HK E +   +++P+L P+V +A
Sbjct: 478 LRQLIKLFISQINAMSTEKEITIVNQFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKLA 537

Query: 512 FFKHTSDDLKLEQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSH 571
           FF   +     E L+ELAKERLYSIL ELT            +SW Y TL+LIL++E S 
Sbjct: 538 FFSKDN-----EALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSG 592

Query: 572 VGDLINPLDENLENIKNEAISCLSKVCRSR----TAQSWGLSTLLSMCLVQLYAGDTDSI 627
             +L+N LD +LE IKN  +  L+++  +     T QS GL  LLSMC++QL++GDT+S+
Sbjct: 593 NQELVNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESL 652

Query: 628 SVIEELCEF----SKHENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQ 683
           S IEEL EF     + E+ S+VGITEI                  +W+ FI ++G  EL 
Sbjct: 653 STIEELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELN 712

Query: 684 ILLDILKARENKQGFAQLF 702
           +LL +L  RENKQGFA LF
Sbjct: 713 VLLAVLPVRENKQGFAHLF 731

 Score =  253 bits (647), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 144/281 (51%), Positives = 181/281 (64%), Gaps = 22/281 (7%)

Query: 752  ILNIDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXX------- 804
            I NIDKEATSAL KALNLP+NIVN+KGEV                               
Sbjct: 787  IANIDKEATSALAKALNLPENIVNEKGEVDLAKLENMSDNDLDNSINDDDDDESDEESMD 846

Query: 805  --XXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYC 862
                       SEIFKRRKEALS+ISTGNQRK EVK+SRENVI+FKHRV+DML +Y+KY 
Sbjct: 847  DEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLMIYMKYV 906

Query: 863  EKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTA 922
            E LTL  ++      G     L+ FI PM+KCV +TLD+ LADK+ KL+K K+FKIK + 
Sbjct: 907  EGLTLTTEN------GEKFGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFKIKSSN 960

Query: 923  FK--DMNKDIE-LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK- 978
            F+   +N D + +M+LL++TH+ +LTSK GQ  +++YS+CST S+FL K+ V +  NDK 
Sbjct: 961  FQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVESNDKE 1020

Query: 979  --LDELIDLYTATTKEW-MQKGKCGPNIFIDFINWLSSKKQ 1016
                +LIDLY  TTK W M KGK G N F DF NWLSS++Q
Sbjct: 1021 IAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQ 1061

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
           gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
           weakly similar to YEL055C uniprot|P39985 Saccharomyces
           cerevisiae
          Length = 1039

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/711 (48%), Positives = 470/711 (66%), Gaps = 29/711 (4%)

Query: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
           M GKVNRD F++LASDL++ER+ AAV+LI++LSAL+LP   EEWSYVL RLI GL+S RN
Sbjct: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61  SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
           SARLGFSLCL+EV+ +A++      P+ L S +++L  LS  L+ +    +KK +KGKDE
Sbjct: 61  SARLGFSLCLSEVVKMALD-KGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119

Query: 121 RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
           RGI            NEPLF+ IF  D E   + F +RF ++L +LA+KKNW++E C +T
Sbjct: 120 RGILFGKMFGLQAILNEPLFTSIFF-DQEGKVSPFALRFAQELAELAVKKNWLRESCLYT 178

Query: 181 LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLL-----KYEGDESLIPSVL 235
           LFQT++ L+P M+      ILL+ DKY LT+TNEGL+ YLLL     +  G    +PS L
Sbjct: 179 LFQTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238

Query: 236 DLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVL 295
            L+   WK+NDPL++GNLP L++VLR++   P  +  + +    K+ NWNPRLHFVW +L
Sbjct: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRDA---PANDSEVADGSHPKSANWNPRLHFVWDIL 295

Query: 296 LPLFGNGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFL 355
           +P+   GK +                V+  I+FPEF++ AVDE+FF+EKASSERKYLGFL
Sbjct: 296 IPILAPGKSDEEIPSKKSHKKKKKDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFL 354

Query: 356 IIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRL 415
           +   A + V   +I  CF+QN MRTLINQS DS+R+LNKISQ  LD+IVKACE+D++ ++
Sbjct: 355 VFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKI 414

Query: 416 VPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGV-LS 474
             CL AMLFGPHG+I+FDKLTKS T SKL+AIK++ S+               ++     
Sbjct: 415 ALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQ 474

Query: 475 HTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLY 534
           H  F LD++LH VR H++EI+   I  P+L  IV +AFF    +D     + +LA+ERL+
Sbjct: 475 HYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED-----ISDLARERLF 529

Query: 535 SILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCL 594
           SIL ELTI K+ +       SWQ+ TLKLIL  E +   + IN LDE+L+ I+ EA+  L
Sbjct: 530 SILSELTIQKDGQ-------SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDIL 581

Query: 595 SKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSK---HENNSMVGITEIX 651
             +  S + QS GL  LLS CL+QLY+GD++S+S++EELC F +   +E+NS+VGITEI 
Sbjct: 582 QNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIL 640

Query: 652 XXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702
                           ++W+QF+ EVG +EL+ILL++L ARENK+GFA+LF
Sbjct: 641 LSLLAQKKALLRKLSLVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691

 Score =  251 bits (641), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 179/283 (63%), Gaps = 18/283 (6%)

Query: 752  ILNIDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXX--------------XXXXXX 797
            +  ID+EATSAL KALNLP+NIVNDKGEV                               
Sbjct: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANSDEMDDDDDDEEDEEEDEE 814

Query: 798  XXXXXXXXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAV 857
                            S+IFKRRKEALS ++TGN+RK EVK++RENVI+FKHR+VDML  
Sbjct: 815  EESMDDEQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874

Query: 858  YVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFK 917
            Y+K+ +++ L + ++ +N+   +   L  F+ PM++C+  TLD+PLADKISKLLKG+++K
Sbjct: 875  YIKHADRIALQDNNDEANS-KDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933

Query: 918  IKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND 977
            IK++AFK       L++ L+ THK +LTSKPGQ  A+++S CST+SLFL K+ VE    D
Sbjct: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSED 993

Query: 978  ---KLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQT 1017
                  ++IDLY  TTKEW+  GK G N+F DF NWL S+K+T
Sbjct: 994  PAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/722 (48%), Positives = 459/722 (63%), Gaps = 52/722 (7%)

Query: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
           MTG+VNRD F+KLASDL+EER+ AAVALI++LSALDLPD A EWSYVL RLI GLSS RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61  SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVN-EGTKKSMKGKD 119
           SARLGFSLCLTEVINLA+N+  G RP+ L S + FL  LS+ L++  + + +KK +KGKD
Sbjct: 61  SARLGFSLCLTEVINLALNLE-GDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKD 119

Query: 120 ERGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFF 179
           ERG+            +EPLF ++F+   EKG ++F +RF ++L  LA+ K+W++EPC F
Sbjct: 120 ERGLLFGKMFGLQALLSEPLFEKVFISK-EKGISDFALRFMDELCQLAVFKSWLREPCLF 178

Query: 180 TLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVL--DL 237
           TLFQ  + +LP  D  +A+ +L + D+Y LTLTNEGL+ YLLL Y+       S+L  D 
Sbjct: 179 TLFQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSILQMDF 238

Query: 238 KNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLP 297
           ++  WK NDPLARGNLPLL++VLR+SSV        ++    K +NW PRLHFVW +LLP
Sbjct: 239 ESKSWKSNDPLARGNLPLLSQVLRDSSV------ATEDESSPKASNWTPRLHFVWDILLP 292

Query: 298 LFGNGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLII 357
           +         S                +IQFPEFW+MAVDES FNEKAS+ERK+LG +I 
Sbjct: 293 IITQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIF 352

Query: 358 DAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVP 417
             A +  P   +G CFSQNVMRTLIN + DS+R+L KIS   L+SIV  C++    +LVP
Sbjct: 353 QKALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVP 412

Query: 418 CLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTL 477
           CL+A+LFGPHGSINFDKLTKS T + L+A+  L  T                 G+LS  L
Sbjct: 413 CLSAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELF-----------GLLSSNL 461

Query: 478 ------------FALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQL 525
                       F LD++LH VR+HK E+N   I+  +LRPI+ +AFF      +K E  
Sbjct: 462 IESSLVEQKNQQFILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFT-----VKDEHT 516

Query: 526 HELAKERLYSILGELT-INKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLE 584
             LAKER YSIL E+T +N E     P   S+Q + L +I D E +   +L   LD+ LE
Sbjct: 517 SNLAKERFYSILSEITHLNNE----GP---SYQNMALDIIRD-EIAAGKELTTKLDDTLE 568

Query: 585 NIKNEAISCLSKVCRS-RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF---SKHE 640
           ++K+EA+  L  +  + +  Q  GL  L+SMCL+QLY+G+++++SVIEELC F   +   
Sbjct: 569 DVKSEALRTLQAISNNEKNPQLRGLEMLISMCLLQLYSGESEAVSVIEELCAFYQDTDEN 628

Query: 641 NNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQ 700
           + S+VGITEI                   WQQF+ E+G  EL+ LLD+L ARENK+GF+Q
Sbjct: 629 STSLVGITEILLSLLAQKKAVLRKLSLSAWQQFVSEIGEAELKALLDVLPARENKKGFSQ 688

Query: 701 LF 702
           LF
Sbjct: 689 LF 690

 Score =  240 bits (613), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/279 (46%), Positives = 175/279 (62%), Gaps = 21/279 (7%)

Query: 752  ILNIDKEATSALVKALNLPDNIVNDKGEV-------------XXXXXXXXXXXXXXXXXX 798
            +  IDKEATSAL KALNLPDNIVNDKGEV                               
Sbjct: 745  VAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGADDVADDGADDEVDGEEDEDEDE 804

Query: 799  XXXXXXXXXXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVY 858
                           S+IFKRRK+ALS+ISTGNQRK E K+SRE+VI+FK RV+DML +Y
Sbjct: 805  DSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLEIY 864

Query: 859  VKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKI 918
            VK+ EK +L  K E+ + +   L      + PM+KC+ +T D+ LA++I+KLL+ K+FK+
Sbjct: 865  VKFVEKQSL--KEENYSKISSCL----LLLEPMIKCIQQTTDKSLANRIAKLLRTKVFKL 918

Query: 919  KVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGG--N 976
            K +AF       ELM++L+ TH+ + T KPGQH A++YS+CST+SLFL+K+ +E     +
Sbjct: 919  KTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSKD 978

Query: 977  DKLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKK 1015
              + ++IDLY  T K+W   GK GPNIFIDF NWLSS+K
Sbjct: 979  AAVHDIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
            YEL055C
          Length = 1041

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1056 (38%), Positives = 572/1056 (54%), Gaps = 70/1056 (6%)

Query: 5    VNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAE-------EWSYVLNRLIKGLSS 57
            VNRD+F++LASDL EERL + V L+K+L  L   +  E       EW+YV+NRLI GL+S
Sbjct: 4    VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58   DRNSARLGFSLCLTEVINLAVNMP-PGQRPKGLESTNEFLSTLSTILNV-NVNEGT-KKS 114
            +R  ARLGFSLCLTEV+NLA++       P  L   + FL  +S  L++ +  +G  +K 
Sbjct: 64   NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 115  MKGKDERGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIK 174
            +KGKDERG+            N+P+F +IF KD    N      F  +LI L+  KNWIK
Sbjct: 124  LKGKDERGLLFGKLFALQSLLNDPIFGKIFNKD----NKAILFEFIYELIALSNLKNWIK 179

Query: 175  EPCFFTLFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSV 234
            EP  FTLF  ++ ++ F+D S   ++L I    +LTLTNEGLS Y+ L Y  +  + P  
Sbjct: 180  EPTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIY-TNPHISPED 238

Query: 235  LDLK---NPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFV 291
            + +    N  WK+NDP  + N+ LL+KVL N+S         +  K   N NW PRLH+V
Sbjct: 239  IQIDNNNNNTWKNNDPFLKSNIVLLSKVLLNTS------AASQSEKHTSNANWTPRLHYV 292

Query: 292  WSVLLPLFGNGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKY 351
            W V+LP+  N K  ++  +            ++ I+F EFW+  +DESFFNEKAS ERKY
Sbjct: 293  WDVILPILLNPK--SSDKLLNKNGNKRRKVSRDRIKFNEFWRQVIDESFFNEKASHERKY 350

Query: 352  LGFLIIDAAFKAV-PGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEED 410
            LGFLII   F  +   + I   F+ N++R++INQ  DS+R LNKIS  T+D IV  C+ +
Sbjct: 351  LGFLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSN 410

Query: 411  SANRLVPCLNAMLFGPH--GSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXX 468
            S  RL+P LN  LF      SINFDKLTK+ T+S+LI +++L ST               
Sbjct: 411  SELRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDL-STDTLSKLFFLFTSKLD 469

Query: 469  KKGVLSHTLFALDSILHIVRAHKVE-INDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHE 527
                 +   F LDSILHI+R+HK + I     + PVL PI+ + FFK T+D      +  
Sbjct: 470  SFTTTTELQFLLDSILHIIRSHKSQIIVSHKFLDPVLEPIILLTFFKETAD----VSISN 525

Query: 528  LAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIK 587
            + K+RL SIL +LT   E        +S QYLTL LI+++       L    D++L  +K
Sbjct: 526  ILKDRLISILNDLTTVGE------NSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVK 579

Query: 588  NEAISCLSKVCR--SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEF-SKHENNSM 644
            + AI+ L +      R ++   L +LLS+ ++QLY  D DSI+ I++LC+F  ++++N++
Sbjct: 580  DSAITTLKRAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRYKSNTI 639

Query: 645  V---------GITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENK 695
            +         GI EI                  +W+ FI+ + L E   + D+L  RENK
Sbjct: 640  MKNDKNRPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENK 699

Query: 696  QGFAQLFXXXXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILN- 754
            +GFA+LF            +D                                    +N 
Sbjct: 700  EGFARLFEGDDEYEEIDSHDDEEKDEDKNIDDISTENSDDDNSSDEENDSIVESNDDINR 759

Query: 755  IDKEATSALVKALNLPDNIVNDKGEV--------XXXXXXXXXXXXXXXXXXXXXXXXXX 806
            IDKEATSAL KAL LPDNI+NDKGEV                                  
Sbjct: 760  IDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMDDEQM 819

Query: 807  XXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLT 866
                   S+IF RRKEALS+I TGN+RK +VK+SRENVI+FKHR+VDM+ VY+K+ E +T
Sbjct: 820  MELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDMIEVYLKHIEIIT 879

Query: 867  LANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDM 926
             ++++         L+ +   I  +L C+ +TLDR LA+KISKLLK K+FKIK+  FKD 
Sbjct: 880  KSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNKLFKIKLVEFKDC 939

Query: 927  NKDIELMDLLKKTHKL----MLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGN-DKLDE 981
              D+   ++L+    L    +L  K GQ+  +++ +CS SSLF  +++ E   N D  D 
Sbjct: 940  G-DLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFAETSTNADLYDS 998

Query: 982  LIDLYTATTKEWMQKG--KCGPNIFIDFINWLSSKK 1015
            LIDLY  TTK W +    K    IF DF NWLSSK+
Sbjct: 999  LIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/706 (46%), Positives = 444/706 (62%), Gaps = 33/706 (4%)

Query: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63
           KVNRD F+KLASDL EER+ +AVALIKDLSAL   +  +E+ YVLNRLI GLSS+RNSAR
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62

Query: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERGI 123
           LGFSLCLTEV+NLA++    Q    L S ++FL  +   L ++     KK  KGKDERGI
Sbjct: 63  LGFSLCLTEVVNLALDRK-DQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGI 121

Query: 124 XXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLFQ 183
                       NEPLF+++F+ D     ++F IRF  QL++LA+ KNW++EPC FTL+Q
Sbjct: 122 MFGRMFALQALLNEPLFAKVFI-DKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQ 180

Query: 184 TMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLKNPGWK 243
           T++  +P++D S  E ++ + DKY LTLTNEGL+ YL L +   +  I S L L++ GWK
Sbjct: 181 TVEKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHTNGKK-IASSLPLESQGWK 239

Query: 244 DNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVLLP-LFGNG 302
            NDPLA+GNLP LT+VL NS++         ET +    NW+PRLHFVW +LLP L G  
Sbjct: 240 LNDPLAKGNLPTLTQVLLNSNI------NQSETPQGNAANWSPRLHFVWDILLPILLGQD 293

Query: 303 KLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLIIDAAFK 362
              N  H+S             SI+F  FWKM VDESFFNEK+SSERKYLGFLII  + +
Sbjct: 294 STTNDEHVSKKQKSKTTS--STSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQKSLE 351

Query: 363 AVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRLVPCLNAM 422
            VP   +   F QNV+R++INQS D++R+L+KISQ  L+SI++ACE+D+  ++ P +  +
Sbjct: 352 LVPAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVI 410

Query: 423 LFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLSHTLFALDS 482
           LFG +G+ NFDKLTK+ T++K+++IK L                      +    F LD+
Sbjct: 411 LFGENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSESIQKDQFVLDT 470

Query: 483 ILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLYSILGEL-T 541
           ILH+VR HK+E+N   I+  +L P++ +AFF   +     E++  +AKER +S+L EL  
Sbjct: 471 ILHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKEN-----ERISNIAKERFFSLLSELAA 525

Query: 542 INKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINP-LDENLENIKNEAISCLSKVC-R 599
           I    R       SWQY  L+LI + E S  G  +N  +D++L  IK + I CL +V  +
Sbjct: 526 ITTSTR-------SWQYTALELISNKEAS--GSPLNQEMDQDLIAIKEKGIECLKEVTKK 576

Query: 600 SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENN---SMVGITEIXXXXXX 656
           S T Q  GL  LLSM L+QLYAGD DS+S++E+LC F     +   S+VGITEI      
Sbjct: 577 SDTVQLRGLECLLSMSLLQLYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLA 636

Query: 657 XXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702
                      + W+QF+  +G EE+++L+D+L ARENK+GFAQLF
Sbjct: 637 QRKAVLKKIALVAWEQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  239 bits (611), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 129/278 (46%), Positives = 176/278 (63%), Gaps = 14/278 (5%)

Query: 755  IDKEATSALVKALNLPDNIVNDKGEV--------XXXXXXXXXXXXXXXXXXXXXXXXXX 806
            I+KE TSAL KALNLPDNI+N+ GEV                                  
Sbjct: 739  INKETTSALAKALNLPDNIINENGEVDLDALEGMSEEENDDDDDDESEEEDDESMDDEKM 798

Query: 807  XXXXXXXSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLT 866
                   SEIFKRRKEALSS+++GNQRK +VK+SRENVI+FKHR++D+L  Y+KY EK+T
Sbjct: 799  MELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYIKYVEKIT 858

Query: 867  LANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDM 926
                 +   N    L+ +   +  M++C+  TLDRPLADKISKLLK K+FKI +T F + 
Sbjct: 859  SRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKINLTFFDNG 918

Query: 927  NKDIE--LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK----LD 980
            N   +  ++  LK  H+L++TSKPGQHA++++S+CSTSSLFLSKL +E    D+      
Sbjct: 919  NVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNADERSYAFS 978

Query: 981  ELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQTV 1018
            +LID+Y   +K+W+ KG+ GP +F+DF NWL+SKK + 
Sbjct: 979  QLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNSA 1016

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] {ON}
            similar to uniprot|P39985 Saccharomyces cerevisiae
            YEL055C
          Length = 1006

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/1051 (37%), Positives = 554/1051 (52%), Gaps = 77/1051 (7%)

Query: 1    MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
            +  +V+RDLF+KLASDL EERL A + L+  LS ++   ++ EW YVLNRLIKGLSS RN
Sbjct: 2    VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVE--KESREWEYVLNRLIKGLSSSRN 59

Query: 61   SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120
             ARLG+ LCLTEV+  A+          L   +E+L  L +       E  K    GK+E
Sbjct: 60   GARLGYCLCLTEVVASALEKSV------LAHADEYLRLLLS---TLSRENIKN---GKEE 107

Query: 121  RGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180
            RGI            NEPLFS++F K  ++ N EF + +   LID+AL K WI+E   FT
Sbjct: 108  RGILFGKLFGLQVLLNEPLFSQVF-KAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFT 166

Query: 181  LFQTMKMLLPFMDESSAEKILL-IYDKYDLTLTNEGLSTYLLLKYEGDESLIPS------ 233
            L+Q ++ L P M      K LL + D   LT T+EGL+ YL L ++   S I +      
Sbjct: 167  LYQAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHK---SFITTGALRKK 223

Query: 234  --VLDLK-NPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHF 290
              + DLK N  WK+NDPL++GNLP +   L+      + N     + KQK   W PRLHF
Sbjct: 224  GLLEDLKLNSPWKNNDPLSKGNLPAIANALK------EINSSEDLSVKQKGI-WMPRLHF 276

Query: 291  VWSVLL-PLFGNGKLEN-TSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSE 348
            VW ++L   F  G+ E+  S  +              I+FPEFWK  VDESFFNEK+SSE
Sbjct: 277  VWDIILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSE 336

Query: 349  RKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACE 408
            RKYLGFL+ + AF   P SY     S+N+ R LINQ   S+R L+K+SQ  L +IV  C 
Sbjct: 337  RKYLGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVC- 395

Query: 409  EDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXX 468
            ++   +  P    +    HGSI+FD+LTKS T++ L++ K L                  
Sbjct: 396  KNQPEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFT 455

Query: 469  KKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLE----- 523
                 S   F LD++LH+VRAHK    D   + P+L  +V   FF+   +D + E     
Sbjct: 456  SLRDHSRVRFLLDAMLHLVRAHK-SAADKVWLAPLLDSLVQQGFFELDENDRQPEVGDET 514

Query: 524  -QLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDEN 582
              + +LA ERLYSIL +L I+ + +    E   W   T+++++         L+NP+DE 
Sbjct: 515  FTVSKLAVERLYSILADL-ISADYKS---EKVCWPRFTVEILMS--KLKKNKLLNPMDEE 568

Query: 583  LENIKNEAISCLSKVCR-----SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFS 637
            L  I N +I     +C       +  Q+ G   + S+ ++Q Y+G+TDSI V+++L  F 
Sbjct: 569  LTEILNSSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFH 628

Query: 638  K----HENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARE 693
            +    +++ S  G  EI                 ++W+ F+ E   +++ +LL+IL ARE
Sbjct: 629  QTLEENKSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARE 688

Query: 694  NKQGFAQLFXXXXXXXXXXXXNDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIL 753
            NK+GF++LF            +D                                     
Sbjct: 689  NKEGFSKLF-----EGDDEGGSDEEEISDELFAEEGASGDNTEEEESGPDSDDQDGEDTE 743

Query: 754  NIDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 813
             IDKEATSALVKALNLP++IVND GEV                                 
Sbjct: 744  QIDKEATSALVKALNLPESIVNDNGEV---HFEDLEDTEDEEISDEDLDDEKMMELDGQL 800

Query: 814  SEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCE-KLTLANKSE 872
            SEIFKRRKEALS I TGN+RK EVK+SRENVI+FKHRVVDML ++V++ E +L    + E
Sbjct: 801  SEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEIFVRWAESELKQGGRPE 860

Query: 873  HSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIE- 931
             S       SK++  I+P++ CV  TLD+PLA+K++KLLK KI K+K+T    ++   E 
Sbjct: 861  KSVT-----SKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICKLKITTDTSLDGLEEN 915

Query: 932  -LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGN-DKLDELIDLYTAT 989
               + LK  H+ ML  K GQ   +++S CST+S+FL+KL+V      +    L ++Y  T
Sbjct: 916  LFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFVHRSPRPETYFTLTEVYHKT 975

Query: 990  TKEWMQKGKCGPNIFIDFINWLSSKKQTVMD 1020
              EW   GK   N+FI+F+NWLS KKQ   D
Sbjct: 976  LNEWFVGGKFSANLFIEFLNWLSIKKQQNSD 1006

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  518 bits (1335), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 313/734 (42%), Positives = 437/734 (59%), Gaps = 62/734 (8%)

Query: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60
           M  K+NRDLF+KLASDL+EER+ AA++LIK+L++L+  ++  EW YVLNRLIKGLSS+RN
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLTEVINLAVNMPPGQRPKG-LESTNEFLSTLSTILNVNVNEGTKKSMK-GK 118
           SARLGFSLCLTEV+++A+        KG L S  E++  L + L        K+++K GK
Sbjct: 59  SARLGFSLCLTEVLSVALE-------KGYLNSIEEYIQLLQSTL-------LKETVKNGK 104

Query: 119 DERGIXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCF 178
           +ERG+            NEPL S+IF+      N  F + F  +L+ +AL K WI+EPC 
Sbjct: 105 EERGLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCL 164

Query: 179 FTLFQTMKMLLPFMDESSA-EKILLIYDKYDLTLTNEGLSTYLLLKY--EGDESLIPSVL 235
           FTLFQ ++ L PF++++   E I  + D   L+LTNEGL+ YL L +   G    I    
Sbjct: 165 FTLFQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKSG 224

Query: 236 DLKN----PGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFV 291
            LKN      WK+NDPL +GNLP L+ VL++ S + D+  GLK+       +W PRLHFV
Sbjct: 225 LLKNLELNSQWKNNDPLTKGNLPTLSAVLKDVSPVEDS--GLKQ-----KGSWAPRLHFV 277

Query: 292 WSVLLPLFGNGKLENTS---HISXXXXXXXXXXVQ-NSIQFPEFWKMAVDESFFNEKASS 347
           W+++LP+         S   HI+          VQ   I+FPEFWK  VDESFFNEK+S 
Sbjct: 278 WNIILPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSG 337

Query: 348 ERKYLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKAC 407
           ERKYLGFLI++AAFK VP S +   FS+N+MRTLINQS DS+R+L+KISQ  L SI++ C
Sbjct: 338 ERKYLGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELC 397

Query: 408 EEDSANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKEL-PSTXXXXXXXXXXXXX 466
           E    ++ VP + AMLF  +G+INFDKLTK+ TV  L+A   + P               
Sbjct: 398 ES-HPDKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLP 456

Query: 467 XXKKGVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHT--------SD 518
                  + T F LDS+LH+VR HK  ++D   +KP++  ++ M FFK +         D
Sbjct: 457 DDPNEEAALTRFLLDSMLHVVRTHKT-VSDKTWVKPLITSVISMGFFKTSPAKVDQENQD 515

Query: 519 DLKLEQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINP 578
           D   +     A+ERLYSIL +L     +  +     SW Y+TL+++L  E S   +LI+P
Sbjct: 516 DDHTDGFEFQARERLYSILADLI---PLSKQSIHSASWPYITLQVLLSQEQSK--ELIHP 570

Query: 579 LDENLENIKNEAISCLSKVCRS-----RTAQSWGLSTLLSMCLVQLYAGDTDSISVIEEL 633
           LD+ L  IK +A++ L  + R        +Q +GL  LLSM ++Q+Y GDT+S+SV+E+L
Sbjct: 571 LDDGLNKIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDL 630

Query: 634 CEF-----SKHENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDI 688
             F        E NS++G+ EI                 ++W+ F+++VG  EL++L DI
Sbjct: 631 VTFYHSMRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDI 690

Query: 689 LKARENKQGFAQLF 702
           L ARENK+GF  LF
Sbjct: 691 LSARENKEGFTALF 704

 Score =  218 bits (555), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 162/268 (60%), Gaps = 10/268 (3%)

Query: 755  IDKEATSALVKALNLPDNIVNDKGEVX--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 812
            IDKE TSAL KALNLPD I+N+ GEV                                  
Sbjct: 782  IDKETTSALAKALNLPDGIINENGEVNFNELSESDDEDESEEDEDEESMDDEKMMELDDQ 841

Query: 813  XSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSE 872
             S+IF+RRKEALS ISTGN+RK E K+SRENVI+FKH+VVDML V+VK+ E+ T  NK  
Sbjct: 842  LSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLEVFVKFVER-TSKNKEC 900

Query: 873  HSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIEL 932
                L    S       P++KCV +T D+ LADK+SKL+K ++ K+K+    + + DIE 
Sbjct: 901  GETELKSVTS----MFQPLIKCVQQTTDKALADKLSKLIKNRMCKLKLPKLINDSDDIEE 956

Query: 933  MDL--LKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDKL-DELIDLYTAT 989
            + +  L   H+LML  K GQ   +++S CS  SLFLSKL V+   ND + D LID+Y +T
Sbjct: 957  LTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQASTNDSIYDRLIDIYLST 1016

Query: 990  TKEWMQKGKCGPNIFIDFINWLSSKKQT 1017
             K+W  KGK G + F DFINWL+SKKQT
Sbjct: 1017 MKKWFSKGKFGTSFFFDFINWLASKKQT 1044

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  473 bits (1216), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 297/717 (41%), Positives = 428/717 (59%), Gaps = 43/717 (5%)

Query: 3   GKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSA 62
            KVNRD F+KLASDL EERL AAV +IKDLSAL++P + EEW+Y +NRL+KGL S RNSA
Sbjct: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63  RLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERG 122
           RLGFS+CL+E +NLA+++   + P+GL S   +L  L+  L  + +EG K+  KGKDERG
Sbjct: 62  RLGFSMCLSEALNLALSL-GDKAPEGLNSIENYLKILNETLGADFDEGKKR--KGKDERG 118

Query: 123 IXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLF 182
           I            NEPLFS +FV   + G + F   F +++I+L+  KNWI+EP  F+L+
Sbjct: 119 ILFGKLFGLQALLNEPLFSNVFVT--KDGISNFVPVFVQEMINLSKCKNWIREPALFSLY 176

Query: 183 QTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDESLIPSVLDLK--NP 240
           QT++ L+  + +S    ++   D+ +LT+TNEGL+ YLLL  E ++     + ++K  N 
Sbjct: 177 QTLEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVDESNKISRAEIAEIKLQNQ 236

Query: 241 GWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQK-NTNWNPRLHFVWSVLLPLF 299
           GWK NDPLA+GNLP LTKVL ++  +  A     E +KQK   NWNPRLHFVW  LL   
Sbjct: 237 GWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDN--EQRKQKGGANWNPRLHFVWEKLLSTI 294

Query: 300 GNGKLE---NTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFLI 356
            NG         H+S             SI+F EFW+M VDE++FN+KASSERKYLGFLI
Sbjct: 295 INGSHSLNVEDKHVSKKRKKNNTIA---SIKFHEFWQMVVDETYFNDKASSERKYLGFLI 351

Query: 357 IDAAFKAVPGSY--IGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANR 414
              AF  +  SY  +     QN +R+LINQ  + +R LNKI+  T++ IV++CE D+  +
Sbjct: 352 FQRAFPMLK-SYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-K 409

Query: 415 LVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVLS 474
           ++P    + FG  GSI FD+L+K+  +S+L+ IK +                  K    S
Sbjct: 410 ILPVFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSEEKS 469

Query: 475 HTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLY 534
            + F LDS+LH+VR  K E++ + + + VL  IV +AFF  T D+   E L E++KERL+
Sbjct: 470 FSQFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFF--TGDN---ETLQEMSKERLF 524

Query: 535 SILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHV--GD-LINPLDENLENIKNEAI 591
           SIL EL  N     +  EI   QY+ +KL+      H+  G+ + + LD+ L   ++ A+
Sbjct: 525 SILSEL--NSLHLSESQEIP--QYVVIKLV----QQHIEGGEKMTSELDDELRETESSAL 576

Query: 592 SCLSKVCRSRTAQSW--GLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH----ENNSMV 645
             L+++ ++ T + +  GL +L + CL+QLY GD++S+  ++EL +  +     +   + 
Sbjct: 577 RILAEIAKA-TDKPYLRGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLS 635

Query: 646 GITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702
            ITEI                  +W+Q +  V  +EL +LLDIL ARENKQGFAQLF
Sbjct: 636 SITEILLSLLAQKKALLKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  218 bits (556), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 170/265 (64%), Gaps = 5/265 (1%)

Query: 754  NIDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 813
            NIDKE TSAL KAL+LP +I+N  GEV                                 
Sbjct: 755  NIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDDDEDDEDDESMDDEQMMDLDDQL 814

Query: 814  SEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEH 873
            SEIFKRRKEALS+I TGN+RK EVK+SRE+VI+FKHR+VD+L VY+K+ EK+ +  +   
Sbjct: 815  SEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLVYIKHVEKM-IQREDVD 873

Query: 874  SNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIELM 933
             N+    L+ L+ F IPM+KC+ +TLD+ LA+K++KLLK ++FKI+VT  K    D+  +
Sbjct: 874  ENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKIRVTGIKLDTADV--V 931

Query: 934  DLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGNDK--LDELIDLYTATTK 991
            +  ++ H+  L +KPGQ   ++YS+CS++SL+ SK+ V+     +   + L+D Y+ T K
Sbjct: 932  EDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQGVYETLVDTYSTTIK 991

Query: 992  EWMQKGKCGPNIFIDFINWLSSKKQ 1016
            EW++  K   +IF+DF+NWL+SKKQ
Sbjct: 992  EWLKDTKFPHSIFLDFVNWLASKKQ 1016

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  461 bits (1187), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 288/734 (39%), Positives = 417/734 (56%), Gaps = 64/734 (8%)

Query: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63
           +VNRDLF++LASD+ EER+ AAV ++ +LS +   D+ +EW YVL RLIKGL+S R  AR
Sbjct: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDERGI 123
           LGFS+CL+EV+ L      G     LES   ++  L   L     +G  K+  GK+ERG+
Sbjct: 63  LGFSMCLSEVVTL------GLEKGRLESVEVYIGQLFEKLA----DGHVKN--GKEERGL 110

Query: 124 XXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLFQ 183
                       NEPLF  IF+ D +  + +F + F + L+ LAL K W++EPC FTL+Q
Sbjct: 111 VFGKLFGLQALLNEPLFGRIFM-DGKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQ 169

Query: 184 TM-KMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLLKYEGDE-------SLIPSVL 235
            + K+   F +    E I  + D + LTLTNEGL+ YLLL YE  E       S I S +
Sbjct: 170 LIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKSKILSKI 229

Query: 236 DLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVL 295
            L++  WK+NDPL++GN+ +L+ VL++  +IP  +  +K+       +W PRLHFVW +L
Sbjct: 230 TLRS-CWKNNDPLSKGNVTILSSVLKD--IIPVEDNVMKQ-----KGSWAPRLHFVWDIL 281

Query: 296 LPLFGN-----GKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERK 350
           +P+        G  E+               V+  + F EFW++ VDESFFN KASSERK
Sbjct: 282 IPILCRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERK 341

Query: 351 YLGFLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEED 410
           YLG LII+ A + VP SY+   FS+N+MRTLINQS +S R L+KIS   L +IV  CE D
Sbjct: 342 YLGLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESD 401

Query: 411 SANRLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKK 470
              +++P +N++ FGP+GSINFD LTKS T+  +IA++ L S                + 
Sbjct: 402 -PTKVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKES 460

Query: 471 GVLSHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKL-------- 522
             +S   + LD +LHIV+AHK++  DM   KP+L  IV ++FF     D +         
Sbjct: 461 SPVSKVRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHAD 519

Query: 523 -----EQLHELAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLIN 577
                +++  L++ERL+SILG+L    +     P   +W Y+TL+++  I   H   LI 
Sbjct: 520 ADAESKKIPVLSRERLFSILGQLIPTSKQNVDGP---TWPYVTLQIV--IAEEHRRSLIF 574

Query: 578 PLDENLENIKNEAISCLSKVCRSRTAQSWGLS------TLLSMCLVQLYAGDTDSISVIE 631
            LDE L+  K  A+  ++ + R ++ +S   S       LL + ++Q+Y+GD +S S++E
Sbjct: 575 KLDEELQQTKEHALKAINDI-RKKSQESPQASELCGLELLLGVTILQMYSGDAESASILE 633

Query: 632 ELCEFSKH---ENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDI 688
           EL  F K    + N +VGITEI                 I+W+  I+++  +EL +L DI
Sbjct: 634 ELTTFYKSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDI 693

Query: 689 LKARENKQGFAQLF 702
           L  RENKQGFA LF
Sbjct: 694 LSVRENKQGFAALF 707

 Score =  204 bits (520), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 160/264 (60%), Gaps = 10/264 (3%)

Query: 755  IDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS 814
            I+KE TSAL  AL LP+N++++ G+V                                 S
Sbjct: 768  INKETTSALADALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEAMMELDGQL---S 824

Query: 815  EIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHS 874
            EIFKRRKEALS + TGN+RK EV++SRE+VISFKHRV+DML +Y KY   + LA KS+  
Sbjct: 825  EIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEIYCKYV--VRLAGKSQQC 882

Query: 875  NNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDI-ELM 933
                  L  +   I P+LKC+ +T+DRPLA+K +KLLK  I K+K+  FK    ++ E++
Sbjct: 883  E--ASKLLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKLKLEPFKGCVDEVSEIV 940

Query: 934  DL-LKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND-KLDELIDLYTATTK 991
             L L+  H  ML  KPGQ   +++  CSTSSLFL K+ V    ++   + +ID+Y+ + K
Sbjct: 941  FLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPDEVTYNRIIDIYSQSIK 1000

Query: 992  EWMQKGKCGPNIFIDFINWLSSKK 1015
             W  KGK GPN FIDFINWL+SK+
Sbjct: 1001 NWTVKGKFGPNFFIDFINWLASKR 1024

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  423 bits (1088), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 268/724 (37%), Positives = 399/724 (55%), Gaps = 57/724 (7%)

Query: 4   KVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRNSAR 63
           ++NRDLF+KLASDL EERL A + L+  LS L+   D+ EW YVL+RLIKGLSS RN AR
Sbjct: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLE--KDSSEWQYVLDRLIKGLSSSRNGAR 62

Query: 64  LGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMK-GKDERG 122
           LGFSLCLTEV+ LA+        KG+      L+ +   +++ ++  +K+++K GK+ERG
Sbjct: 63  LGFSLCLTEVVALALE-------KGV------LARVDQYMHLLISALSKENVKNGKEERG 109

Query: 123 IXXXXXXXXXXXXNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFTLF 182
           +            NEPLFS++F  D  + N E    +   LID+AL K WI+E   FTLF
Sbjct: 110 LLFGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLF 169

Query: 183 QTMKMLLPFMDESSAEKILL-IYDKYDLTLTNEGLSTYLLLKYEGDESLIPSV------- 234
           Q ++ L P +      K +L + D   LT T+EGL+ YL L +    +  P +       
Sbjct: 170 QAVEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLHRCSHT-GPVLRKKGFLD 228

Query: 235 -LDLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWS 293
            L+LKNP WK+NDPL RGNLP ++  L++S    D       +  QK   W PRLHF W 
Sbjct: 229 ELNLKNP-WKNNDPLKRGNLPAISNALKDSGARDDP------SLTQKGV-WAPRLHFAWD 280

Query: 294 VLLPLFGNGKLENTSHISXXXXXXXXXXVQNSIQFPEFWKMAVDESFFNEKASSERKYLG 353
           ++L    + +    + +            +  I+FPEFWK  VDESFFNEK+SSERKYLG
Sbjct: 281 IVLQTLLHAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLG 340

Query: 354 FLIIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSAN 413
            L+ +  F+  P  Y+   FS+N++R LINQ   ++R L+KISQ  L +IV+ C+     
Sbjct: 341 ILVFEKTFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVCKAQ-PE 399

Query: 414 RLVPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTXXXXXXXXXXXXXXXKKGVL 473
           +  P    + FG +G+INFD LTK+ TV+ L++ K L S                    L
Sbjct: 400 KTAPSFVGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLKEL 459

Query: 474 SHTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTS-DDLKLEQ-----LHE 527
           S   F LD+ILH+VRAHK   +++  +KPVL+ +V + FF+ +   D+K  Q     L  
Sbjct: 460 SRARFILDAILHLVRAHKAHADEV-WLKPVLKALVCLGFFQQSELKDVKDSQESFHSLSS 518

Query: 528 LAKERLYSILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIK 587
           +A ERL+SIL +L   ++    D     W ++ ++L+    N     L+  +DE L +I 
Sbjct: 519 IASERLFSILADLLTVEQ----DTYSVCWPFIAVQLLKTDTNQKT--LLQSMDEELGDIL 572

Query: 588 NEAISCLSKVCR----SRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKH---- 639
           + +++ LS + +    +  +Q  GL  L S+ ++Q YAG+ +SISV+E+L  F       
Sbjct: 573 DSSMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDG 632

Query: 640 -ENNSMVGITEIXXXXXXXXXXXXXXXXXIIWQQFIEEVGLEELQILLDILKARENKQGF 698
            ++  + G  EI                 + W+ F+ +V  ++L +LL++L  RENK+GF
Sbjct: 633 AKSAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGF 692

Query: 699 AQLF 702
           + LF
Sbjct: 693 SNLF 696

 Score =  202 bits (515), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 119/266 (44%), Positives = 163/266 (61%), Gaps = 13/266 (4%)

Query: 755  IDKEATSALVKALNLPDNIVNDKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXS 814
            IDKEATSAL KALNLPD+IV+DKGEV                                 S
Sbjct: 748  IDKEATSALAKALNLPDSIVDDKGEVRFEDLGDTDEEEEESEEDLDDEKMMELDGQL--S 805

Query: 815  EIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAVYVKYCEKLTLANKSEHS 874
            EIFKRRKEALS I TGN+RK EVK+SRENVI+FKHRVVDML + V++ E     +K +  
Sbjct: 806  EIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEILVRWIE-----SKMKKD 860

Query: 875  NNLGGS-LSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTAFKDMNKDIE-- 931
             ++  S L K+   I+P+L C+  TLD+PLA+KI+KLLK KI K+K  +F    + ++  
Sbjct: 861  GHIEKSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKLK-PSFSSTTEKVDKK 919

Query: 932  -LMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGN-DKLDELIDLYTAT 989
             ++ LL+  H+ ML  K GQ   +++S CST+S+FL++L V+     +  +EL  +Y  T
Sbjct: 920  AVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPELETYEELTGIYHKT 979

Query: 990  TKEWMQKGKCGPNIFIDFINWLSSKK 1015
               W   GK G ++F++F+NWLS KK
Sbjct: 980  LDGWFVTGKFGVSMFVEFLNWLSVKK 1005

>KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {ON}
           weakly similar to uniprot|P52868 Saccharomyces
           cerevisiae YGL128C
          Length = 270

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 863 EKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFKIKVTA 922
           EKL   ++ E     G +L KLV+F IP+    N +      D ++KL +  +F+IK+  
Sbjct: 108 EKLISYDEIEKIQRYGQTLRKLVHFEIPISDWRNPSFTEN-TDDLNKLTETCLFRIKLVK 166

Query: 923 FKDMNKDIELMDLLKK 938
            K+ N + +L +  +K
Sbjct: 167 RKEYNNEQKLNEWFRK 182

>TBLA0A01800 Chr1 (439946..440575) [630 bp, 209 aa] {ON} Anc_6.157
           YBR242W
          Length = 209

 Score = 32.3 bits (72), Expect = 4.5,   Method: Composition-based stats.
 Identities = 27/106 (25%), Positives = 46/106 (43%), Gaps = 14/106 (13%)

Query: 550 DPEINSWQYLTLKLILDIENSHVGDLINPLD------------ENLENIKNEAISCLSKV 597
           DP ++  + + + L+ DI  S VGD I P D            E ++ + ++ IS  +KV
Sbjct: 72  DPNVDRNRCVRIALVHDIAESLVGD-ITPHDPIGKDEKHRREWETIQYLCDQLISKYNKV 130

Query: 598 CRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSKHENNS 643
                 Q W L+     C+   Y  D D   ++ +  E+ K  N +
Sbjct: 131 AAEEIKQDW-LAYENITCVEARYVKDIDKYEMLVQCYEYEKRSNGT 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,255,609
Number of extensions: 3925689
Number of successful extensions: 11768
Number of sequences better than 10.0: 27
Number of HSP's gapped: 11800
Number of HSP's successfully gapped: 64
Length of query: 1022
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 902
Effective length of database: 39,721,479
Effective search space: 35828774058
Effective search space used: 35828774058
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)