Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR507C (GIN4)1.52ON1142114250200.0
Smik_4.7891.52ON1136114645390.0
Skud_4.7831.52ON1135114643870.0
Suva_2.6871.52ON1128114943090.0
CAGL0K05709g1.52ON110397423540.0
KAFR0D041001.52ON111755720020.0
TDEL0C064901.52ON115357419050.0
KNAG0F002901.52ON112556618950.0
Kpol_2002.461.52ON112357118780.0
NCAS0B086001.52ON111758218490.0
NDAI0A006601.52ON102256218340.0
ZYRO0F17402g1.52ON118957018200.0
KLLA0C01650g1.52ON111257517980.0
TPHA0E036401.52ON113758517630.0
KLTH0F01672g1.52ON116457117620.0
SAKL0C01716g1.52ON121559617290.0
Ecym_10581.52ON116458117170.0
AFR696C1.52ON114257917140.0
TBLA0A071501.52ON139142316910.0
Skud_3.391.52ON101735814510.0
YCL024W (KCC4)1.52ON103735814510.0
Smik_3.541.52ON103236114371e-180
Suva_3.1901.52ON102436014311e-179
KLTH0D05566g2.479ON112835510331e-121
SAKL0E02860g2.479ON137735510441e-121
Ecym_73922.479ON143435510381e-119
ABL034W2.479ON142536010341e-119
Kwal_26.77882.479ON126736310221e-118
KLLA0F13552g2.479ON126736210181e-118
YKL101W (HSL1)2.479ON151838910221e-117
Smik_11.1392.479ON153438910201e-116
TDEL0A025502.479ON136939610091e-116
Suva_11.1232.479ON152639010131e-115
TBLA0I011502.479ON174538110151e-115
NCAS0A057702.479ON146138310061e-115
Skud_11.1262.479ON151838910071e-115
KNAG0A065402.479ON14323899921e-113
KAFR0D032002.479ON14483809891e-113
ZYRO0G03366g2.479ON16163989821e-111
CAGL0K08514g2.479ON14894079781e-111
Kpol_431.92.479ON15524029781e-111
TPHA0G032002.479ON15344269071e-101
Kwal_33.132251.52ON9643678666e-99
NDAI0D027502.479ON15152988382e-92
Kwal_33.13222singletonOFF1481206055e-72
TPHA0C004705.611ON6312946442e-71
CAGL0M08910g5.611ON6122816381e-70
KLLA0A03806g5.611ON6022706325e-70
NCAS0A080805.611ON6232706319e-70
Kpol_495.145.611ON6242776311e-69
TBLA0E033605.611ON6542776331e-69
YDR477W (SNF1)5.611ON6332706311e-69
Smik_4.7545.611ON6322706292e-69
Suva_2.6515.611ON6332706293e-69
Skud_4.7515.611ON6342706275e-69
KNAG0B032305.611ON6412836222e-68
Kpol_1018.655.611ON6012706193e-68
Kwal_47.182335.611ON5982746184e-68
KAFR0C058605.611ON6442706205e-68
AEL230W5.611ON6082706176e-68
KLTH0G05698g5.611ON5972746157e-68
NDAI0H009405.611ON6852706201e-67
TPHA0D028405.611ON6342696171e-67
TDEL0A047805.611ON6212706142e-67
SAKL0G06952g5.611ON5992706104e-67
Ecym_55885.611ON6132706106e-67
ZYRO0A05544g5.611ON6312986109e-67
KNAG0J015908.654ON8053195252e-54
Kwal_26.87098.654ON8293455191e-53
SAKL0H07084g8.654ON9192995183e-53
TPHA0G017108.654ON8052885135e-53
NCAS0C015908.654ON8642985111e-52
CAGL0M02519g8.654ON7563005072e-52
NDAI0E023208.654ON9322945122e-52
TDEL0A060008.654ON7902935072e-52
KLTH0D10714g8.654ON8723005093e-52
ZYRO0F06842g8.654ON8433035083e-52
NDAI0E012908.654ON7292955017e-52
Kpol_1072.298.654ON8932875069e-52
Suva_16.1698.654ON8582985031e-51
Kpol_1012.68.654ON6282964913e-51
CAGL0J03872g8.654ON6612874924e-51
KAFR0A037308.654ON7882934941e-50
NDAI0J012508.279ON11763505011e-50
CAGL0M11396g8.279ON11922895002e-50
Smik_6.3398.654ON8652984942e-50
NCAS0B014708.654ON7272904883e-50
CAGL0M02299g8.668ON8932824933e-50
YPL141C (FRK1)8.654ON8652984924e-50
Ecym_83398.654ON9202904934e-50
Skud_16.1408.654ON8652984907e-50
Smik_4.3678.279ON10662844947e-50
TPHA0J008208.279ON12182894948e-50
KAFR0H025408.654ON8173354861e-49
ACR119W8.654ON9312974882e-49
Skud_4.3838.279ON10652844902e-49
NCAS0B050908.279ON12102944902e-49
TBLA0B039708.654ON12082944902e-49
Suva_2.2838.279ON10892844893e-49
TPHA0D011408.654ON6222974744e-49
Smik_15.4178.654ON8062944816e-49
YDR122W (KIN1)8.279ON10642844849e-49
NCAS0B037408.279ON10492904831e-48
NDAI0B020708.279ON12583484851e-48
TBLA0C046008.279ON13152844832e-48
KNAG0G021108.279ON11922974813e-48
Kpol_1066.468.279ON12252844788e-48
TDEL0F040608.279ON11263044779e-48
Skud_15.3998.654ON8073444711e-47
SAKL0H16632g8.279ON10622894751e-47
SAKL0H06754g8.668ON8842794712e-47
Skud_12.1648.279ON11602894742e-47
Suva_8.2848.654ON8082944682e-47
Smik_12.1558.279ON11622894733e-47
KAFR0B028008.279ON10952984723e-47
YLR096W (KIN2)8.279ON11472894723e-47
KNAG0A030408.654ON6442934604e-47
Suva_10.1808.279ON11592934715e-47
YOR233W (KIN4)8.654ON8002944639e-47
TBLA0C017508.654ON9812974679e-47
Ecym_42918.279ON11452994662e-46
KLLA0F19536g8.279ON11042894624e-46
AGR058W8.279ON10712934625e-46
KLTH0G13288g8.279ON11423334601e-45
KLLA0D07348g8.654ON9092944561e-45
ZYRO0D06776g8.279ON12042844563e-45
ZYRO0F07194g8.668ON9383324524e-45
KNAG0H031408.279ON9362844491e-44
NDAI0E023908.668ON8833054453e-44
CAGL0B01925g8.279ON9442894454e-44
KNAG0J016708.668ON10093454445e-44
NCAS0C016708.668ON8962794411e-43
KLLA0F11319g8.668ON8432924381e-43
TPHA0G016308.668ON8712794372e-43
KNAG0D010906.222ON3722944115e-43
KNAG0I014801.374ON4402964158e-43
SAKL0D07656g1.374ON4322724131e-42
TDEL0A061408.668ON8613504302e-42
ACR133C8.668ON8512824273e-42
TBLA0B038608.668ON9882824276e-42
Kpol_1072.198.668ON8962814267e-42
NDAI0G053001.374ON4372754087e-42
Kwal_26.87518.668ON8482774248e-42
Ecym_24058.668ON8552824231e-41
KLTH0D11044g8.668ON8493454221e-41
KLLA0F23155g1.374ON4272704023e-41
TPHA0O011201.374ON4293094005e-41
TBLA0B038408.676ON8583074168e-41
Smik_6.3508.676ON8222904151e-40
CAGL0M02233g8.676ON7672984131e-40
YFR014C (CMK1)1.374ON4462773982e-40
Kpol_1065.36.222ON3762793922e-40
Skud_16.1298.676ON8273104104e-40
Smik_7.3191.374ON4462793954e-40
Suva_16.1608.668ON9182944114e-40
TPHA0E028206.222ON3842593904e-40
YPL153C (RAD53)8.676ON8212914095e-40
KLTH0C10912g6.31ON6972924065e-40
Suva_16.1578.676ON8322964088e-40
KNAG0J017008.676ON8202854079e-40
NCAS0A088801.374ON4222753909e-40
Suva_6.781.374ON4452793911e-39
NDAI0E021108.676ON9032894052e-39
CAGL0F04741g1.374ON4422963892e-39
TBLA0B004906.31ON7873044032e-39
Skud_6.891.374ON4462793892e-39
KAFR0H024308.676ON7842834032e-39
KLTH0H11396g1.374ON4372773882e-39
KLTH0D11242g8.676ON7952814033e-39
Smik_6.3478.668ON9172824043e-39
Kwal_26.87968.676ON7962804033e-39
CAGL0L07326g2.352ON5063143923e-39
Skud_16.1328.668ON9242824034e-39
SAKL0H06534g8.676ON8042834014e-39
KLLA0F11143g8.676ON8132784014e-39
Kwal_56.224766.31ON6972303984e-39
Kwal_0.961.374ON4272713855e-39
YPL150W8.668ON9012824025e-39
ACL006W6.31ON7082403976e-39
TDEL0A062208.676ON7942833997e-39
Skud_13.1546.31ON7052523977e-39
Suva_13.1636.31ON7052523969e-39
YMR001C (CDC5)6.31ON7052523969e-39
Ecym_30356.31ON7402103971e-38
NCAS0B044906.222ON3492573771e-38
NCAS0D021006.31ON7262083951e-38
Smik_13.1596.31ON7052523951e-38
Kpol_1069.131.374ON4272793812e-38
Kpol_1072.168.676ON7952833952e-38
AAR009W1.374ON4532703813e-38
Kpol_1037.206.31ON7042793923e-38
CAGL0K10604g1.374ON4462793803e-38
NCAS0C013708.676ON7992813943e-38
NCAS0D006301.374ON4272793794e-38
KAFR0C044801.374ON4352873794e-38
NDAI0H035201.374ON4582733804e-38
KAFR0G026906.31ON7132393905e-38
TBLA0A020506.222ON4342743768e-38
Skud_15.1441.374ON4492753778e-38
TPHA0G016008.676ON8452833901e-37
KAFR0K003306.214ON3732813702e-37
CAGL0J11638g6.31ON7462583862e-37
Smik_6.4146.222ON3672893682e-37
YPL209C (IPL1)6.222ON3672573682e-37
Skud_16.766.214ON3822813692e-37
YPL203W (TPK2)6.214ON3802813693e-37
Suva_15.1551.374ON4522753733e-37
Smik_6.4086.214ON3812813693e-37
TBLA0D050101.374ON4342783723e-37
ZYRO0E07018g6.222ON3672603673e-37
ACR142W8.676ON8373363863e-37
KAFR0K002806.222ON3602143673e-37
Kwal_56.240916.222ON3812143683e-37
KAFR0C042801.336ON5343113773e-37
TBLA0A020306.214ON4032773693e-37
YOL016C (CMK2)1.374ON4472753724e-37
KLTH0H04180g6.214ON3532723664e-37
Kwal_56.237178.279ON8582303864e-37
Ecym_23978.676ON8722813855e-37
Skud_16.706.222ON3672573665e-37
KNAG0D011406.214ON3952813685e-37
KNAG0E008506.31ON7112513826e-37
SAKL0E01584g6.31ON6952393816e-37
TPHA0J004206.31ON7072373816e-37
CAGL0G09020g6.214ON3612723646e-37
NDAI0F016006.222ON4122143678e-37
Smik_15.1531.374ON4422753699e-37
ZYRO0F07370g8.676ON7622813811e-36
Ecym_12751.374ON4512713691e-36
Skud_10.501.182ON3972733651e-36
CAGL0I09504g1.336ON5283133731e-36
TDEL0E053106.222ON3742643631e-36
NCAS0A011006.214ON3542813612e-36
KLLA0B02332g6.222ON3612933612e-36
NDAI0A009601.182ON4082613642e-36
ZYRO0C07480g6.31ON7742643792e-36
KLLA0E01585g2.352ON5122943702e-36
Suva_16.1046.214ON3832813622e-36
TDEL0B063201.374ON4442873662e-36
NDAI0C026806.31ON7502503782e-36
Kwal_56.240596.214ON3532723602e-36
YJL164C (TPK1)1.182ON3972733623e-36
TDEL0G043806.31ON7222523763e-36
SAKL0C05368g1.182ON4182723633e-36
KLLA0B07205g1.182ON4552773654e-36
Smik_10.661.182ON3972733614e-36
KAFR0K024502.352ON5112993675e-36
CAGL0E05720g6.222ON3582743585e-36
Kpol_1033.506.214ON3842653595e-36
Kpol_1004.192.352ON4943033666e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR507C
         (1142 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1938   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1753   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1694   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1664   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   911   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   775   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   738   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   734   0.0  
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   728   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   716   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    711   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   705   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   697   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   683   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   683   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   670   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   665   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   664   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   655   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   563   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   563   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   558   e-180
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   555   e-179
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   402   e-121
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   406   e-121
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   404   e-119
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   402   e-119
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   398   e-118
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   396   e-118
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   398   e-117
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   397   e-116
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   393   e-116
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   394   e-115
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   395   e-115
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   392   e-115
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   392   e-115
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   386   e-113
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   385   e-113
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   382   e-111
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   381   e-111
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   381   e-111
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   353   e-101
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   338   6e-99
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   327   2e-92
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   237   5e-72
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   252   2e-71
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   250   1e-70
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   248   5e-70
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   247   9e-70
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   247   1e-69
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   248   1e-69
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   247   1e-69
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   246   2e-69
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   246   3e-69
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   246   5e-69
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   244   2e-68
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   243   3e-68
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   242   4e-68
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   243   5e-68
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   242   6e-68
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   241   7e-68
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   243   1e-67
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              242   1e-67
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   241   2e-67
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   239   4e-67
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   239   6e-67
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   239   9e-67
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   206   2e-54
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   204   1e-53
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   204   3e-53
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   202   5e-53
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    201   1e-52
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   199   2e-52
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              201   2e-52
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   199   2e-52
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   200   3e-52
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   200   3e-52
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   197   7e-52
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   199   9e-52
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   198   1e-51
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   193   3e-51
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   194   4e-51
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   194   1e-50
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   197   1e-50
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   197   2e-50
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   194   2e-50
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    192   3e-50
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   194   3e-50
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   194   4e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   194   4e-50
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   193   7e-50
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   194   7e-50
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   194   8e-50
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   191   1e-49
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   192   2e-49
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   193   2e-49
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             193   2e-49
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   193   2e-49
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   192   3e-49
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   187   4e-49
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   189   6e-49
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   191   9e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   190   1e-48
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             191   1e-48
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   190   2e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   189   3e-48
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   188   8e-48
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   188   9e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   186   1e-47
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   187   1e-47
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   186   2e-47
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   187   2e-47
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   184   2e-47
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   186   3e-47
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   186   3e-47
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   186   3e-47
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   181   4e-47
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   186   5e-47
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   182   9e-47
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   184   9e-47
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   184   2e-46
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   182   4e-46
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   182   5e-46
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   181   1e-45
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   180   1e-45
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   180   3e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   178   4e-45
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   177   1e-44
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   176   3e-44
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   176   4e-44
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   175   5e-44
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   174   1e-43
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   173   1e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   172   2e-43
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   162   5e-43
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   164   8e-43
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   163   1e-42
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   170   2e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   169   3e-42
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   169   6e-42
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   168   7e-42
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   161   7e-42
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   167   8e-42
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   167   1e-41
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   167   1e-41
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   159   3e-41
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   158   5e-41
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   164   8e-41
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   164   1e-40
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   163   1e-40
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   157   2e-40
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   155   2e-40
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   162   4e-40
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   156   4e-40
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   162   4e-40
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   154   4e-40
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   162   5e-40
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   160   5e-40
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   161   8e-40
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             161   9e-40
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   154   9e-40
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   155   1e-39
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   160   2e-39
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   154   2e-39
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   159   2e-39
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   154   2e-39
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   159   2e-39
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   154   2e-39
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   159   3e-39
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   160   3e-39
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   159   3e-39
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   155   3e-39
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   159   4e-39
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   159   4e-39
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   159   4e-39
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   157   4e-39
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   152   5e-39
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   159   5e-39
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   157   6e-39
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   158   7e-39
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   157   7e-39
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   157   9e-39
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   157   9e-39
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   157   1e-38
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    149   1e-38
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     156   1e-38
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   156   1e-38
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   151   2e-38
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   156   2e-38
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   151   3e-38
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   155   3e-38
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   150   3e-38
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   156   3e-38
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   150   4e-38
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   150   4e-38
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              150   4e-38
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   154   5e-38
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              149   8e-38
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   149   8e-38
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   154   1e-37
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   147   2e-37
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   153   2e-37
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   146   2e-37
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   146   2e-37
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   146   2e-37
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   146   3e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   148   3e-37
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   146   3e-37
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   147   3e-37
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   145   3e-37
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   153   3e-37
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   145   3e-37
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   146   3e-37
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   149   3e-37
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   146   3e-37
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   147   4e-37
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   145   4e-37
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   153   4e-37
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   152   5e-37
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   145   5e-37
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              146   5e-37
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   151   6e-37
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   151   6e-37
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   151   6e-37
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   144   6e-37
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   145   8e-37
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   146   9e-37
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   151   1e-36
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   146   1e-36
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   145   1e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   148   1e-36
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   144   1e-36
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              143   2e-36
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   143   2e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   144   2e-36
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   150   2e-36
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   147   2e-36
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   144   2e-36
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   145   2e-36
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   150   2e-36
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   143   2e-36
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   144   3e-36
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   149   3e-36
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   144   3e-36
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   145   4e-36
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   143   4e-36
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   145   5e-36
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   142   5e-36
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   142   5e-36
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   145   6e-36
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   149   6e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   143   6e-36
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   144   6e-36
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   149   7e-36
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   142   7e-36
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   142   7e-36
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   142   1e-35
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   142   1e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   143   1e-35
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   141   1e-35
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   142   1e-35
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   141   1e-35
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    141   1e-35
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   143   2e-35
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   144   2e-35
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   144   2e-35
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   147   2e-35
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   140   3e-35
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   140   3e-35
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   143   3e-35
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   145   3e-35
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   140   3e-35
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   140   5e-35
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   142   5e-35
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   140   5e-35
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   139   7e-35
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   140   7e-35
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   139   8e-35
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   142   9e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   138   1e-34
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   138   1e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      139   1e-34
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   141   2e-34
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   140   2e-34
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   139   2e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   137   2e-34
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   137   2e-34
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   140   2e-34
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   138   3e-34
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   144   3e-34
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   137   4e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   138   4e-34
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   140   4e-34
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   137   6e-34
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   138   7e-34
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   137   8e-34
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   139   1e-33
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   138   1e-33
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   138   2e-33
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   138   2e-33
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   135   3e-33
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   134   3e-33
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   140   4e-33
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   136   4e-33
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   137   5e-33
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   137   5e-33
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   137   5e-33
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   140   6e-33
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   136   8e-33
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   139   1e-32
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   135   1e-32
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   139   1e-32
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   140   1e-32
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   134   1e-32
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   135   1e-32
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   138   1e-32
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   135   2e-32
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   138   3e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   134   3e-32
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              135   3e-32
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   137   4e-32
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   137   4e-32
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   137   4e-32
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   137   5e-32
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   137   7e-32
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   133   8e-32
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   133   8e-32
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   135   1e-31
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   135   1e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   131   1e-31
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   129   2e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   135   2e-31
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   135   2e-31
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   133   2e-31
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   135   2e-31
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   133   3e-31
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   133   3e-31
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   131   3e-31
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   131   4e-31
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   133   4e-31
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   134   4e-31
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   134   4e-31
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   130   5e-31
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   134   5e-31
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   133   5e-31
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   132   5e-31
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   134   5e-31
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   133   6e-31
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   128   6e-31
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   133   6e-31
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   133   7e-31
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   133   7e-31
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   130   8e-31
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   129   9e-31
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   132   9e-31
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   132   9e-31
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   133   1e-30
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   133   1e-30
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   127   1e-30
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   132   2e-30
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             130   2e-30
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   129   2e-30
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   132   2e-30
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   130   2e-30
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   131   2e-30
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   129   2e-30
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   131   3e-30
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   132   3e-30
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   130   3e-30
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   130   4e-30
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   130   4e-30
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   130   4e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   131   4e-30
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   129   4e-30
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   130   4e-30
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   131   5e-30
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   129   5e-30
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   127   5e-30
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   131   5e-30
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   130   5e-30
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   130   6e-30
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   129   6e-30
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   130   7e-30
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   127   7e-30
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   130   7e-30
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   127   8e-30
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   127   8e-30
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   127   8e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   130   9e-30
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   129   9e-30
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   129   9e-30
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   129   9e-30
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   128   9e-30
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   130   1e-29
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   130   1e-29
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   130   1e-29
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   128   1e-29
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   128   1e-29
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   126   1e-29
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   128   1e-29
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   128   1e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   127   1e-29
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   129   1e-29
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   125   1e-29
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   129   2e-29
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   127   2e-29
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   126   2e-29
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   126   2e-29
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   129   2e-29
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   129   2e-29
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   127   2e-29
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   129   2e-29
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   128   2e-29
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   125   2e-29
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   128   2e-29
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   129   2e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   127   2e-29
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    128   2e-29
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   124   2e-29
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   126   3e-29
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   129   3e-29
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   127   3e-29
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    127   3e-29
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   128   3e-29
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   127   3e-29
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   126   3e-29
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   127   3e-29
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   126   4e-29
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   127   4e-29
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   127   4e-29
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   128   4e-29
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   128   4e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   125   4e-29
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   128   4e-29
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   127   5e-29
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   125   5e-29
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   127   5e-29
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   127   6e-29
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   124   6e-29
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   127   6e-29
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   124   6e-29
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   126   6e-29
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   127   7e-29
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   125   8e-29
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              127   8e-29
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   127   8e-29
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     127   8e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   127   8e-29
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   127   8e-29
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   125   9e-29
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   127   1e-28
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   125   1e-28
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   125   1e-28
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   125   1e-28
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   126   1e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   125   1e-28
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   127   1e-28
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   127   1e-28
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   126   1e-28
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   126   1e-28
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   125   1e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   125   1e-28
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   125   1e-28
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   126   1e-28
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   123   1e-28
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   125   1e-28
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   125   1e-28
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   125   2e-28
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   125   2e-28
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   125   2e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   125   2e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   125   2e-28
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   124   2e-28
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             124   2e-28
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   124   2e-28
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   125   2e-28
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   123   2e-28
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   125   2e-28
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   124   2e-28
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    125   2e-28
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   121   3e-28
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   125   3e-28
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   125   3e-28
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   124   3e-28
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   124   3e-28
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   123   3e-28
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   125   3e-28
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   125   3e-28
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   124   4e-28
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   124   4e-28
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   124   4e-28
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   124   4e-28
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   124   4e-28
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   123   4e-28
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   124   4e-28
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   121   4e-28
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   124   4e-28
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   123   5e-28
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   124   5e-28
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   123   5e-28
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   123   5e-28
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   121   5e-28
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   124   5e-28
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   124   5e-28
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   124   6e-28
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   121   6e-28
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   121   7e-28
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   123   7e-28
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   124   7e-28
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   122   7e-28
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   124   8e-28
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   122   8e-28
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   120   8e-28
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   124   8e-28
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   124   8e-28
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   121   8e-28
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   122   9e-28
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   122   9e-28
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   122   1e-27
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   123   1e-27
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   123   1e-27
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   123   1e-27
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   123   1e-27
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   124   1e-27
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   123   1e-27
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   120   1e-27
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   121   1e-27
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   123   1e-27
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   122   1e-27
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   123   1e-27
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   122   2e-27
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   121   2e-27
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   122   2e-27
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   122   2e-27
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   123   2e-27
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   120   2e-27
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   119   2e-27
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   120   2e-27
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   122   2e-27
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   122   2e-27
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   122   2e-27
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   121   2e-27
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   119   2e-27
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   122   2e-27
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   122   2e-27
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   121   2e-27
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   121   2e-27
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   122   2e-27
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   122   2e-27
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    122   2e-27
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   119   3e-27
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   122   3e-27
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   122   3e-27
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   120   3e-27
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   119   3e-27
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   121   3e-27
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   119   3e-27
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   121   3e-27
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   122   3e-27
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   121   3e-27
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   119   3e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   122   3e-27
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   119   4e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   121   4e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   120   4e-27
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   120   4e-27
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   120   5e-27
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   121   5e-27
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   120   5e-27
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   120   5e-27
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   120   5e-27
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   121   5e-27
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   120   5e-27
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   120   6e-27
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   121   6e-27
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   120   6e-27
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   120   6e-27
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   119   6e-27
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   120   7e-27
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                117   7e-27
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   120   7e-27
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   120   7e-27
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   119   7e-27
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   120   7e-27
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   117   8e-27
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   120   8e-27
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   119   8e-27
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   120   8e-27
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   120   8e-27
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   120   9e-27
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   120   9e-27
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   119   9e-27
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   120   9e-27
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   118   9e-27
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    120   1e-26
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   120   1e-26
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   117   1e-26
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   120   1e-26
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   119   1e-26
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   120   1e-26
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   120   1e-26
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   119   1e-26
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   120   1e-26
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   119   1e-26
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    114   1e-26
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   119   1e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   119   1e-26
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   113   1e-26
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   117   2e-26
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   117   2e-26
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   119   2e-26
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   119   2e-26
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   119   2e-26
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   119   2e-26
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   119   2e-26
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   119   2e-26
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   118   2e-26
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   119   2e-26
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   119   2e-26
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             119   2e-26
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   116   2e-26
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   119   2e-26
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   118   3e-26
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   119   3e-26
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   119   3e-26
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   118   3e-26
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   117   3e-26
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   118   3e-26
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   114   3e-26
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   119   3e-26
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   119   3e-26
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   118   3e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   116   3e-26
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   115   3e-26
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   112   3e-26
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   112   3e-26
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   119   3e-26
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   118   4e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   112   4e-26
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   118   4e-26
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   118   4e-26
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   116   4e-26
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   111   5e-26
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   117   5e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   115   5e-26
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   115   6e-26
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   117   6e-26
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   117   6e-26
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   117   6e-26
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   115   6e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   116   7e-26
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   117   7e-26
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   117   8e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   116   8e-26
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   116   9e-26
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   117   9e-26
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   110   1e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   116   1e-25
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   114   1e-25
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   117   1e-25
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   113   1e-25
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   116   1e-25
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   117   1e-25
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   114   1e-25
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   115   1e-25
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   117   1e-25
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   115   1e-25
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   117   1e-25
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   116   2e-25
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              114   2e-25
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   116   2e-25
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   115   2e-25
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   112   2e-25
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   112   2e-25
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   115   2e-25
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   114   2e-25
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   115   2e-25
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   112   2e-25
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   112   2e-25
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   115   2e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   114   2e-25
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   113   3e-25
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   115   3e-25
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   112   3e-25
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   112   3e-25
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   112   3e-25
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   112   3e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   113   3e-25
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   113   3e-25
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   113   3e-25
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   111   4e-25
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   108   4e-25
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   114   4e-25
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   112   4e-25
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   114   5e-25
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   112   5e-25
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   112   5e-25
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   111   5e-25
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   114   6e-25
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   114   6e-25
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   108   6e-25
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   112   6e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   114   6e-25
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   111   7e-25
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   114   7e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   108   8e-25
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   113   8e-25
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   112   8e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   112   8e-25
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   113   9e-25
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   107   9e-25
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   112   9e-25
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   111   9e-25
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   113   1e-24
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   112   1e-24
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   110   1e-24
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   111   1e-24
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   113   1e-24
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   113   1e-24
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   107   1e-24
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   112   1e-24
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   113   1e-24
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   112   1e-24
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   112   1e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   107   2e-24
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   112   2e-24
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   110   2e-24
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   111   2e-24
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   107   2e-24
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   111   2e-24
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   110   3e-24
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   112   3e-24
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   108   3e-24
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   111   3e-24
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   112   3e-24
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      112   3e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   111   3e-24
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   110   3e-24
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   108   3e-24
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   111   4e-24
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   111   4e-24
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   109   4e-24
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   112   4e-24
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   111   4e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   109   4e-24
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   106   4e-24
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   111   5e-24
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   105   5e-24
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   105   5e-24
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   109   5e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   110   6e-24
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   111   6e-24
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   109   6e-24
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   105   6e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   109   7e-24
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   109   7e-24
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   108   7e-24
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   107   8e-24
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   107   8e-24
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   109   8e-24
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   110   9e-24
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   109   9e-24
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    110   9e-24
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   108   9e-24
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              109   9e-24
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   110   9e-24
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    105   1e-23
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   107   1e-23
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   110   1e-23
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   110   1e-23
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   105   1e-23
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   110   1e-23
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   104   1e-23
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   104   1e-23
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   107   1e-23
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   109   1e-23
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   109   1e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   108   1e-23
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   109   2e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   107   2e-23
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   107   2e-23
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   105   2e-23
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   109   2e-23
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   107   2e-23
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   109   2e-23
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   107   2e-23
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   106   2e-23
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   109   2e-23
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   109   2e-23
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   103   2e-23
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   106   2e-23
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   108   3e-23
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   103   3e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   107   3e-23
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   108   3e-23
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   108   3e-23
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   106   3e-23
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   108   3e-23
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   108   3e-23
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   107   3e-23
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   108   3e-23
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   108   3e-23
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   108   3e-23
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   101   3e-23
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   107   3e-23
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   107   4e-23
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   108   4e-23
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   104   4e-23
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   105   4e-23
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   108   4e-23
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   107   4e-23
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   106   4e-23
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   108   4e-23
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            107   4e-23
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   108   4e-23
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   108   4e-23
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   108   4e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   108   4e-23
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   108   4e-23
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   108   4e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   106   4e-23
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   103   5e-23
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   108   5e-23
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   108   5e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   108   5e-23
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   108   5e-23
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   6e-23
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   6e-23
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   107   6e-23
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   107   6e-23
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   107   6e-23
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   102   7e-23
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   107   7e-23
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   102   8e-23
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   105   8e-23
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   102   9e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   107   9e-23
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   105   1e-22
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   105   1e-22
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   105   1e-22
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   105   1e-22
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   105   1e-22
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   105   1e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   105   1e-22
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   105   1e-22
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...   106   1e-22
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   107   1e-22
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   106   1e-22
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...   106   1e-22
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   106   1e-22
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   107   1e-22
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              105   1e-22
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    106   1e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   104   2e-22
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   104   2e-22
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   103   2e-22
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   106   2e-22
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   106   2e-22
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   106   2e-22
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...   105   2e-22
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   105   2e-22
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   105   2e-22
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   105   2e-22
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   100   2e-22
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   105   2e-22
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   105   3e-22
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   105   3e-22
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180      105   3e-22
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   104   3e-22
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   105   3e-22
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   105   3e-22
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   104   3e-22
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   105   3e-22
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   103   4e-22
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   105   4e-22
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   103   4e-22
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   105   4e-22
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   104   4e-22
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   105   5e-22
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   104   5e-22
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   105   5e-22
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   104   5e-22
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   104   5e-22
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   102   6e-22
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   104   6e-22
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   104   6e-22
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   104   6e-22
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   104   7e-22
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   104   7e-22
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   100   7e-22
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   102   7e-22
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   104   7e-22
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   104   7e-22
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   103   7e-22
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...   102   9e-22
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   103   9e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   103   9e-22
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   103   9e-22
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    99   9e-22
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   100   9e-22
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...   103   1e-21
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   103   1e-21
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   103   1e-21
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   103   1e-21
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   103   1e-21
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...   101   1e-21
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   102   1e-21
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    99   1e-21
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   103   1e-21
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    99   1e-21
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   100   1e-21
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   101   1e-21
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...   101   1e-21
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   103   2e-21
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   102   2e-21
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   103   2e-21
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   101   2e-21
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   101   2e-21
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   103   2e-21
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   101   2e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   2e-21
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    99   2e-21
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              98   2e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   2e-21
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    98   2e-21
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   100   2e-21
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...   101   2e-21
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   102   3e-21
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...   102   3e-21
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...   100   3e-21
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   102   3e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   101   3e-21
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   100   3e-21
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   100   3e-21
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    99   3e-21
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   102   3e-21
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   100   3e-21
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   100   3e-21
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...   102   3e-21
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    97   4e-21
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    97   4e-21
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   100   4e-21
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   101   4e-21
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   100   4e-21
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...   101   4e-21
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    97   5e-21
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...   100   5e-21
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   101   5e-21
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...   101   5e-21
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   101   5e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    97   5e-21
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    98   5e-21
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    98   5e-21
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    98   6e-21
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    98   6e-21
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...   100   7e-21
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    96   7e-21
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   100   7e-21
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     99   7e-21
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    99   7e-21
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    97   8e-21
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   100   8e-21
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    99   8e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   100   9e-21
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    98   9e-21
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    96   1e-20
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    99   1e-20
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   100   1e-20
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    96   1e-20
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    98   1e-20
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    99   1e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    97   1e-20
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    99   1e-20
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    99   1e-20
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   100   1e-20
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    99   1e-20
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    96   1e-20
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...   100   2e-20
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   100   2e-20
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    99   2e-20
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   100   2e-20
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    99   2e-20
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    99   2e-20
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    94   2e-20
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    99   2e-20
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    99   2e-20
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    98   2e-20
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    96   2e-20
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    99   2e-20
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    98   2e-20
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    95   2e-20
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    99   2e-20
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    95   2e-20
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    96   2e-20
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    98   3e-20
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    99   3e-20
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    98   3e-20
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    98   3e-20
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    98   3e-20
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    97   3e-20
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    96   3e-20
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    98   3e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    99   3e-20
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    99   3e-20
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    99   4e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      98   4e-20
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    98   4e-20
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    99   4e-20
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    97   4e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    94   5e-20
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    98   5e-20
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    97   5e-20
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    97   5e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    96   5e-20
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     96   5e-20
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    95   6e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    94   6e-20
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    95   6e-20
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    97   6e-20
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    97   6e-20
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    97   7e-20
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    94   7e-20
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    98   7e-20
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    97   7e-20
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    97   7e-20
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    93   7e-20
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    93   7e-20
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    98   7e-20
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    97   8e-20
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    96   8e-20
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    97   9e-20
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    96   9e-20
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    93   9e-20
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    95   9e-20
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    94   9e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    96   1e-19
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    96   1e-19
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    91   1e-19
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    94   1e-19
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    97   1e-19
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    98   1e-19
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    94   1e-19
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    96   1e-19
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    93   1e-19
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    93   1e-19
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    96   1e-19
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    96   1e-19
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    94   1e-19
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    96   1e-19
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    97   1e-19
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    96   1e-19
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    96   1e-19
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    96   1e-19
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    96   1e-19
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    96   1e-19
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    95   1e-19
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    96   1e-19
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    94   1e-19
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    97   1e-19
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    96   1e-19
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    96   1e-19
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    95   1e-19
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    95   2e-19
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    97   2e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    94   2e-19
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    96   2e-19
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     96   2e-19
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    96   2e-19
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    92   2e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    95   2e-19
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    95   2e-19
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    95   2e-19
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    96   2e-19
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    95   2e-19
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    96   2e-19
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    92   2e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    94   2e-19
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    95   2e-19
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    94   2e-19
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    97   2e-19
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    93   3e-19
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    94   3e-19
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    95   3e-19
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    95   3e-19
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    96   3e-19
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    95   3e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    96   3e-19
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    94   3e-19
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    95   3e-19
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    96   4e-19
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    96   4e-19
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    94   4e-19
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    94   4e-19
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    95   4e-19
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    93   4e-19
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    94   4e-19
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    95   4e-19
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    91   4e-19
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    91   4e-19
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    94   5e-19
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    96   5e-19
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    95   5e-19
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    94   5e-19
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    92   5e-19
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    94   5e-19
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    92   5e-19
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    95   5e-19
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    94   6e-19
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    94   6e-19
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    95   6e-19
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    94   6e-19
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     94   6e-19
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    91   6e-19
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    94   6e-19
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    95   6e-19
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    92   7e-19
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    94   7e-19
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    94   7e-19
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    95   7e-19
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    95   7e-19
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    91   7e-19
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    94   8e-19
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    93   8e-19
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    94   8e-19
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    91   8e-19
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    92   9e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    91   9e-19
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    92   9e-19
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    94   9e-19
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    93   9e-19
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    94   9e-19
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    94   9e-19
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    95   1e-18
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    91   1e-18
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    93   1e-18
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    93   1e-18
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    94   1e-18
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    91   1e-18
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    94   1e-18
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    93   1e-18
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    93   1e-18
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    93   1e-18
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    93   1e-18
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    94   1e-18
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    93   1e-18
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    94   1e-18
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    91   1e-18
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    93   1e-18
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    93   1e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   1e-18
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    93   1e-18
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    92   2e-18
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    90   2e-18
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    89   2e-18
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    92   2e-18
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    93   2e-18
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    91   2e-18
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    93   2e-18
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    91   2e-18
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    90   2e-18
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    92   2e-18
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    93   2e-18
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    94   2e-18
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    94   2e-18
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    94   2e-18
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    89   2e-18
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    90   2e-18
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    92   2e-18
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    93   2e-18
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    92   2e-18
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    93   2e-18
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    93   2e-18
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    91   2e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    93   3e-18
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    92   3e-18
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    92   3e-18
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    92   3e-18
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    93   3e-18
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    93   3e-18
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    91   3e-18
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    91   3e-18
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    93   3e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    92   3e-18
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    92   4e-18
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    92   4e-18
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    91   4e-18
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    89   4e-18
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    91   4e-18
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    92   4e-18
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    91   4e-18
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    91   4e-18
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    92   4e-18
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    92   4e-18
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    89   5e-18
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    92   5e-18
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    91   5e-18
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    90   5e-18
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    92   5e-18
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    92   5e-18
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    91   6e-18
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    92   6e-18
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    92   6e-18
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    91   6e-18
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    92   6e-18
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    92   6e-18
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    91   6e-18
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    92   6e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    91   7e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    92   7e-18
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    91   7e-18
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    92   7e-18
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             91   7e-18
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    89   9e-18
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    86   9e-18
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    91   9e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    91   1e-17
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    90   1e-17
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    91   1e-17
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    91   1e-17
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    91   1e-17
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    91   1e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    90   2e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    89   2e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      90   2e-17
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              89   2e-17
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    90   2e-17
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    89   2e-17
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    89   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               90   2e-17
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    89   2e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    89   2e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        89   2e-17
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    89   2e-17
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    88   2e-17
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    87   2e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    89   3e-17
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    90   3e-17
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    87   3e-17
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    88   3e-17
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    90   3e-17
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    90   3e-17
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    89   3e-17
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    88   3e-17
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    89   3e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    88   3e-17
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    89   3e-17
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    89   3e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    88   3e-17
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    88   3e-17
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    87   4e-17
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    88   4e-17
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    89   4e-17
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    89   4e-17
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    89   4e-17
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    87   4e-17
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    87   4e-17
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     88   4e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    87   5e-17
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     87   5e-17
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    87   5e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    89   5e-17
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    87   5e-17
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    88   6e-17
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    87   6e-17
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    86   6e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    86   7e-17
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    88   7e-17
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    88   7e-17
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    89   7e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    88   7e-17
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    87   8e-17
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    86   8e-17
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    85   8e-17
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    85   8e-17
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    88   8e-17
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    87   9e-17
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    85   9e-17
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               87   9e-17
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    87   1e-16
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    86   1e-16
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    87   1e-16
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    87   1e-16
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    87   1e-16
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    85   1e-16
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    87   1e-16
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    87   1e-16
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    87   1e-16
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    85   1e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    85   1e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    84   1e-16
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              88   1e-16
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    85   1e-16
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    87   1e-16
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    88   1e-16
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    86   1e-16
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    87   1e-16
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    85   1e-16
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    86   1e-16
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    86   2e-16
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    86   2e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    87   2e-16
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    87   2e-16
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    84   2e-16
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    86   2e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     84   2e-16
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    86   2e-16
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    86   2e-16
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     84   2e-16
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    86   2e-16
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    86   2e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    86   2e-16
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    84   2e-16
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    85   3e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    86   3e-16
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    85   3e-16
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    86   3e-16
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    86   3e-16
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    86   3e-16
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    85   3e-16
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    85   3e-16
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    86   3e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    83   3e-16
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    84   3e-16
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    85   3e-16
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      86   3e-16
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    86   3e-16
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    85   3e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    86   3e-16
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    86   3e-16
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    86   4e-16
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    86   4e-16
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    84   4e-16
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    86   4e-16
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    84   4e-16
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    86   4e-16
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    85   4e-16
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    85   4e-16
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              86   4e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   4e-16
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    85   5e-16
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    83   5e-16
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    85   5e-16
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    83   5e-16
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    83   6e-16
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    84   6e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    84   6e-16
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    85   6e-16
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    83   6e-16
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    85   7e-16
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    85   7e-16
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      85   7e-16
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    84   8e-16
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    81   8e-16
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    82   8e-16
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    84   8e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    84   9e-16
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    84   9e-16
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    84   9e-16
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    82   1e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    85   1e-15
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    84   1e-15
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    83   1e-15
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    82   1e-15
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    83   1e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    83   1e-15
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    84   1e-15
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    84   1e-15
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    84   1e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    84   1e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    83   1e-15
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    83   1e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    83   1e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     84   1e-15
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    82   1e-15
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    82   1e-15
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    84   1e-15
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    83   1e-15
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    80   1e-15
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    82   1e-15
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    84   2e-15
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    83   2e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    82   2e-15
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    83   2e-15
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    84   2e-15
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    81   2e-15
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    84   2e-15
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    82   2e-15
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    81   2e-15
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    81   2e-15
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    83   2e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    83   2e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    83   2e-15
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    84   2e-15
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    83   2e-15
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    82   2e-15
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    81   2e-15
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    83   2e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    81   3e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    79   3e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    83   3e-15
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    81   3e-15
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    83   3e-15
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    82   3e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    80   3e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     82   3e-15
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    82   3e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    81   3e-15
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    82   3e-15
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    82   4e-15
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    81   4e-15
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    80   4e-15
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    82   4e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    80   4e-15
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    81   4e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   4e-15
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    80   4e-15
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    80   5e-15
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    80   5e-15
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    82   5e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    80   5e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    81   5e-15
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    81   5e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    80   6e-15
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    80   6e-15
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    82   6e-15
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    81   6e-15
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    81   6e-15
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    82   7e-15
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    81   7e-15
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    79   7e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    79   7e-15
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    82   7e-15
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    82   7e-15
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    79   7e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    80   8e-15
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    81   8e-15
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    80   9e-15
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    79   9e-15
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    81   9e-15
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    81   1e-14
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    81   1e-14
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    81   1e-14
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    81   1e-14
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    81   1e-14
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    79   1e-14
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    79   1e-14
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    81   1e-14
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    79   1e-14
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    80   1e-14
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    78   2e-14
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    80   2e-14
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    79   2e-14
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    80   2e-14
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    80   2e-14
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    79   2e-14
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    79   2e-14
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    79   2e-14
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    79   2e-14
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    80   2e-14
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    80   2e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    78   3e-14
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    80   3e-14
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    78   3e-14
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    78   3e-14
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    80   3e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    79   3e-14
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    79   3e-14
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    78   3e-14
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    77   3e-14
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    79   3e-14
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    79   3e-14
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    79   3e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     79   3e-14
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    79   3e-14
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    77   3e-14
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    79   4e-14
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    79   4e-14
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    77   4e-14
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    78   4e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     79   4e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    77   4e-14
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    77   4e-14
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    79   4e-14
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    79   5e-14
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    78   5e-14
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    79   5e-14
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    78   5e-14
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    79   6e-14
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    77   6e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    78   6e-14
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    78   6e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    79   6e-14
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    78   6e-14
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    79   6e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    78   6e-14
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    77   6e-14
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    77   8e-14
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    77   8e-14
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    77   8e-14
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    78   8e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    78   9e-14
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    78   9e-14
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    77   9e-14
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    77   9e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    77   1e-13
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    77   1e-13
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    77   1e-13
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    76   1e-13
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    77   1e-13
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    77   1e-13
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              77   1e-13
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    76   1e-13
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    76   1e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    77   1e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    77   1e-13
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    77   1e-13
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    77   1e-13
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    77   2e-13
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    77   2e-13
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    77   2e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    77   2e-13
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    77   2e-13
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    77   2e-13
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    77   2e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    75   2e-13
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    77   2e-13
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    77   2e-13
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    76   2e-13
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    75   2e-13
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    77   2e-13
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    77   2e-13
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    75   2e-13
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    75   2e-13
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    77   2e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    76   2e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    75   3e-13
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    76   3e-13
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    76   3e-13
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    76   3e-13
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    76   3e-13
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               74   3e-13
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    75   3e-13
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    76   3e-13
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    74   3e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    75   3e-13
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    76   4e-13
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    75   4e-13
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    75   4e-13
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    75   4e-13
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    75   5e-13
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    75   5e-13
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    75   5e-13
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    74   5e-13
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    75   5e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   5e-13
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    75   5e-13
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    74   6e-13
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    74   6e-13
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    75   6e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   6e-13
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    74   7e-13
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    75   7e-13
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    75   7e-13
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    75   8e-13
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    73   8e-13
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    73   8e-13
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    75   8e-13
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    75   8e-13
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    75   9e-13
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    75   9e-13
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    73   9e-13
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    75   9e-13
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      75   9e-13
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    74   1e-12
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    74   1e-12
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    74   1e-12
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    75   1e-12
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    74   1e-12
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    74   1e-12
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    74   1e-12
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    75   1e-12
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    75   1e-12
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    74   1e-12
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    74   1e-12
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    74   1e-12
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               74   1e-12
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    74   1e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    74   1e-12
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    74   1e-12
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    73   1e-12
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    74   1e-12
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    73   1e-12
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    72   1e-12
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             72   1e-12
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    73   1e-12
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    72   1e-12
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    72   2e-12
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    74   2e-12
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    74   2e-12
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    72   2e-12
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    74   2e-12
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    72   2e-12
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    72   2e-12
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    72   2e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    72   2e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    72   2e-12
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    73   2e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    73   2e-12
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    72   3e-12
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    74   3e-12
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    73   3e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    72   3e-12
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    73   3e-12
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    73   3e-12
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    72   3e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    71   4e-12
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    72   4e-12
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    72   4e-12
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    72   4e-12
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    71   5e-12
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    72   5e-12
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               72   5e-12
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    72   5e-12
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    72   5e-12
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    72   5e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    72   5e-12
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    72   6e-12
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    72   6e-12
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    72   7e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    72   7e-12
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    70   7e-12
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    72   7e-12
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    72   7e-12
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    72   7e-12
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    72   8e-12
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    71   9e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    70   9e-12
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    71   9e-12
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    72   1e-11
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    71   1e-11
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    71   1e-11
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    71   1e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    71   1e-11
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    71   1e-11
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    71   1e-11
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    71   1e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               70   1e-11
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    69   1e-11
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    71   1e-11
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    71   1e-11
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    70   2e-11
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    70   2e-11
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    70   2e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    69   2e-11
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    70   2e-11
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    70   2e-11
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    70   2e-11
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    70   2e-11
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    70   2e-11
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    70   2e-11
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    70   2e-11
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    70   3e-11
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    70   3e-11
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    70   3e-11
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    70   3e-11
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    70   3e-11
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    70   3e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   4e-11
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    69   4e-11
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    69   4e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    69   4e-11
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    69   5e-11
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    69   5e-11
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    69   5e-11
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    68   5e-11
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    69   5e-11
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    69   6e-11
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    69   6e-11
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    68   6e-11
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    69   6e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    68   6e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     68   7e-11
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    69   7e-11
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    67   7e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    67   8e-11
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    68   8e-11
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    67   8e-11
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    68   9e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    68   9e-11
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    68   9e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    68   1e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    68   1e-10
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    68   1e-10
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    68   1e-10
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    68   1e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    68   1e-10
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    68   1e-10
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    68   1e-10
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    67   1e-10
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    67   1e-10
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    68   1e-10
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    67   1e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    67   1e-10
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    67   1e-10
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    67   1e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    67   2e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     67   2e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    67   2e-10
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    67   2e-10
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    67   2e-10
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    67   2e-10
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    67   2e-10
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    67   2e-10
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    67   2e-10
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    67   2e-10
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    66   2e-10
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    67   2e-10
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    67   3e-10
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       67   3e-10
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    66   3e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    67   3e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    67   3e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    65   4e-10
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    66   4e-10
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    66   5e-10
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    66   5e-10
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    66   5e-10
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     65   6e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    65   6e-10
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    65   6e-10
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   6e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    65   7e-10
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    64   8e-10
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    65   9e-10
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    65   9e-10
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    65   1e-09
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    65   1e-09
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    64   1e-09
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    65   1e-09
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    64   1e-09
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    65   1e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    65   1e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    64   1e-09
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    64   1e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    64   1e-09
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    64   1e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    64   2e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    64   2e-09
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    64   2e-09
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    64   2e-09
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    64   2e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    63   2e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    63   2e-09
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    64   2e-09
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    64   2e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    64   2e-09
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    62   2e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    63   3e-09
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    63   3e-09
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    63   3e-09
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    63   3e-09
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    63   3e-09
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    63   3e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    63   3e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    62   3e-09
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    63   4e-09
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    62   4e-09
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    62   5e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    62   6e-09
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    61   6e-09
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    62   6e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    62   6e-09
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    61   7e-09
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    61   7e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    62   7e-09
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    62   7e-09
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    62   7e-09
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    61   1e-08
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    61   1e-08
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    61   1e-08
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               60   1e-08
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    61   1e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    60   2e-08
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    61   2e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    60   2e-08
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    60   2e-08
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    59   3e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    59   3e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    59   3e-08
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    59   4e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    59   4e-08
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    59   4e-08
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    59   5e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    59   5e-08
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    59   5e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    58   5e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    58   5e-08
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    59   5e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    58   6e-08
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    59   6e-08
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    59   7e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    58   7e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    58   7e-08
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    59   8e-08
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    59   8e-08
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    58   9e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    57   9e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    58   1e-07
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    58   1e-07
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    58   1e-07
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    58   1e-07
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    57   1e-07
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    58   1e-07
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               58   1e-07
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    58   1e-07
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    58   1e-07
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    57   1e-07
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    57   1e-07
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    57   2e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    57   2e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    56   2e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    57   2e-07
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    57   3e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    57   3e-07
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    57   3e-07
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    57   3e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    56   3e-07
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    57   3e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    57   3e-07
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    56   3e-07
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    57   3e-07
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    57   4e-07
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    56   4e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    55   4e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    56   5e-07
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    55   7e-07
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    55   7e-07
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    55   9e-07
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    55   1e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    54   1e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    55   1e-06
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    54   2e-06
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    53   2e-06
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    53   2e-06
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    54   2e-06
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    54   3e-06
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    53   3e-06
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    53   3e-06
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    52   4e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    52   4e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   4e-06
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    53   5e-06
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    52   5e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    53   5e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    52   6e-06
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    50   7e-06
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    52   7e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    52   7e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    52   8e-06
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    51   9e-06
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    52   1e-05
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    52   1e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    51   1e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    50   2e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    51   2e-05
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    50   2e-05
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    50   2e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    51   2e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    50   2e-05
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    49   3e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    49   4e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    50   4e-05
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    49   6e-05
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    49   6e-05
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    48   1e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    49   1e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    47   1e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     48   1e-04
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    47   1e-04
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    48   2e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    47   2e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    47   2e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    47   2e-04
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    47   2e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    47   2e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    47   3e-04
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    47   3e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    47   4e-04
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    46   5e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    46   5e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    45   6e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    46   6e-04
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    45   9e-04
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    45   0.001
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    45   0.001
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     45   0.001
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    45   0.001
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    45   0.001
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    45   0.001
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    44   0.001
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     45   0.001
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    44   0.001
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    45   0.001
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    45   0.002
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    44   0.002
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    44   0.003
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    44   0.003
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    43   0.003
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    44   0.003
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    44   0.004
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    43   0.004
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    43   0.004
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    43   0.004
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    43   0.004
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    43   0.005
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    43   0.005
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    43   0.005
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    43   0.006
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    42   0.007
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.007
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    42   0.007
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    42   0.009
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    42   0.010
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    42   0.011
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    42   0.012
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    42   0.013
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.013
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    41   0.014
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.015
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    41   0.016
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    41   0.016
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    41   0.018
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    41   0.021
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    39   0.022
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    41   0.022
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    40   0.024
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    40   0.024
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.025
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    40   0.026
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    40   0.026
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.027
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    40   0.029
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    40   0.029
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    40   0.030
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.033
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    38   0.034
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.036
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     40   0.037
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    40   0.038
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    40   0.039
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    40   0.039
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    40   0.040
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    40   0.040
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    40   0.043
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    40   0.043
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    40   0.049
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    40   0.050
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    39   0.051
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    40   0.052
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    40   0.054
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    40   0.055
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    39   0.055
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    39   0.059
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.065
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    39   0.067
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    39   0.072
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.074
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    39   0.080
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    39   0.085
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    39   0.085
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    39   0.091
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.097
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    39   0.11 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    39   0.11 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.12 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    38   0.13 
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    38   0.13 
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    38   0.14 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    38   0.15 
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    38   0.15 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    38   0.16 
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    38   0.17 
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    38   0.17 
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    38   0.18 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    38   0.19 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    38   0.19 
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    37   0.21 
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    37   0.24 
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    37   0.24 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    37   0.25 
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    37   0.26 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    37   0.34 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    37   0.35 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    37   0.40 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    37   0.42 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    37   0.45 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     36   0.46 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.54 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.62 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.62 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.72 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    36   0.80 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   0.81 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    35   0.91 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   0.99 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    35   1.5  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    35   1.5  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    35   1.7  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    34   2.0  
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    34   2.2  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    34   2.8  
KLLA0B13277g Chr2 (1165743..1167797) [2055 bp, 684 aa] {ON} high...    34   3.2  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    33   3.5  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   5.4  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    33   6.0  
TBLA0I03210 Chr9 (773539..776265) [2727 bp, 908 aa] {ON} Anc_3.5...    32   8.9  

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1938 bits (5020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 972/1142 (85%), Positives = 972/1142 (85%)

Query: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
            MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV
Sbjct: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60

Query: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
            ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
            LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS
Sbjct: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300

Query: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
            IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360

Query: 361  YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXX 420
            YRFKCDTQKELI                       TTPQRRRNRESLISVTSSRKKPI  
Sbjct: 361  YRFKCDTQKELIKQQQVKKRQSISSVSVSPSKKVSTTPQRRRNRESLISVTSSRKKPISF 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVEKNQK 480
                                             TIVNQSSPTPASRNKRASVINVEKNQK
Sbjct: 421  NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINVEKNQK 480

Query: 481  RASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540
            RASIFSTT              LIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS
Sbjct: 481  RASIFSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541  SNFATLIDEIFEYEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            SNFATLIDEIFEYEKY                                            
Sbjct: 541  SNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKLLEKED 600

Query: 601  XXXXXXXXXXXXXXDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL 660
                          DISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL
Sbjct: 601  LKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL 660

Query: 661  RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS 720
            RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS
Sbjct: 661  RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS 720

Query: 721  FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAP 780
            FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAP
Sbjct: 721  FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAP 780

Query: 781  VSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQ 840
            VSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQ
Sbjct: 781  VSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQ 840

Query: 841  QSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFN 900
            QSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFN
Sbjct: 841  QSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFN 900

Query: 901  GSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTXXXXXXX 960
            GSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHT       
Sbjct: 901  GSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTEKEEENE 960

Query: 961  XXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQD 1020
                                 VVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQD
Sbjct: 961  EKEEKKPEQHKQEEDQEKREKVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQD 1020

Query: 1021 KNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT 1080
            KNTAIGNG            TMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT
Sbjct: 1021 KNTAIGNGSFFRKFSKSSDKTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLT 1080

Query: 1081 LTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
            LTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL
Sbjct: 1081 LTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140

Query: 1141 QK 1142
            QK
Sbjct: 1141 QK 1142

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1753 bits (4539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/1146 (76%), Positives = 929/1146 (81%), Gaps = 14/1146 (1%)

Query: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
            MA+NGNS+PAIKDNTIGPWKLGETLGLGSTGKVQLARN STGQEAAVKVISK VFNTGNV
Sbjct: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNV 60

Query: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN DLYLVLEYAEKGELFN
Sbjct: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFN 120

Query: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPE+EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
            ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
            LLLKVQKGEFE+PSDDEISREAQDLI +ILTVDPERRIKTRDILKHPLLQKYPSI+DSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKS 300

Query: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
            IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDP+GIKEKLRE GANAEKTLYALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALL 360

Query: 361  YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXX 420
            YRFKCDTQKEL+                       TTPQRR+NRES+ISV+SSRKKPI  
Sbjct: 361  YRFKCDTQKELVKQQQIKKRQSISSLSISPSKKLSTTPQRRKNRESMISVSSSRKKPISF 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVEKNQK 480
                                             TIVNQSSPTPASRNKRASVIN+EKNQK
Sbjct: 421  NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPASRNKRASVINIEKNQK 480

Query: 481  RASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540
            RAS+FST               LIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS
Sbjct: 481  RASVFSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541  SNFATLIDEIFEYEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            SNFATLIDEIFEYEKY                                            
Sbjct: 541  SNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKLLEKEE 600

Query: 601  XXXXXXXXXXXXXXDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL 660
                          DISDLEQELS+HKEEK DGNIRSISAPMENEEKNI+HL  DIDNIL
Sbjct: 601  LKMKQEELKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPMENEEKNIDHLGTDIDNIL 660

Query: 661  RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS 720
            RRRNFSLQTRPVSRLDPGI+FS+P E V PVEPKR+ENERLTTEKKILETIRRSKFLGSS
Sbjct: 661  RRRNFSLQTRPVSRLDPGIVFSNPIETVYPVEPKRSENERLTTEKKILETIRRSKFLGSS 720

Query: 721  FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKD--STATT 778
            FNI+KELKLSKMEYPS++AP++LS ERVVSD N  YESLILPKD  GVSQLKD  ++ TT
Sbjct: 721  FNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGKYESLILPKDAKGVSQLKDDITSTTT 780

Query: 779  APVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVN 838
              +SDG+LRKISE+RVPQFTRKSRHFSESNKRLS+LSMYSTKESFTNLVDILKN NLDVN
Sbjct: 781  EHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVDILKNSNLDVN 840

Query: 839  NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 898
            NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDK+ALKLNFADR
Sbjct: 841  NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKTALKLNFADR 900

Query: 899  FNGSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTXXXXX 958
            FN S E K+TDNLHLP LPPL+GD+E+RKQNS+E     PK+KSMIP+S SSSHT     
Sbjct: 901  FNESTEYKETDNLHLPSLPPLSGDDEMRKQNSEEDSLVQPKVKSMIPQSDSSSHTEKVEE 960

Query: 959  XXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHK 1018
                                      D+EPPLNKSVQK+REKN G Q KDH +DHLKEHK
Sbjct: 961  KEGESQEVQEESEKE---------AKDIEPPLNKSVQKLREKNPGPQEKDHQRDHLKEHK 1011

Query: 1019 QDKNTAIGNGX--XXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHP 1076
            QD+NT  GN                +ELYAK+SA+QLFNGLEKLLRGWTQ+GLKNIKSHP
Sbjct: 1012 QDRNTT-GNSSFFRKFSKSSASDKLVELYAKVSARQLFNGLEKLLRGWTQFGLKNIKSHP 1070

Query: 1077 NNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNK 1136
            NNLTLTGKLSS+NIFSLRSTLFE+NIYP+G+MSVVQFKK+SGSFKAVKKLVNEVENVLNK
Sbjct: 1071 NNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVVQFKKISGSFKAVKKLVNEVENVLNK 1130

Query: 1137 EGVLQK 1142
            EGVLQK
Sbjct: 1131 EGVLQK 1136

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1694 bits (4387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 856/1146 (74%), Positives = 913/1146 (79%), Gaps = 15/1146 (1%)

Query: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
            MA+NGNS+PAIKDNTIGPWKLGETLGLGSTGKVQLARN STGQEAAVKVISKAVFN GN+
Sbjct: 1    MAVNGNSVPAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNM 60

Query: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            SGTSIVGS TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61   SGTSIVGSITPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPE+EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
            ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240

Query: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
            LLLKVQKG+FE+PSDDE+SREAQDLI KILTVDP+RRIK RDILKHPLLQKYPSIRDSKS
Sbjct: 241  LLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKS 300

Query: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
            IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDP+GIKEKL+EPGANAEKTLYALL
Sbjct: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALL 360

Query: 361  YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXX 420
            YRFKCDTQKELI                       TTPQRR+NRES+ISVTSSRKKPI  
Sbjct: 361  YRFKCDTQKELIRQQQIKKRQSISSVSTSSPNKISTTPQRRKNRESIISVTSSRKKPISF 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVEKNQK 480
                                             TIVNQ+SPTPASRNKR S+INV+KNQ+
Sbjct: 421  NKFTASSASSSNLTTPGSSKRLSKNFSSKKRLSTIVNQASPTPASRNKRTSIINVDKNQR 480

Query: 481  RASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540
            RAS+FST               LIPSMKRESVTTKLMSTYAKLA DDDWEYIEKETKRTS
Sbjct: 481  RASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLAADDDWEYIEKETKRTS 540

Query: 541  SNFATLIDEIFEYEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            SNFATLIDEIFEYEKY                                            
Sbjct: 541  SNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKVLEKEE 600

Query: 601  XXXXXXXXXXXXXXDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL 660
                          DISDLE ELSKHKEEK DGNIRSISAPME+EEKNINHLEVDIDNIL
Sbjct: 601  LKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPMESEEKNINHLEVDIDNIL 660

Query: 661  RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS 720
            RRRNFSLQTRPVSRLDPGIMFSSP E+ S VEPKRTENERLTTEKKILETIRRSKFLGSS
Sbjct: 661  RRRNFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRSKFLGSS 720

Query: 721  FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAP 780
            FNI+KELKLSKMEYPS++ PQRLSEER+VSD +D Y SL+LPKD  G SQL+D  A T  
Sbjct: 721  FNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDHIAPTTG 780

Query: 781  --VSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVN 838
              +S+G LRKISE+RVPQFTRKSRHFSESNKRLSVLSMYS+KESFTNLVDILKNGN+DV+
Sbjct: 781  DLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKNGNIDVH 840

Query: 839  NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 898
             QQSQRIPTP+SADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR
Sbjct: 841  KQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 900

Query: 899  FNGSNEAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTXXXXX 958
            FN S   K+T+NLHLP LPPLNG +E+ KQ  ++     PK+KSMIP+S SSSHT     
Sbjct: 901  FNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVLGIQPKVKSMIPQSDSSSHTGKEEE 960

Query: 959  XXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHK 1018
                                      D+EPPLNKSVQK R  ++G Q K H     +E K
Sbjct: 961  KEEKGEEGREDQEKDAKG------AKDIEPPLNKSVQKTRANDSGPQVKSHP----REPK 1010

Query: 1019 QDKNTAIGNGX--XXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHP 1076
            +D+N + GNG              ++ELYAK+SAKQLFNGLEKLLRGWTQYGLKNIKSHP
Sbjct: 1011 KDRNIS-GNGSFFRKFSKSSTSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHP 1069

Query: 1077 NNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNK 1136
            NNLTLTGKLSS+NIFSLRSTLFE++IYPRGKMSVVQFKKVSG+FKAVKKLVNEVENVL+K
Sbjct: 1070 NNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKVSGAFKAVKKLVNEVENVLSK 1129

Query: 1137 EGVLQK 1142
            EGVL+K
Sbjct: 1130 EGVLEK 1135

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1664 bits (4309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 852/1149 (74%), Positives = 901/1149 (78%), Gaps = 28/1149 (2%)

Query: 1    MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
            MA+NGNSI AIKDNTIGPWKLGETLGLGSTGKVQLARN STGQEAAVKVISKAVFN+GNV
Sbjct: 1    MAVNGNSIQAIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNV 60

Query: 61   SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            SGTSIVGS TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN
Sbjct: 61   SGTSIVGSNTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120

Query: 121  LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
            LLVERGPLPE+EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL
Sbjct: 121  LLVERGPLPENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180

Query: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
            ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 181  ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRA 240

Query: 241  LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
            LLLKVQKGEFE+PSDDEISREAQDLI KILTVDPERRIK RDILKHPLLQKYPSIRDSKS
Sbjct: 241  LLLKVQKGEFELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKS 300

Query: 301  IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
            IR LPREDTYLTPLSESNSSIDATILQNLVILWHGRDP+GI+ KL+EPGANAEKTLYALL
Sbjct: 301  IRDLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALL 360

Query: 361  YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXX 420
            YRFKCDTQKELI                       TTPQRRRNRES+ISV+SSRKKPI  
Sbjct: 361  YRFKCDTQKELIKQQQIRKRQSIGSVSISPPKRTSTTPQRRRNRESIISVSSSRKKPISF 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVEKNQK 480
                                             TIVNQSSPTP+SRNKR S+ NV+KNQK
Sbjct: 421  NKFTASSASSSNLTTPGSSKRLSKNFSSKKKLSTIVNQSSPTPSSRNKRTSIANVDKNQK 480

Query: 481  RASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540
            RASIFSTT              LIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS
Sbjct: 481  RASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTS 540

Query: 541  SNFATLIDEIFEYEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 600
            SNFATLIDEIFEYEKY                                            
Sbjct: 541  SNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKEE 600

Query: 601  XXXXXXXXXXXXXXDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNIL 660
                          DISDLE EL  H+EEK +GNIRSISAPMENEE NINHLE DIDNIL
Sbjct: 601  LKRKQEELKKQIDIDISDLEHELINHREEKFEGNIRSISAPMENEENNINHLEADIDNIL 660

Query: 661  RRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSS 720
            RRRNFSLQTRPVSRLDPGI+FSSP E   PVEPK+ ENERLTTEKKILETIRRSKFLGSS
Sbjct: 661  RRRNFSLQTRPVSRLDPGIIFSSPIETEDPVEPKKAENERLTTEKKILETIRRSKFLGSS 720

Query: 721  FNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTA--TT 778
            FNIDKELKLS+MEYP + APQRLSEER+VSDSN  YESL+LPKD  GV+ LKD+TA  TT
Sbjct: 721  FNIDKELKLSQMEYPGMAAPQRLSEERIVSDSNGKYESLVLPKDAKGVAHLKDNTAPTTT 780

Query: 779  APVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVN 838
              +S+G LRKIS+IRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLD+N
Sbjct: 781  ELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDIN 840

Query: 839  NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 898
             QQ+QR+PTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDS IKDK+ LKLNFADR
Sbjct: 841  PQQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSCIKDKNTLKLNFADR 900

Query: 899  FNGSNEAKQTDNLHLPILPPLNGDNELRKQN-SQEGDQAH--PKIKSMIPESGSSSHTXX 955
            FNGS   K+T NLHLP LPPLNG +E  KQ   QE +  H  PK+KSMIPES S SH   
Sbjct: 901  FNGSTNEKETKNLHLPTLPPLNGKDEAGKQGEEQEKEDLHEQPKVKSMIPESDSLSHAEK 960

Query: 956  XXXXXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLK 1015
                                         D+EPPLNKSVQK REKN  +QAK+ S D   
Sbjct: 961  EQKEREDQQRGGK----------------DLEPPLNKSVQKTREKNNDTQAKNQSTD--- 1001

Query: 1016 EHKQDKNTAIGNGX--XXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIK 1073
              K +KN + GNG              + ELYAK+SAKQLFNGLEKLLRGW QYGLKN+K
Sbjct: 1002 -PKPNKNVS-GNGSFFRKFSKSSTSEKSTELYAKVSAKQLFNGLEKLLRGWNQYGLKNVK 1059

Query: 1074 SHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENV 1133
            S+PNNLTLTGKLSS+N+FSLRSTLFEV+IY +GK+SVV+FKK+SGSFK VKKLV EVENV
Sbjct: 1060 SNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKISGSFKTVKKLVKEVENV 1119

Query: 1134 LNKEGVLQK 1142
            LNKEGVLQK
Sbjct: 1120 LNKEGVLQK 1128

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/974 (52%), Positives = 625/974 (64%), Gaps = 68/974 (6%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61
           AI+ N++  IK+N IGPWKLGETLG GSTGKV LA N +T Q+AAVKVISKAVF   N S
Sbjct: 3   AISSNTVSVIKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
            ++  G  T +ALPY IE+EIIIMKLLNHPNVLRL+DVWETN+DLYLVLEYAEKGELFN+
Sbjct: 63  ESN--GDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNM 119

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVERGPLPE+EA+R FRQIIIG+SYCH+LG+VHRDLKPENLLLD+K NIKIADFGMAALE
Sbjct: 120 LVERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALE 179

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           +E KLLETSCGSPHYAAPEI+SG+PY+GF+SDVWSCGVILFALLTGRLPFDEEDGNIR L
Sbjct: 180 SEDKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNL 239

Query: 242 LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301
           LLKVQKGEFEMP DDEI++EAQDL+ ++LTVDP +RI  R+ILKHPLLQKYPSI+DS+SI
Sbjct: 240 LLKVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSI 299

Query: 302 RGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLY 361
           R LPREDTYL+PL+++NS ID  ILQNLVILWHG+D   I  KLREPGAN EKTLYALLY
Sbjct: 300 RNLPREDTYLSPLADTNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLY 359

Query: 362 RFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXT-----TPQRRRNRESLISVTSSRKK 416
           RFKCDTQ+E                         +     TPQ++  R S+I+ +S R  
Sbjct: 360 RFKCDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASIIASSSKRPV 419

Query: 417 PIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVE 476
            +                                       + SPT  SR++R+S+I  +
Sbjct: 420 SVTKTATNITVNSSITGTPKSAKRMSMNNSARKRMSALYGTRDSPTKTSRSRRSSIITKD 479

Query: 477 --KNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEK 534
              N+ R S+ S +              L+P++KR+SVTTKLM+TYAKL+EDDDWEYIE+
Sbjct: 480 FLGNRPRDSVISMSHNKRASKSSKRIS-LVPNLKRQSVTTKLMATYAKLSEDDDWEYIER 538

Query: 535 ETKRTSSNFATLIDEIFEYEKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 594
           ETKRTSS+FATLIDEIFE   Y                                      
Sbjct: 539 ETKRTSSDFATLIDEIFE---YEKYEQIRKEKAELERKVRETKEREERERKERQEKELQE 595

Query: 595 XXXXXXXXXXXXXXXXXXXXDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEV 654
                               +IS+L++EL   ++   +   RS+S P+E++ K I  +E 
Sbjct: 596 RLERERIEKQKEDIARQMDEEISNLKKELVGDQDN--EDKFRSVSEPLESKSKKIEDIEE 653

Query: 655 DIDNILRRRNFSLQTRPVSRLDPGIMF-SSPTEEVSPV-EPKRTENERLTTEKKILETIR 712
           DID ILR R +SLQTRPVSRLDPGI F   P +    V E    E E   TE+KILETIR
Sbjct: 654 DIDGILRNRKYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPELEETEQKILETIR 713

Query: 713 RSKFLGSSFNIDKELKLSKMEYPSI------IAPQRLSEERVVSDSNDGYESLILPK--D 764
           RSKFLGSSF+I KEL+  K    +       +AP  L E               LPK  +
Sbjct: 714 RSKFLGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPE--------------TLPKAVE 759

Query: 765 GNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFT 824
              VS             D  LRKIS+I+VPQFTRKSRHFS SN+RLSVLSMYSTKES++
Sbjct: 760 KKNVSM------------DPSLRKISDIKVPQFTRKSRHFSTSNRRLSVLSMYSTKESYS 807

Query: 825 NLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDST 884
           NL DILKNG  +   +  Q  PTP+SADDS+ LF+T++ EA+   + S +ERLY+V + +
Sbjct: 808 NLADILKNGPGE--KEMIQTAPTPKSADDSDQLFDTID-EADTPASVSREERLYEVAEES 864

Query: 885 IKDKSALKLNFADRFN--GSN---EAKQTDNLHLPILPPLNGDNELRKQNSQEGDQAHPK 939
             + +  K++ AD  N  GSN     +Q D++ LP LPPL  D   ++   Q        
Sbjct: 865 ENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFEDGSTKETKEQS------- 917

Query: 940 IKSMIPESGSSSHT 953
            KSMIPE+  SS +
Sbjct: 918 -KSMIPENMQSSES 930

 Score =  110 bits (274), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 73/98 (74%)

Query: 1044 LYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIY 1103
            L   +S+KQLF+GL  LL+GWT+YGLK I     + T+TGKL++DNI S RST F + I+
Sbjct: 1005 LSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIF 1064

Query: 1104 PRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQ 1141
             + K S V F+KVSGS KAV++L +EV+ VL+KEGVL+
Sbjct: 1065 SQEKGSAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVLR 1102

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/557 (68%), Positives = 427/557 (76%), Gaps = 15/557 (2%)

Query: 5   GNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTS 64
            N++P+IK + +GPWKLGETLGLGSTGKVQLA N +TG++AA+KVISK+VFN  +   +S
Sbjct: 4   SNNLPSIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSS 63

Query: 65  IVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           +   TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYAEKGELFNLLVE
Sbjct: 64  L---TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVE 120

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG 184
           +GPL E EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE 
Sbjct: 121 KGPLQEQEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 180

Query: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
           KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFDEEDGNIR LLLK
Sbjct: 181 KLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 240

Query: 245 VQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGL 304
           VQ GEFEMPSDDEIS EAQDL+ KILTVDPE+RI+ RDILKHPLLQKYPSI+DSKSIR L
Sbjct: 241 VQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNL 300

Query: 305 PREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           PREDTYL PLS++NS+ID TILQNLV+LWHGRD   I  KL+EPGANAEKTLYALL RFK
Sbjct: 301 PREDTYLNPLSDNNSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFK 360

Query: 365 CDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXXXXXX 424
            D++KE                         +TPQRR+NR S+ISV+SS KKP       
Sbjct: 361 IDSEKENFKNEQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLS 420

Query: 425 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIV-----NQSSPTPASRNKRASVINVEKNQ 479
                                         I      N SSPTPA RNKR S+IN +   
Sbjct: 421 SVVHNNLSASSSTTTTPASKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTD--- 477

Query: 480 KRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRT 539
            R SI S                ++ +MKR S+TTKL++TYAKL+EDDDWEYIEKETKRT
Sbjct: 478 -RQSILSKN---KRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRT 533

Query: 540 SSNFATLIDEIFEYEKY 556
           SS+FATLIDEIFE+EKY
Sbjct: 534 SSDFATLIDEIFEHEKY 550

 Score =  281 bits (720), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 176/355 (49%), Positives = 224/355 (63%), Gaps = 66/355 (18%)

Query: 628 EEKLDGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFS--SPT 685
           +EK + N RS+S P+  E  N        DN+LR+RNFSLQTRP+SRLDPG+ FS  SPT
Sbjct: 622 QEKNEDNYRSVSVPLSKETVN--------DNLLRQRNFSLQTRPISRLDPGLFFSEQSPT 673

Query: 686 EE--VSPVEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSK---MEYPSIIAP 740
           EE  +SP EP    N++L TEK ILETIRRSKFLGSSF+I++ELK ++   M+ P++   
Sbjct: 674 EEKPISPDEP--VPNKKLDTEKMILETIRRSKFLGSSFDINRELKAAEKRVMQPPTV--- 728

Query: 741 QRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRK 800
           Q+L+ E   SD         LPK   G + L  STA  +        KIS+IRVPQFTRK
Sbjct: 729 QKLTTENKSSDE--------LPKHAVGTAALNSSTAEVS--------KISDIRVPQFTRK 772

Query: 801 SRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFET 860
           SRHF+ SN+RLSVLSMYST++SF+NLVDILKN   +   +  QR PTP SA DSEF+FET
Sbjct: 773 SRHFTTSNRRLSVLSMYSTRQSFSNLVDILKNT--EAGTELGQRTPTPHSAGDSEFIFET 830

Query: 861 VNEEAEYTGNSSNDERLYDVGDSTIKDK-SALKLNFADRFN----GSNEAKQTDNLHLPI 915
           VNEEAEYTGNSSND++LY+V D    +K S +KLNFADRFN     S E  +     LP+
Sbjct: 831 VNEEAEYTGNSSNDDKLYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQNKLPV 890

Query: 916 LPPLNGD-----------------------NELRKQNSQEGDQAHPKIKSMIPES 947
           LPPL+G                        ++  +  S + ++   +IKSMIPE+
Sbjct: 891 LPPLDGKAGLGIYQTSSPIEPQLLERPVKGDKFMETISSDNEKPEKEIKSMIPEA 945

 Score =  110 bits (276), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 73/97 (75%)

Query: 1044 LYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIY 1103
            L   I+A+Q+F+GL +LL GW++YGLKN++S  + +T++GKLSSDNI SLRST FE+ + 
Sbjct: 1019 LVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVT 1078

Query: 1104 PRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
              G+ S V  +K SGS KAV +L  E+EN+ +KEGVL
Sbjct: 1079 SNGESSSVLIRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/574 (64%), Positives = 422/574 (73%), Gaps = 19/574 (3%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61
           A++  S+P +K N IGPWKLGETLGLGSTGKVQLA + ST Q+AA+KVISKA+FN     
Sbjct: 3   AMSNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSV 62

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
             S V ++TPD+LPYGIEREIIIMKLLNHPNVLRLYDVWETN++LY+VLEYA+KGELFNL
Sbjct: 63  KDSSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNL 122

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVERGPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE
Sbjct: 123 LVERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALE 182

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           TE KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVILFALLTGRLPFD+EDGNIR L
Sbjct: 183 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNL 242

Query: 242 LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301
           LL+VQ G +EMP DDEIS +AQDLI +ILTVDPE+RIK RDILKHPLLQKYPSI DSKSI
Sbjct: 243 LLQVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSI 302

Query: 302 RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
           R LPREDTYL PLSE  S+ ID  ILQNLV+LWHGR+   I  KLREPGANAEKTLYALL
Sbjct: 303 RNLPREDTYLHPLSEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362

Query: 361 YRFKCDTQKELIXX-XXXXXXXXXXXXXXXXXXXXXTTPQ-----RRRNRESLISVTSSR 414
            RFK DT+ + +                        + PQ     +RRNR S+ISV+SS 
Sbjct: 363 DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422

Query: 415 KKPIXXXXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXTIVNQSSPTPASRNKRAS 471
           K+P+                                         N  SPTPASR+KR S
Sbjct: 423 KRPVSFNKLSNVVSPGSVPSSNSNTPSKRVSVNLSSNKRLSAVYTNSGSPTPASRHKRVS 482

Query: 472 VINVEKNQKRASI---------FSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAK 522
           ++++E+ ++  +          +S+T                PS KR S+TTKL+STYAK
Sbjct: 483 IVDLERERENDTPPVPIEMLKDYSSTAKQKRLSRNNMRLSFKPSNKRGSITTKLISTYAK 542

Query: 523 LAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           L+EDDDWEYIEKETKRTSS+FATL D+IFE+EK+
Sbjct: 543 LSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKF 576

 Score =  353 bits (907), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 229/521 (43%), Positives = 306/521 (58%), Gaps = 42/521 (8%)

Query: 634  NIRSISAPMENEEKN-INHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSPVE 692
            N RS+S P++ +  + +  L+ +ID++LR+R FSLQTRPVSRLDPG+ FSS + E     
Sbjct: 660  NGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV-FSSDSSEKDQYT 718

Query: 693  PKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDS 752
                +  +L  +K ILETIRRSKFLGSSF+I+KELK +           + + +R++S +
Sbjct: 719  GSE-DRAKLNNDKIILETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTT 777

Query: 753  NDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLS 812
            ND YE+ ILPK+    + LKD      P      RKIS+I+VPQFTRKSR F +SNKRLS
Sbjct: 778  NDEYETQILPKNATASAPLKDHNHQAEP------RKISDIKVPQFTRKSRQFGDSNKRLS 831

Query: 813  VLSMYSTKESFTNLVDILKNGNLDVNNQQSQR-IPTPRSADDSEFLFETVNEEAEYTGNS 871
            VLSMYS+K+S+TNL D+L   N + +N +  R  P  +S  + EFLFE V E+ E TG+S
Sbjct: 832  VLSMYSSKQSYTNLADLL---NEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDS 888

Query: 872  SNDERLYDVGDSTIKDKSALKLNFADRF---NGSNEAKQTDNLHLPILPPLNGDNELRK- 927
            S+D RLY+V + +   K  LKLNFADRF   NG +   +  N+ LP LPPL+G  E +  
Sbjct: 889  SHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPLDG-KEAKGL 947

Query: 928  ---QNSQEG--DQAHPKIKSMIP-ESGSSSHTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 981
               Q+S E   + A   +KSMI  +    S T                            
Sbjct: 948  GIYQSSSESLPEPAQHNVKSMIQNDENQPSET----------------AEVLSIKEDNAQ 991

Query: 982  VVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGXXXXXXXXXXXXT 1041
            V    E PLN S+ K R   A    +  SK+     K+   +                  
Sbjct: 992  VERQQEAPLNASIPKHRTDGAQKSERMPSKEG--SEKKRNTSFFRKFSKSSNEKTNGEFD 1049

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
             ELYA ++AKQLFNGL+ LL+GW +YGLK +KS P+ LTLTGKLSS+NI SLRSTLFE+ 
Sbjct: 1050 AELYASVAAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMV 1109

Query: 1102 IYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            ++ RGK S+V F+K SGS K +K+LV+E+E VL KE VL K
Sbjct: 1110 VWSRGKGSIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  734 bits (1895), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/566 (64%), Positives = 415/566 (73%), Gaps = 17/566 (3%)

Query: 3   INGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSG 62
           I   + P IK + IG WK+GETLGLGSTGKVQLA N +TG +AA+KVISK +F   NV  
Sbjct: 2   ITNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNV-- 59

Query: 63  TSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
           TS+V +TTPDALPYGIEREI+IMKLLNH NVLRLYDVWETN++LY+VLEYAEKGELFNLL
Sbjct: 60  TSMVDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLL 119

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           VERGPLPE+EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLD KYNIKIADFGMAALET
Sbjct: 120 VERGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALET 179

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
           E KLLETSCGSPHYAAPEIVSGIPY GFASDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 180 EDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIR 302
           LKVQ G+FEMP DDEIS+EAQ+LI KIL V+P  RI  RDILKHPLLQKYPSI+DSKSIR
Sbjct: 240 LKVQAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIR 299

Query: 303 GLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYR 362
            LPREDTYL PL+E+NS+ID  ILQNLV+LWHGRDP  I+ KL+E GANAEKTLYA+L R
Sbjct: 300 NLPREDTYLHPLAETNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359

Query: 363 FKCDTQKELI------------XXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISV 410
           FK D ++E +                                   TTP R++NR S+ISV
Sbjct: 360 FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP-RKKNRASVISV 418

Query: 411 TSSRKKPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRA 470
           TSS K+PI                                         SPTPASR KR 
Sbjct: 419 TSSHKRPISFQKLPTLNSTSSLAAITPSTSARRKRLSKISGYPVSNVNGSPTPASRKKRN 478

Query: 471 SVINVEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWE 530
           S+ N++    R+S    T              ++P+ K  ++ +KL+STYAKL+EDD+WE
Sbjct: 479 SMANIQ--AARSSTIKKTNTFKKNNRASKRVSILPNNKNGTIASKLISTYAKLSEDDEWE 536

Query: 531 YIEKETKRTSSNFATLIDEIFEYEKY 556
           Y+E+ETKRTSSNFATLIDEIFE+EKY
Sbjct: 537 YLEQETKRTSSNFATLIDEIFEHEKY 562

 Score =  293 bits (750), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 214/545 (39%), Positives = 294/545 (53%), Gaps = 60/545 (11%)

Query: 615  DISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSR 674
            +I +L++EL     E      RS+S P+  ++  +   E+++  +LR+RN +LQTRP SR
Sbjct: 618  EIENLKKELDMMSHEG-KTESRSVSEPLNKKQGGV---EIEVKELLRQRNAALQTRPKSR 673

Query: 675  LDPGIMFSSPTEEVSPVEPKRTENE---RLTTEKKILETIRRSKFLGSSFNIDKELKLSK 731
            LDPG+ F S   +      +  E E   +L TEK ILETIRRSKFLGSSF+I KELK + 
Sbjct: 674  LDPGLFFDSAESDTRNPSLQVFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSAS 733

Query: 732  MEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISE 791
                   AP R     V++  ++   S +LPK+    + L+  +          +RKIS+
Sbjct: 734  ARSDYSRAPGR-----VITAPSNLERSDVLPKNAIATAPLRIHS------DQPEVRKISD 782

Query: 792  IRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDIL--KNGNLDVNNQQSQRIPTPR 849
            I+VPQFTRKSR+FSES+KRLSVLSMYST++SF NL D++  ++ N D    + Q I TP 
Sbjct: 783  IKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQ-IATPN 841

Query: 850  SADDSEFLFETVNEEAEYTGNSSNDERLY-DVGDSTIKDKSALKLNFADRFNGSNEAKQT 908
            SA  SEFLFE+VNEEAE T N+S D +LY          K  L++N +DR+N +N     
Sbjct: 842  SAGQSEFLFESVNEEAENTNNTSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSEADM 901

Query: 909  DNLHLPILPPLNGDNELRK----QNSQEGDQAHP---KIKSMIPESGSSSHTXXXXXXXX 961
            +N  LPILPPL  D E+      Q+  E   A P   K KS   E+G  S          
Sbjct: 902  EN-KLPILPPL--DPEIAGLGIYQDQPEEVNAKPQEKKSKSKSAETGDISE--------- 949

Query: 962  XXXXXXXXXXXXXXXXXXXXVVDDMEPP------LNKSVQKIREKNAGSQAKDHSKDHLK 1015
                                +    +PP      L+   Q+  E+   S+    S + L+
Sbjct: 950  --------GEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENTFSNNFLR 1001

Query: 1016 EHKQDKNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSH 1075
            +     NT   +                ++  +SA Q++ GL  LLRGW  YGLK+IK +
Sbjct: 1002 KLSGQSNTTTQSVKKTKLGAEDG-----IHTTVSATQMYQGLYNLLRGWGSYGLKSIKGN 1056

Query: 1076 PNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLN 1135
              N+T+TGKL+S+NI SLRST+FE+ I   GK S V  KK SGS KAV +L  EV+NVL 
Sbjct: 1057 SENMTITGKLASENILSLRSTIFEIIIIREGKGSKVDIKKKSGSTKAVNRLAGEVKNVLV 1116

Query: 1136 KEGVL 1140
            KEGV+
Sbjct: 1117 KEGVM 1121

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/571 (64%), Positives = 425/571 (74%), Gaps = 26/571 (4%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGST 69
           ++K +TIGPWKLGETLGLGSTGKVQLA N ST Q+AA+KVISK+VF++  +   S + S+
Sbjct: 10  SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSS--MGNNSSMVSS 67

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
           TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 68  TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127

Query: 130 EHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189
           E+EAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 128 ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187

Query: 190 SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE 249
           SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKGE
Sbjct: 188 SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247

Query: 250 FEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDT 309
           FEMP DDEIS+EAQDL+ KIL VDPE+RIK+R+ILKHPLLQKYPSI+DSK+IR LPREDT
Sbjct: 248 FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307

Query: 310 YLTPL---SESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCD 366
           YL PL      +++ID TILQNLV+LWHGR+ + I +KLREPGANAEKTLYALLYRFK D
Sbjct: 308 YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367

Query: 367 TQKE-LIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXXXXXXX 425
           +++E L                        TTPQ+++NR S+ISV+SS K+P+       
Sbjct: 368 SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427

Query: 426 XXXXXXXXXXXXXXXXXXXXXXXXXXXXT------IVNQS---SPTPASRNKRASVINVE 476
                                       +      I+ QS   SPTPA RNKR SV N+E
Sbjct: 428 IQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLE 487

Query: 477 KNQKRASI-----------FSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAE 525
            +     I            S+               ++P+ KR S+TTK++STYAKL+E
Sbjct: 488 TSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSE 547

Query: 526 DDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           DDDWE+IEKETKR SS+FATLIDEIFE+EKY
Sbjct: 548 DDDWEFIEKETKRVSSDFATLIDEIFEHEKY 578

 Score =  270 bits (691), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 200/545 (36%), Positives = 296/545 (54%), Gaps = 75/545 (13%)

Query: 618  DLEQELSKHKE-EKLDGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLD 676
            +L+Q+    +E E +  N+RSIS+P+EN   N    E D      +R+FSLQTRPVS+LD
Sbjct: 634  ELQQDTKNFQEDEVVHKNVRSISSPVEN--GNEAKSEEDASG---QRSFSLQTRPVSKLD 688

Query: 677  PGIMFSS----PTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSK- 731
            PGI   S      EE+   E  +T    + ++K ILETIRRSKFLGSSFNIDKELK  K 
Sbjct: 689  PGIKCGSNKPVQMEEIVEDELDKT----IDSQKVILETIRRSKFLGSSFNIDKELKQVKK 744

Query: 732  -MEYPSIIAPQRLSEE---RVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLR 787
              E   +   Q+   +   R+VS++N+ YE+ +LPK+      LKD +    P      R
Sbjct: 745  DAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEP------R 798

Query: 788  KISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVN-NQQSQRIP 846
            KIS+I+VPQFTRKS+ F++SNKRLSVLS+YS+ +S+TNL ++LK G +D+  N+ S  + 
Sbjct: 799  KISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIGVNEGSNNVE 858

Query: 847  TPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNEAK 906
                +++ EF FETV  E E        E      ++ +   + +KLN+ADRF   + A 
Sbjct: 859  V---SEEPEFQFETVGTEIENNKYEEEKEIEN---ENNLSQGANIKLNYADRF---DTAG 909

Query: 907  QTDNLHLPILPPLNGDNEL-------RKQNSQEGDQAHPKIKSMIP--ESGSSSHTXXXX 957
              + + LP LPPL GD+++         ++  EG+++ P     +P  +   S  T    
Sbjct: 910  NVNEVKLPTLPPL-GDDKVSDGLGIYSSKSGSEGNESKP-----VPSIKENKSEETLKEK 963

Query: 958  XXXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEH 1017
                                       + +PPLN  V K R+    +  ++++  H  + 
Sbjct: 964  NV-------------------------EPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDK 998

Query: 1018 KQDKNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPN 1077
             +  +                   ++L++ +S  QL+NGL  LL+GW  YGLK IKS+  
Sbjct: 999  PRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKE 1058

Query: 1078 NLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKE 1137
              +++ +LSSDNI SLRST  ++ ++  GK SV+ F+K SGS K +K+L +EVE VL KE
Sbjct: 1059 AFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKE 1118

Query: 1138 GVLQK 1142
            GVL K
Sbjct: 1119 GVLAK 1123

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/582 (62%), Positives = 420/582 (72%), Gaps = 32/582 (5%)

Query: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
           +A N  +IP IK +TIGPWKLGETLGLGSTGKVQLA N +T Q+AA+K+ISK++FNT   
Sbjct: 4   LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63

Query: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
           S  + + + TPD+LPYGIEREIIIMKLL H NVL LYDVWETN++LY++LEYAEKGELFN
Sbjct: 64  SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVE+GPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 124 LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           ETE KLLETSCGSPHYAAPEIVSGIPY GF SDVWSCGVILFALLTGRLPFDEEDGNIR 
Sbjct: 184 ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243

Query: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
           LLLKVQ G+FEMP DDE+SR+AQDLI +ILTVDP +RIKTR+ILKHPLLQKYPSI+DSKS
Sbjct: 244 LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
           I+ LPREDTYL PLS++NS ID +ILQNLV+LWHGRD E I  KL+E GANAEKT+YALL
Sbjct: 304 IKNLPREDTYLFPLSDNNSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALL 363

Query: 361 YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXX 420
           YRFK + +                           +TP R++NR S +SV+SSRK+P+  
Sbjct: 364 YRFKIEAEN----LSAKQEQVKRKQSIIKKSTANVSTPPRKKNRISTMSVSSSRKRPVSF 419

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQS-------------------SP 461
                                              +N S                   SP
Sbjct: 420 NRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGNSNSP 479

Query: 462 TPASRNKRASVINVEKNQKRASI-------FSTTXXXXXXXXXXXXXXLIPSMKRESVTT 514
           TP SR+KR S+IN++ N     I       +                  + + KR S+TT
Sbjct: 480 TP-SRSKRISLINLD-NSTAPPIPVNVLKDYKNKSSSSKNKRASKRLTFLGNGKRGSITT 537

Query: 515 KLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           KL+STYAKL+EDD+WEYIEKETKRTSS+FATLIDEIFE+EKY
Sbjct: 538 KLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKY 579

 Score =  291 bits (744), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 213/537 (39%), Positives = 298/537 (55%), Gaps = 67/537 (12%)

Query: 615  DISDLEQELSKH-KEEKLDGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVS 673
            +IS+L+ +L+   K  +   N RS+SAP+E E  N   +E DI+++  RRN SLQTRP S
Sbjct: 635  EISNLKADLANETKGAEPYENPRSVSAPLERE--NPEAIERDINDLFARRNVSLQTRPKS 692

Query: 674  RLDPGIMFSSPTEEVSPVEPKRTE-NERLTTEKKILETIRRSKFLGSSFNIDKELKLSKM 732
            RLDPGI++S+P E VS   P  ++ ++ +  EKKILETIRRS+FLGSS+NI+KEL+ +K 
Sbjct: 693  RLDPGILYSAPAETVS--NPLLSDIDQEIDREKKILETIRRSRFLGSSYNINKELEFAKK 750

Query: 733  EYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEI 792
               + +A     E+R    S    ++++  K   GV  L D+ A         LRKISEI
Sbjct: 751  ---TALAETSKKEKR----SKVTSQNIVADKAAIGVIPLNDTEAG--------LRKISEI 795

Query: 793  RVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSAD 852
            +VPQFTRKSRHFS SN+RLSVLSMYSTK+S+TNL DILK G +++ ++ +    T +++ 
Sbjct: 796  KVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILKEGGVNLASE-ANNTTTSKAST 854

Query: 853  DSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDNLH 912
            + EF FE+VNE    T N     +LY++ +    +     +N  D        K   N+ 
Sbjct: 855  EPEFQFESVNEG---TAN-----KLYELQE----EPEYTDVNKED-------GKPKKNVK 895

Query: 913  LPILPPL----NGDNELRKQNSQEGD-----QAHPKIKSMIPESGSSSHTXXXXXXXXXX 963
            LP LPPL    N  N L    S   D     +  PK +SMIPE   S +           
Sbjct: 896  LPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVV 955

Query: 964  XXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHLKEHKQDKNT 1023
                                ++   PLN+    + +K   S  +  SK          +T
Sbjct: 956  EPESQATKKINKPKQRQPKKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAV------ST 1009

Query: 1024 AIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTG 1083
               NG              E+Y  +SA QL+ GL +LL+GW++YGLK++KS  N + LTG
Sbjct: 1010 LTKNGFD-----------YEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNYMKLTG 1058

Query: 1084 KLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
            KLS+DNI SLRST+FE+ +  +GK SVV F K+SGS K V++L  E+E VL +EGVL
Sbjct: 1059 KLSNDNILSLRSTVFEMIVESKGKQSVVGFNKISGSSKTVRRLFVEIEKVLRQEGVL 1115

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  711 bits (1834), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/562 (63%), Positives = 416/562 (74%), Gaps = 42/562 (7%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTT 70
           +K +TIGPWKLG+TLGLGSTGKV+LA N +T Q+AA+K+ISK++F+ G V  +S+V +++
Sbjct: 10  MKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVGESSMVSNSS 69

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
           PDALPYGIEREIIIMKLL HPNVL LYDVWETN+ LY++LEYAEKGELFNLLVERGPLPE
Sbjct: 70  PDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPE 129

Query: 131 HEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190
            EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK NIKIADFGMAALET+ K+LETS
Sbjct: 130 KEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETS 189

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF 250
           CGSPHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQ GE+
Sbjct: 190 CGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEY 249

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTY 310
           EMP DDEIS+EAQDLI +ILTVDPE+RIKTRDILKHPLLQKYPSI+DS+SI+ LPREDTY
Sbjct: 250 EMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTY 309

Query: 311 LTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKE 370
           L PLSE+NS ID +ILQNLV LWHGRD + I  KLRE GA+AEKT+YALLYRFK + +K 
Sbjct: 310 LYPLSENNSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAEK- 368

Query: 371 LIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIXXXXXXXXXXXX 430
                                     +  RR+NR S+ISV+SS K+P+            
Sbjct: 369 ----------------------MNTCSSPRRKNRISMISVSSSHKRPVSMKKISTVQNNT 406

Query: 431 XXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVINVEKNQKRA-------- 482
                                     N SSPTP SR KR SVIN++ ++ +A        
Sbjct: 407 PPSNRRLSISLSSTQRKRMSGILQHTN-SSPTP-SRTKRISVINIDDSENKAPPPVPMEM 464

Query: 483 --------SIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEK 534
                        T              L+ + KR S+TTKL+STYAKL+EDD+WEYIE+
Sbjct: 465 LEDYKNNSKNVRRTIKKKKKKKNNYRLTLV-NNKRVSITTKLLSTYAKLSEDDNWEYIER 523

Query: 535 ETKRTSSNFATLIDEIFEYEKY 556
           ETKRTSS+FATLIDE+FE+EKY
Sbjct: 524 ETKRTSSDFATLIDELFEHEKY 545

 Score =  160 bits (404), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 114/268 (42%), Positives = 159/268 (59%), Gaps = 65/268 (24%)

Query: 619 LEQELSKHKEEKLD-GNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDP 677
           +++E+SK KE+ L+  N RS+SAP+    K     + + + +  RR FSLQTRPVSRLDP
Sbjct: 588 IDEEISKLKEDALEKDNFRSVSAPI----KENEDEDENENELRNRRQFSLQTRPVSRLDP 643

Query: 678 GIMFSSPTEEVSPVEPKRTENER-----LTTEKKILETIRRSKFLGSSFNIDKELKLSKM 732
           GI++S+P E   P   +   NE         ++KILETIRRSKFLGSSFNI +EL+ S+ 
Sbjct: 644 GILYSAPAE--IPSYERVVVNESGNKSSAQQQRKILETIRRSKFLGSSFNIQQELEFSQR 701

Query: 733 EYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEI 792
              +++ P   ++E+VV                  V ++K          +G LRKISE+
Sbjct: 702 ---NVLVP---TKEQVVD-----------------VDEVK---------LEGGLRKISEV 729

Query: 793 RVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSAD 852
           ++PQFTRKSRHFS+SNKRLSVLSMYSTK+S+TNL  ILK+G  +  ++ +++ P      
Sbjct: 730 KIPQFTRKSRHFSDSNKRLSVLSMYSTKQSYTNLGHILKDGTEE--SEPAKKTP------ 781

Query: 853 DSEFLFETVNEEAEYTGNSSNDERLYDV 880
             E LFE           S  D+RLY+V
Sbjct: 782 --ELLFE-----------SGRDDRLYEV 796

 Score =  118 bits (295), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 1043 ELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNI 1102
            E+Y  I ++QL+ GL KLL GWTQYGLK+++S    + +TGKL++DNI SLRSTLFE+ +
Sbjct: 924  EIYVNIGSRQLYTGLRKLLEGWTQYGLKDVRSDNTAMKITGKLANDNILSLRSTLFELLV 983

Query: 1103 YPRG-KMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
             P+G K S++ F KV GS K V++L  E+E VLNKEGVL
Sbjct: 984  EPKGSKYSLIGFTKVQGSSKVVRRLFTEIEKVLNKEGVL 1022

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/570 (62%), Positives = 404/570 (70%), Gaps = 17/570 (2%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61
            +N  S P ++ + +GPWKLGETLG GSTGKVQLA N  T Q AAVK ISKA+F+     
Sbjct: 3   GMNKRSAPTVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAP 62

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
           G S + ++TPD LPYGIEREIIIMKLLNHPNVLRLYDVWETN  LY+VLEYAEKGELFNL
Sbjct: 63  GNSSIAASTPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNL 122

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           LVE GPLPE+EA+ FFRQIIIGVSYCHALGIVHRDLKPENLLLDH  NIKIADFGMAALE
Sbjct: 123 LVENGPLPENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALE 182

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
           TE KLLETSCGSPHYAAPEIVSGIPY GFASD+WSCGVI FALLTGRLPFDEEDGNIR L
Sbjct: 183 TEDKLLETSCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNL 242

Query: 242 LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301
           LLKVQ G+FEMP DDEIS EAQDL+ KILTVDPE RIK R+ILKHPLLQKYP++ D+KSI
Sbjct: 243 LLKVQSGKFEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSI 302

Query: 302 RGLPREDTYLTPLSESNSS-IDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
           R LPREDTYL PLS+S SS +D  ILQNLV+LWHGR    I  KL++PGANAEKTLYALL
Sbjct: 303 RNLPREDTYLHPLSDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALL 362

Query: 361 YRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIX- 419
            RFK DT++E                         +   ++RNR S I+ +SS K+P+  
Sbjct: 363 ARFKNDTEREAARQKQIKKRSSLNGTGAGVNNNHVSP--KKRNRASTINASSSHKRPVSL 420

Query: 420 ------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRASVI 473
                                                   T  N  SPTPASR+KR S+I
Sbjct: 421 IKLSGSSNSNSNSNPSSTSTTPPKRMSVNLSSNKRLSTVKTQGNGGSPTPASRSKRVSII 480

Query: 474 NVEKNQKRASI-------FSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAED 526
             +KN     +       ++ T                P+ KR SVTTKL+STYAKL+E+
Sbjct: 481 ESDKNGGAPPVPIDMLKDYNKTPNSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLSEE 540

Query: 527 DDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           DDWEYIEKETKRTSS+FATLIDEIFE+EK+
Sbjct: 541 DDWEYIEKETKRTSSDFATLIDEIFEHEKF 570

 Score =  310 bits (794), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 226/583 (38%), Positives = 314/583 (53%), Gaps = 74/583 (12%)

Query: 615  DISDLEQELSKHKEEKLDGNIRSISAPMENEEKN-INHLEVDIDNILRRRNFSLQTRPVS 673
            D +D E ++  H   +    +RS+SAP+E ++++ + +++ DI+ I  +R  SLQTRPVS
Sbjct: 626  DGTDTESDV--HSNNQAPNGVRSVSAPLERKKRDSMVNVQSDIEEIFGQRTMSLQTRPVS 683

Query: 674  RLDPGIMFSSPTEEVSPVEPKRTENER-LTTEKKILETIRRSKFLGSSFNIDKELKLSKM 732
            RLDPG+ ++   EE +  E   TE E+ L T+K ILETIRRSKFLGSSF+I KEL+  ++
Sbjct: 684  RLDPGLFYA---EESNEPEAGDTEEEKKLRTQKNILETIRRSKFLGSSFDIGKELQNEEL 740

Query: 733  EYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEI 792
            +  +   P R   +R VS +N+ Y++ +LP               TAP+ D   RKISEI
Sbjct: 741  KKKAS-QPHR---DRTVSQTNEPYDTRVLPTQA----------VATAPLRDQEPRKISEI 786

Query: 793  RVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNL-DVNNQQSQRIPTPRSA 851
             VPQFTRKSR FS+SNKRLSVLSMYSTK S+ NL ++L + +  D     +      +  
Sbjct: 787  SVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNLLNDSDASDGRLNSAAEYSDVKGK 846

Query: 852  DDSEFLFETVNEEAEYTGN----SSNDERLYDVGDST---------IKDKSALKLNFADR 898
             + EF FE V E ++        S+NDERL +V  ++         +  K  +KLNFADR
Sbjct: 847  KEPEFQFEAVREASDEDNGISRLSNNDERLRNVSGTSGGSGVPHDNLSSKHNMKLNFADR 906

Query: 899  FNG-------SNEAKQTDNLHLPILPPLNGDNELRK----QNSQEG--DQAHPKIKSMI- 944
            F+        SN +  + N+ LP LPPL+G +E       Q+S E   D   P  KS + 
Sbjct: 907  FSADEPTAGSSNSSSASKNVKLPTLPPLDGTSEANGLGIYQSSSESFRDIVEPTPKSKLQ 966

Query: 945  -----PES----------GSSSHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDDME-- 987
                 PE           GS  H+                                    
Sbjct: 967  DNSSNPEQEVEEEVAGREGSVKHSAIDTASKERSKRTDRIDAKKPSSFQENLASAGASKG 1026

Query: 988  PPLNKSVQKIRE---KNAGSQAKDHS-----KDHLKEHKQDKNTAIGNGXXXXXXXXXXX 1039
            PPLN S+ K R    +N  + AK  +     KD      + +N +               
Sbjct: 1027 PPLNDSMPKRRNEDPRNGSTAAKGENGRAPLKDITTNSDKKRNVSFFRKFSKSNEKDTTG 1086

Query: 1040 XTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFE 1099
               E+   +SAKQLF GL+ LL GWTQYGLK+++SHP  +TLTGKL+S+NI SLRSTLFE
Sbjct: 1087 FDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTGKLTSENILSLRSTLFE 1146

Query: 1100 VNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            + ++ RGK+SVV F+K SGS KA+++LV+EVE VL KEGV+ K
Sbjct: 1147 MVVWSRGKVSVVGFRKKSGSSKAMRRLVSEVEKVLLKEGVISK 1189

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/575 (60%), Positives = 413/575 (71%), Gaps = 39/575 (6%)

Query: 3   INGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSG 62
           +NGN I  +K +TIGPWKLG TLG+GSTGKV +A N + GQ+AAVK+ISK++FN     G
Sbjct: 1   MNGNGITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFN---AQG 57

Query: 63  TSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
           ++++G   PD LPYGIEREIIIMKLLNHPNVLRLYDVWET+ DLY+VLEY EKGELFNLL
Sbjct: 58  STMIGGNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLL 117

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           VERGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+N+K+ADFGMAALE+
Sbjct: 118 VERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALES 177

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
           + KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR LL
Sbjct: 178 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 237

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIR 302
           LKVQ G+FEMP DDEIS EAQDLI +ILTVDPE+RIKTR+ILKHPLL+KYPSI+DSKSIR
Sbjct: 238 LKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIR 297

Query: 303 GLPREDTYLTPLS--ESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
            LPREDTYL PLS    N  +D TILQNLV+LWHGR+ E I  KL EPGAN EKT YALL
Sbjct: 298 NLPREDTYLNPLSLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALL 357

Query: 361 YRFKCDTQKELIXXXXXXXXXXXXXXXXX---------XXXXXXTTPQRRRNRESLISVT 411
           +RFK D  ++ +                                TTP+++R   S+I  +
Sbjct: 358 HRFKHDNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTPKKKRT--SIIVAS 415

Query: 412 SSRKKPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSPTPASRNKRAS 471
           SS K+P+                                    + N SSPTPA+ +KR S
Sbjct: 416 SSHKRPV-SMQKLSSQHSSPVKNGSIGKRLSKTFPSNKRISQLVSNSSSPTPAA-HKRVS 473

Query: 472 VIN----------VEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYA 521
            IN          + ++ KR S                   L+P+MKR S+TTKL++TYA
Sbjct: 474 RINDSAAPPVPKEMLRDYKRQS-----------KRQSKRFSLLPNMKRGSITTKLIATYA 522

Query: 522 KLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           KL+ED +WEYIEKETKRTS +FATL+D+IFE+EKY
Sbjct: 523 KLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKY 557

 Score =  180 bits (457), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 126/332 (37%), Positives = 186/332 (56%), Gaps = 44/332 (13%)

Query: 628 EEKLDGNIRSISAPME-----NEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFS 682
           +E+   N RS+SAP+E     N+  +   ++ DI+ ++  RNFSLQTRPVSRLDPGI+ +
Sbjct: 633 DERNTANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGIIAA 692

Query: 683 SPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQR 742
                 +       E+++ + EK ILETIRRSKFLGS FN++ EL+ ++ +   +++ +R
Sbjct: 693 ESRLSAN------LEDDQASKEKTILETIRRSKFLGSQFNLNVELEKAQKD---LVSKER 743

Query: 743 LSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSR 802
             + R  S+    YE   LPK+   V+ L+D             RK+SE++VPQFTR+S+
Sbjct: 744 QEQLRKYSEQTAKYEVQKLPKNAKAVATLRDDEVEP--------RKLSEVKVPQFTRRSK 795

Query: 803 HFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVN 862
           HFS SNKR SVLS+YSTK SFTNLVD LKN N            + + A + EF+FETV 
Sbjct: 796 HFSSSNKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVE 855

Query: 863 EEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDN---LHLPILPPL 919
           E  E       + +L++V ++        KL  A R   ++  KQ+ N   ++LP LPPL
Sbjct: 856 ELDE-------NSKLFEVPET-----EEGKLASAARKESTDARKQSTNDKDINLPSLPPL 903

Query: 920 NGDNELRKQNS-------QEGDQAHPKIKSMI 944
              +++  +N        Q  DQ     K+M+
Sbjct: 904 QVSHDVADENGALGLGIYQPNDQTQKPHKTML 935

 Score =  101 bits (251), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 1043 ELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNI 1102
            +L A +SA +++  L++LL  WT YGLK+++S PN+  ++GKL+SDNI SLRST F++ +
Sbjct: 1010 QLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITV 1069

Query: 1103 YP-RGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
             P  G  S++QF K SGS K   +LV E+E +L KE VL
Sbjct: 1070 LPGEGNGSIIQFTKKSGSTKTFNRLVKEIEKILEKEKVL 1108

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/585 (59%), Positives = 405/585 (69%), Gaps = 40/585 (6%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFN------------- 56
            +  N IGPWKLGETLG GSTGKVQLA N  T Q+AA+K+ISK+VF+             
Sbjct: 10  TVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVNSNNNNNSAL 69

Query: 57  -TGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEK 115
              +V+  S+      +ALPYGIEREIIIMKLLNH NVLRLYDVWETN +LY+VLEYAEK
Sbjct: 70  AASDVNNGSV--QHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEK 127

Query: 116 GELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADF 175
           GELFNLLVE+GPL E+EA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADF
Sbjct: 128 GELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADF 187

Query: 176 GMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEED 235
           GMAALETE KLLETSCGSPHYAAPEIVSG+PY G  +D+WSCGVILFALLTGRLPFDEED
Sbjct: 188 GMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGRLPFDEED 247

Query: 236 GNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           GNIR LLLKVQKGEFEMP  DE+S EAQDLI KILTV+P++RIKTR+ILKHPLLQKYP+I
Sbjct: 248 GNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLLQKYPNI 307

Query: 296 RDSKSIRGLPREDTYLTPLSESN---SSIDATILQNLVILWHGRDPEGIKEKLREPGANA 352
           +DSK+IR LPREDTYL PL+++N   + ID +ILQNL +LWHG+D   I +KL+EPGANA
Sbjct: 308 KDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKLKEPGANA 367

Query: 353 EKTLYALLYRFKCDTQKELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTS 412
           EKTLY LL+RFK DT++E                           P+RR+NR S+ISVTS
Sbjct: 368 EKTLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSNQGNVPRRRKNRNSMISVTS 427

Query: 413 SRKKPIXXXXXXX------------XXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSS 460
           S KKP+                                               T  N SS
Sbjct: 428 SHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNSRLYTQSNSSS 487

Query: 461 PTPASRNKRASVINVEKNQKRASIF---------STTXXXXXXXXXXXXXXLIPSMKRES 511
           PTPA R++R+S  N+   +  A              +               + + KR S
Sbjct: 488 PTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQNKRGSRLSKRYSFLLNNKRGS 547

Query: 512 VTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           VTTK+MSTYAKLAEDDDWE+IEKETKR SS+FATLIDEIFE+EK+
Sbjct: 548 VTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKF 592

 Score =  256 bits (655), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 197/531 (37%), Positives = 285/531 (53%), Gaps = 89/531 (16%)

Query: 634  NIRSISAPMEN---EEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSP 690
            N RS+S P++N   +EK              +RNFSLQTRP+SRLDPG+MFS    ++  
Sbjct: 674  NSRSVSEPVKNGGTDEKG-------------QRNFSLQTRPISRLDPGLMFS----KLGD 716

Query: 691  VEPKRTENERLT--TEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSI--IAPQRLSE- 745
            V+   + +E LT   +K ILETIRRSKFLGSSF+I+KEL  +  E   +  +  Q+  E 
Sbjct: 717  VDNNSSVDENLTMNNQKTILETIRRSKFLGSSFDINKELNNANEERKRLRQLQLQKQKEL 776

Query: 746  ---ERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSR 802
               ER+ S S    E+ +L K+  GV  LKD ++   P      RKISE++VPQFTRKS+
Sbjct: 777  EEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEP------RKISEVQVPQFTRKSK 830

Query: 803  HFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVN 862
            +FSESNKRLSVLS YS+K+S+TNLVD++K     V ++     P   + +DS++ +    
Sbjct: 831  YFSESNKRLSVLSFYSSKQSYTNLVDMIKEN--PVEDEDVTEDPG-FNFEDSQYDYLEEK 887

Query: 863  EEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNE-AKQTDNLH--LPILPPL 919
             EA    +    + + D      K+  ++KLNFADRF+  N   KQ  +     P +   
Sbjct: 888  NEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRFSNVNSNTKQESSFEDKFPNILSK 947

Query: 920  NGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTXXXXXXXXXXXXXXXXXXXXXXXXXX 979
            +G   L   +  E  +  P +KSMIPE    + +                          
Sbjct: 948  SGTEGLGLYSKNEKTEPKP-VKSMIPEEDKVNSSPV------------------------ 982

Query: 980  XXVVDDMEPPLNKSVQKIREKN-------AGSQAKDHSKDHLKE-HKQDKNTAIGNGXXX 1031
                  +E PLNK V K R +N       +GSQ   ++   L++   +  N+ +  G   
Sbjct: 983  ------VEAPLNKVVNKTRAENKSTSKGPSGSQKVSNTSSFLRKISGKSSNSTVAKGAFE 1036

Query: 1032 XXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIF 1091
                      + LY+ ++  QLFNGL+ LL+GWT YGLK++K       + GKLS+DNI 
Sbjct: 1037 ----------VNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNIL 1086

Query: 1092 SLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            SLRST+ E+ ++   K SV+  +K SGS K +++L +E+E VL+KEGVLQK
Sbjct: 1087 SLRSTIVELCVFTESKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQK 1137

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/571 (60%), Positives = 411/571 (71%), Gaps = 29/571 (5%)

Query: 6   NSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTS- 64
           +++  +K + IGPWKLG TLG GSTGKV +A++ STGQ+AAVK++SK++F  GN S +S 
Sbjct: 13  STLTTLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIF--GNQSNSST 70

Query: 65  IVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           IVGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWETN+ LY+VLEY EKGELFNLLV+
Sbjct: 71  IVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVD 130

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG 184
           RGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++ 
Sbjct: 131 RGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKD 190

Query: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
           KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLK
Sbjct: 191 KLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK 250

Query: 245 VQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGL 304
           VQ G+FEMP  +EIS EAQDLI KILTVDP  RIK+R ILKHPLLQKYPSI+DSKSIR L
Sbjct: 251 VQSGKFEMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNL 310

Query: 305 PREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           PREDTYL PL   + +ID TI+ NLV+LWHGRD   I  KL+EPGAN EKT YALL+RFK
Sbjct: 311 PREDTYLNPLDSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFK 370

Query: 365 CDTQKELIXXXXXXXXXXXX------XXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPI 418
            D+Q+E +                             TTP +++ R  +IS +SS K+P+
Sbjct: 371 HDSQQEQLKQQRRSQAMQVSPKKTGLRKSNSRRSINSTTP-KKKTRAPVISASSSHKRPV 429

Query: 419 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT-IVN-QSSPTPASRNKRASV---- 472
                                              + ++N  SSPTPAS  KRAS+    
Sbjct: 430 SFSRLSYSNGSNTDHNTPNSSGKRSSVNLSSNKRISALINPNSSPTPAS--KRASLRELD 487

Query: 473 -------INVEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAE 525
                  +++ K+  +A+                    +P  KR S+TTKL++TYAK++E
Sbjct: 488 PSAPPIPVDMLKDYNKAA----PKANRKSSRISKRLSFLPGNKRGSITTKLIATYAKISE 543

Query: 526 DDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           D+DWEYIEKETKRTS++FATL DEIFE+EKY
Sbjct: 544 DNDWEYIEKETKRTSADFATLCDEIFEHEKY 574

 Score =  280 bits (715), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 208/542 (38%), Positives = 279/542 (51%), Gaps = 76/542 (14%)

Query: 636  RSISAPME-----NEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSP 690
            RS+SAP+E     ++  +++ L+ DI ++L RR FSL+TRP SRLDPGI     T E  P
Sbjct: 658  RSVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGIY----TLEEVP 713

Query: 691  VEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKM--EYPSIIAPQRLSEERV 748
                +     L TEK ILETIRRSKFLGSSF+I+KEL   +   E  +    QR  E+RV
Sbjct: 714  NSDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRV 773

Query: 749  VSD-----SNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRH 803
            VS+     S +GYE   LPK+        D  A + P      RKISE++VPQFTR+SRH
Sbjct: 774  VSNATGNYSENGYEPQTLPKNAAATKISND--AGSDP------RKISEVQVPQFTRRSRH 825

Query: 804  FSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNE 863
            F+ SNKRLSVLSMYSTK SFTNL D L+ G  D+ +       T R   ++EF+FE+V+ 
Sbjct: 826  FTASNKRLSVLSMYSTKASFTNLADHLR-GKTDLQSINGSPPSTSRMEPETEFMFESVDG 884

Query: 864  EAEYTGNSSNDERLYDVG---DSTIKDKSALKLNFADRFNG-----SNEAKQTDNLHLPI 915
            E + T ++S D RLY+V    D     +SA++LNFADRFN          +  + + LP 
Sbjct: 885  EGKETADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPS 944

Query: 916  LPPL--------NGDNELRKQNSQEGDQAHPKIKSMIPESGSSSHTXXXXXXXXXXXXXX 967
            LPPL        NG    +  +     + H + KSMIP                      
Sbjct: 945  LPPLDKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPK 1004

Query: 968  XXXXXXXXXXXXXXVVDDMEPPLNKSVQKI--REKNAGSQ-----AKDHSKDHLKEH--K 1018
                           V+    PLNK ++K    EKN  +Q      K ++K   +    K
Sbjct: 1005 D--------------VESAPAPLNKVMKKNTEAEKNQPNQPAPNAVKKNNKSFFRRFSGK 1050

Query: 1019 QDKNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNN 1078
             D     G                +    I   Q+FN L KLL  W  YGLK++ + P+ 
Sbjct: 1051 SDDEKRPGE------------YDFKFDTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQ 1098

Query: 1079 LTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEG 1138
              + GK+SSDN+ SLRSTLFE++I  +G+ S+V F K SGS K  KKLV E+E +L  + 
Sbjct: 1099 KKIKGKMSSDNMLSLRSTLFEISIVSKGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKK 1158

Query: 1139 VL 1140
             L
Sbjct: 1159 AL 1160

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/596 (56%), Positives = 406/596 (68%), Gaps = 43/596 (7%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT-GNV 60
           +I  + +  +K++ IGPWKLG  LG GS GKV +A++ +TGQ+AAVK++SK++F      
Sbjct: 9   SIISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQN 68

Query: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
           + ++IVGS  PD LPYGIEREIIIMKLLNH NVLRLYDVWET ++LY+VLEY EKGELFN
Sbjct: 69  NSSTIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFN 128

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLVERGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAAL
Sbjct: 129 LLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 188

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE++GNIR+
Sbjct: 189 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRS 248

Query: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
           LLLKVQ GE+EMP +DEIS EAQDLI KILTVDP+RRIKTR+ILKHPLLQKYPSI+DSKS
Sbjct: 249 LLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKS 308

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
           IR LPREDTYL PL   + SID  ILQNLV+LWHGRD   I  KL EPGAN EKT Y LL
Sbjct: 309 IRNLPREDTYLNPLDHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLL 368

Query: 361 YRFKCDT------------------------------QKELIXXXXXXXXXXXXXXXXXX 390
           +RFK D                               Q   +                  
Sbjct: 369 FRFKHDVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITS 428

Query: 391 XXXXXTTPQRRRNRESLISVTSSRKKPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 450
                TT  +++NR S+ISV+SS K+P+                                
Sbjct: 429 TSLSGTTTPKKKNRVSMISVSSSHKRPVSFNKLSTAGKSDSACGTPGSSTKRMSISLSSS 488

Query: 451 XXXTIVN-QSSPTPASRNKRASVINVEKN---------QKRASIFSTTXXXXXXXXXXXX 500
              + +   +SPTPA  NKR SV +++ +             S                 
Sbjct: 489 KRLSAMGPNTSPTPA--NKRMSVRDMDSSAPPVPMDVLNDYTSALPNRKATKRASRASKR 546

Query: 501 XXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
              +P++KR S+TTKL++TYAKL+E+DDWEYIEKETKRTS++FATL D+IFE+EKY
Sbjct: 547 LSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKY 602

 Score =  295 bits (755), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 219/552 (39%), Positives = 283/552 (51%), Gaps = 62/552 (11%)

Query: 628  EEKLDGNIRSISAPM-------ENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIM 680
            EE+     R +SAP+       + +  +I  L  DID++L+RR  SLQTRPVSRLDPGI+
Sbjct: 683  EEQGASKNRCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRRTVSLQTRPVSRLDPGIV 742

Query: 681  FSSPTEEVSPVEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAP 740
             +     V   E    +   L TEK ILETIRRS+FLGSSF+I KEL+ ++ +    +A 
Sbjct: 743  AAENLGSVIYEEADGVDETTLRTEKTILETIRRSRFLGSSFDIKKELERAQRKKEEALAR 802

Query: 741  QR----LSEERVVSDSNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQ 796
            Q     LS     S +ND YES  LPK+   V  L D         +   RKISEI+VPQ
Sbjct: 803  QHQQRILSSATAASATNDAYESRALPKNAAAVDTLNDE-------RNPEPRKISEIKVPQ 855

Query: 797  FTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEF 856
            FTR+SRHF+ SNKRLSVLSMYSTK SFTNL D LK G  D+         T +   + EF
Sbjct: 856  FTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLK-GGADLQEVSGSAPSTTKITQEPEF 914

Query: 857  LFETVNEE-AEYTGNSSNDERLYDVGD----STIKDKSALKLNFADRFN---GSNEAKQT 908
            LFE+V+EE +E T +++ D RLY+V D    S    K+A++LNFADRFN   G N A   
Sbjct: 915  LFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLNFADRFNTRAGDNPA--- 971

Query: 909  DNLHLPILPPL--NGD---NELRKQNSQEGDQA---------HPKIKSMIPESGSSSHTX 954
             ++ LP LPPL  NG    N L    S E  +A          PK+ SMIP+  +     
Sbjct: 972  -DVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPKVFSMIPDDIAGPAKS 1030

Query: 955  XXXXXXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDHL 1014
                                         +  +PPLN           G   K++ +  L
Sbjct: 1031 TKPAESENVPTSATKKSEPKNALHSADAPEASQPPLN-----------GMMRKNNDRKPL 1079

Query: 1015 KE-----HKQDKNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGL 1069
            ++      K+   +                   +L   + A Q+FN L KLL GW  YGL
Sbjct: 1080 EDITPAAEKKRNRSFFRKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWKDYGL 1139

Query: 1070 KNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIY-PRGKMSVVQFKKVSGSFKAVKKLVN 1128
            K ++      T+TGKLSSDNI SLRST+FE+ +     K SVV F K SGS K  K+LV 
Sbjct: 1140 KEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFKRLVK 1199

Query: 1129 EVENVLNKEGVL 1140
            EVE VL +E VL
Sbjct: 1200 EVEKVLERENVL 1211

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/581 (58%), Positives = 402/581 (69%), Gaps = 54/581 (9%)

Query: 1   MAINGNS-IPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGN 59
           M    NS + ++K   IGPW LGETLG+GSTGKV +A+N  TGQ AAVK+ISK++FN   
Sbjct: 1   MGTKDNSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFN--- 57

Query: 60  VSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
             G++ VGS  PD LPYGIEREI IMKLLNHPNVLRLYDVWET+TDLY+VLEY EKGELF
Sbjct: 58  AQGSTFVGSNDPDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELF 117

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           NLL+ERGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAA
Sbjct: 118 NLLIERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAA 177

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIR 239
           LE++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDE+DGNIR
Sbjct: 178 LESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIR 237

Query: 240 TLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSK 299
            LLLKVQ GEFEMP  DEIS EAQDLI KILTVDP  RIKTR+ILKHPLL+KYPSI+DSK
Sbjct: 238 KLLLKVQSGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSK 297

Query: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYAL 359
           SIR LPREDTYL PL  ++ ++D TIL+NLV+LWHGRD   I  KL E G N EKT YAL
Sbjct: 298 SIRNLPREDTYLNPLDHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYAL 357

Query: 360 LYRFKCDTQ----------KELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLIS 409
           L+RFK + +          K +                         TP+++R+  S I+
Sbjct: 358 LHRFKYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKKRS--SGIN 415

Query: 410 VTSSRKKPIXXXX----------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQS 459
           V+S+ K+P+                                             +I   +
Sbjct: 416 VSSAHKRPVSIQKWGEIGGGNNGLISPSKKRSLSNRKLSAILNTPSSSPSRKRMSIAQDA 475

Query: 460 SPTPAS----RNKRASVINVEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTK 515
            P P S     NKRAS     +N KR S                    +PS+KR+S+T+K
Sbjct: 476 PPMPTSVLRDYNKRAS-----RNSKRFS-------------------FLPSIKRQSITSK 511

Query: 516 LMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           +++TYAKL+ED+DWEYI+KE KRTSS+FATLID IFE+EKY
Sbjct: 512 IIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKY 552

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 175/548 (31%), Positives = 257/548 (46%), Gaps = 96/548 (17%)

Query: 636  RSISAPME-----NEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSP 690
            RS+S P +     ++  ++  L+  I+ +L +R  S+QTRP+SRLDPGIM      E+  
Sbjct: 666  RSVSEPHKRHSSTSKRDSLLALQYSINTVLNKRAVSVQTRPISRLDPGIMAQEVAHELDY 725

Query: 691  VEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIA---------PQ 741
             + +      L  EK ILETIRRS FLGS F+I KELK +K E               P 
Sbjct: 726  DDEEILSERTLRREKTILETIRRSNFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPD 785

Query: 742  RLS--EERVVSD------SNDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIR 793
            R+S  ++R VSD      ++DGY++  L +    V  L+D         +   +K+SE+R
Sbjct: 786  RISYHDQRFVSDGTTITSAHDGYDTTSLTRH-TTVGVLRD--------DESEPKKLSEVR 836

Query: 794  VPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADD 853
            +P+ TR+SRH S S+KR SVLSMYST  S+TNL D +K+   DV  +      + +    
Sbjct: 837  IPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLADFMKS---DVQLKPLNDTASSKVTQQ 893

Query: 854  SEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDN--- 910
             EF+FE+  +  E    SSND     +      + + +KLN+ADRF    E  + D+   
Sbjct: 894  PEFMFESTIDNVERI--SSNDNS--HISSMEAPNNTVIKLNYADRFYKPVEVIELDDTDN 949

Query: 911  -----------LHLPILPPLNGDNE------LRKQNSQEGDQAHPKIKSMIPESGSSSHT 953
                       + LP LPPL   N+      + + +S   D  H  ++S+ P     +  
Sbjct: 950  TQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPREDFKHA-VRSVTPNENKENED 1008

Query: 954  XXXXXXXXXXXXXXXXXXXXXXXXXXXXVVDDMEPPLNKSVQKIREKNAGSQAKDHSKDH 1013
                                            +  PL    Q+   K   S  +  SK+ 
Sbjct: 1009 PAGTTQQKAPLTSVGKEL-------------GIREPLTDLAQQGVPKKRPSFFRKFSKEK 1055

Query: 1014 LK-EHKQDKNTAIGNGXXXXXXXXXXXXTMELYAKISAKQLFNGLEKLLRGWTQYGLKNI 1072
            +K E+    +T + N               +++  +   +L NG       WT YGLK +
Sbjct: 1056 IKPEYDYQLDTTVNN--------------TKMFRALD--KLLNG-------WTSYGLKQV 1092

Query: 1073 KSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGKMSVVQFKKVSGSFKAVKKLVNEVEN 1132
            +S P+   +TGKLSSDNI SLRST F+V +      S V+F K SGS K   +LVNE+E 
Sbjct: 1093 RSSPSVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFARLVNEIEK 1152

Query: 1133 VLNKEGVL 1140
            +L KE VL
Sbjct: 1153 ILEKEKVL 1160

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/579 (58%), Positives = 405/579 (69%), Gaps = 53/579 (9%)

Query: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
           M    N++ +++ + IGPWKLGETLG GSTGKV LA+N  TGQ AAVKVISK+VFN    
Sbjct: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFN---A 57

Query: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
            G++ VGS  PD LPYGIEREIIIMKLLNHPNVLRLYDVWET  DLY+VLEY EKGELFN
Sbjct: 58  QGSTFVGSNDPDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFN 117

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LLV+RGPLPE+EA+RFFRQIIIG+SYCHALGIVHRDLKPENLLLDHK+NIK+ADFGMAAL
Sbjct: 118 LLVQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL 177

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
           E++ KLLETSCGSPHYAAPEIVSG+PY GF SDVWSCGVIL+ALLTGRLPFDEEDGNIR 
Sbjct: 178 ESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRN 237

Query: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS 300
           LLLKVQ G++E+P +DEIS EA+DLI +ILTV+PE+RIKTR+ILKHPLLQKYPSI+DSKS
Sbjct: 238 LLLKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKS 297

Query: 301 IRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
           IR LPREDTYL PL  ++ +ID  ILQNLV+LWHGRD   I  KL+EPGAN EKT YALL
Sbjct: 298 IRNLPREDTYLNPLDHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALL 357

Query: 361 YRFKCDTQ----------KELIXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISV 410
           +RFK + +          K +                        +TP+++R+  S I+V
Sbjct: 358 HRFKFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKKRS--SAINV 415

Query: 411 TSSRKKPIXXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIVNQSSP 461
           +S+ K+P+                                            ++   + P
Sbjct: 416 SSAHKRPVSIQKLNDCGTLNPTSPSKKRSLSNRKLSAVLAGSNSSSPSRKRMSVGQDAPP 475

Query: 462 TPAS----RNKRASVINVEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLM 517
            P +     NKRAS     +  KR S                    +PS KR S+TTK++
Sbjct: 476 VPTAVLRDYNKRAS-----RASKRLS-------------------FLPS-KRGSITTKII 510

Query: 518 STYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           +TYAKL+ED+DWEYI++E KRTSS+FATLID IFE+EKY
Sbjct: 511 ATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKY 549

 Score =  175 bits (444), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 143/380 (37%), Positives = 205/380 (53%), Gaps = 68/380 (17%)

Query: 616 ISDLEQELSKHKEEK-----LDGNIRSISAPME------NEEKNINHLEVDIDNILRRRN 664
           ++ L+ E++  K+EK      + ++RSIS PME      ++  +   L+ +I+++L+RR 
Sbjct: 613 VARLKAEVAATKQEKRISLAQEQHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRT 672

Query: 665 FSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENE-RLTTEKKILETIRRSKFLGSSFNI 723
            SL+TRP+SRLDPGI  S   EE + +E     NE RL  EK ILETIRRSKFLGS ++I
Sbjct: 673 LSLETRPISRLDPGIRLS---EENTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYDI 729

Query: 724 DKEL------KLSKMEY---------PSIIAPQRLSEERVVSD------SNDGYESLILP 762
           DKEL      KL K+           P + + Q   E+R VSD      S++  ES+ILP
Sbjct: 730 DKELQRVRREKLEKVNMRKSQDRKLEPGLHSRQ---EQRFVSDGTTVTSSHEDSESIILP 786

Query: 763 KDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKES 822
           K+   +  LKD         +   RK+SE+++PQFTR+S+HFS S+KRLSVLSMYSTK S
Sbjct: 787 KNVTAIGVLKDE--------ESEPRKLSEVKIPQFTRRSKHFSASSKRLSVLSMYSTKVS 838

Query: 823 FTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDV-- 880
           +TNL D L N ++ + + Q     + +   + EF+FE+  +E  Y   +  D  L     
Sbjct: 839 YTNLADYL-NNDVQLKSLQPSAPTSIKIPQEPEFMFESAGQENRYQAAAPTDTYLERPKV 897

Query: 881 ---GDSTIKDKSALKLNFADRFNGSNEAKQTD--NLHLPILPPLNGDNELRKQNSQEGDQ 935
              GD    +   L +   D  + S +  + D   + LPILPPL   + L K N     Q
Sbjct: 898 GVEGDHEPGEPVEL-IELDDSEDRSKQYSEEDIAKVKLPILPPL---DHLNKPNGLGIYQ 953

Query: 936 A---------HPKIKSMIPE 946
           A          P +KSMIP+
Sbjct: 954 APAPPKEPLGQPVMKSMIPD 973

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 65/100 (65%), Gaps = 1/100 (1%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
            ++L   +   ++F  L KLL GWT YGLK ++S P + T+TGKLSSDNI SLRST FE+ 
Sbjct: 1039 VQLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIV 1098

Query: 1102 IYPRGKM-SVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
            I       S V+F K SGS K   +LVNE+E +L KE VL
Sbjct: 1099 ILSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/423 (72%), Positives = 348/423 (82%), Gaps = 16/423 (3%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTT 70
           +K NT+GPWKLGETLGLGSTGKVQLA N STGQ+AA+KVISKAVFN  N +  S     T
Sbjct: 12  VKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANA-SDSALLT 70

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
           PD+LPYGIEREIIIMKLLNHPNVLRLYDVWET+++LY+VLEYAEKGELFNLLVERGPLPE
Sbjct: 71  PDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPE 130

Query: 131 HEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETS 190
           +EAIRFFRQIIIG+SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETE KLLETS
Sbjct: 131 NEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETS 190

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF 250
           CGSPHYAAPEI+SG+PY G  +DVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+F
Sbjct: 191 CGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQF 250

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTY 310
           EMP +DEISREAQDLI KILTVDP++RIKTR+ILKHPL+QKYPSI+DSK+IR LPREDTY
Sbjct: 251 EMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTY 310

Query: 311 LTPLSESN---SSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDT 367
           L PLS+ N     ID  ILQNLV+LWHGRD + I +KL+EPGANAEKTLYALL RFK DT
Sbjct: 311 LNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDT 370

Query: 368 QKEL------------IXXXXXXXXXXXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRK 415
           +KE+            +                        TP +R+NR S++SV+S+ K
Sbjct: 371 EKEIKRQSQLKKRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASMVSVSSAHK 430

Query: 416 KPI 418
           +P+
Sbjct: 431 RPV 433

 Score =  181 bits (459), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/302 (42%), Positives = 180/302 (59%), Gaps = 47/302 (15%)

Query: 631  LDGNIRSISAPMENEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEVSP 690
            +D   RS+SAP+E  EK+ +    D     ++RNFSL+TRPVSRLDPG+M+SS T   + 
Sbjct: 757  VDIQPRSVSAPLEKTEKSRDS-PFDYS---KQRNFSLRTRPVSRLDPGLMYSSGTGSSAY 812

Query: 691  VEPKRTEN-------ERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRL 743
                 TE+        R+ T+K ILETIRRSKFLGSSF++ KEL++ +    + I  Q  
Sbjct: 813  NPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVEELESNRIKQQAF 872

Query: 744  ----------------------SEERVVSDSNDGYESLILPKDGNGVSQ---LKDSTATT 778
                                  S +R+VS +ND YE+ ILPK   G +Q   L DS+   
Sbjct: 873  QDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQTIGLNDSSV-- 930

Query: 779  APVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVN 838
                  + R +SEI+VPQFTRKS+ FSESNKRLSVLS+YS++ESFTNLVD+LK   ++V 
Sbjct: 931  ------QPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKEDGINV- 983

Query: 839  NQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDERLYDVGDSTIKDKSALKLNFADR 898
             + ++R PT +S  + EFLFE+ + +     +S+ D+ + +  +S     + L+L+F DR
Sbjct: 984  -EPTERSPTTKSQ-EPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSFHDR 1041

Query: 899  FN 900
            FN
Sbjct: 1042 FN 1043

 Score =  119 bits (298), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 77/102 (75%), Gaps = 1/102 (0%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
             +L A ++A Q+F GL+ L RGW++YGLKNIKS P +L  TGK+SS+NI S +ST+FE+ 
Sbjct: 1290 FQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELE 1349

Query: 1102 IYPRG-KMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            I     K  +++FKK SGS K+V++LVNEVENVL KEGVL K
Sbjct: 1350 IISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVLLK 1391

 Score = 94.7 bits (234), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 49/52 (94%)

Query: 505 PSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           P+M+R S+TTKL+STYA+LAEDDDWE+IEKETKR SSNFATLID IFE+EKY
Sbjct: 618 PNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKY 669

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/358 (72%), Positives = 305/358 (85%), Gaps = 8/358 (2%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT-GNVSGTSIVGSTTPD 72
           +TIGPWKLGETLG+GS GKV+LA++  T  + AVK+ISK++FNT GN      V      
Sbjct: 16  STIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSV------ 69

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHE 132
            LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+RG LPE E
Sbjct: 70  -LPYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPERE 128

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCG 192
           A++ FRQIII VSYCHALGIVHRDLKPENLLLD  YNIK+ADFGMAAL+T+  LLETSCG
Sbjct: 129 AMKCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCG 188

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYAAPEIVSG+PY+GF+SDVWSCGVILFALLTGRLPFDEE+GNIRTLLLKVQ+G+FEM
Sbjct: 189 SPHYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEM 248

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLT 312
           P D EIS++AQDLI KIL VDP +RIK RDIL HPLL++Y +I+DSKSI+ LPREDTYL 
Sbjct: 249 PDDTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLY 308

Query: 313 PLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKE 370
           PL+++ ++ID +ILQNLV+LWHGR  + IK KL+  G N EKTLYALLYRFK ++ +E
Sbjct: 309 PLADAGAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRE 366

 Score =  105 bits (261), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 112/220 (50%), Gaps = 46/220 (20%)

Query: 638 ISAPMENEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRT 696
           +S+P+ N E +   L  DID +L  R   S  TRP+S+LDPG+M   P    +P + K  
Sbjct: 570 VSSPLINYEFSQQELLQDIDTLLTNRYQLSAYTRPISKLDPGLM---PAAGTTPHDIKEQ 626

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGY 756
                 TE KI+ETI RSKFLGS  N+ + +     E    +AP  + E  ++S      
Sbjct: 627 TALIRDTEVKIIETIHRSKFLGSLLNVREGMSKDDDE----LAP--IEESSIIS------ 674

Query: 757 ESLILPKDGNGVSQLKDSTATTAPVSDGR--LRKISEIRVPQFTRKSRHFSESNKRLSVL 814
                               TT  + D R  +RKIS++ VP FTRKSRHF+ ++ R SVL
Sbjct: 675 --------------------TTPLIYDDRTEVRKISDVEVPHFTRKSRHFTAASNRRSVL 714

Query: 815 SMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDS 854
           S+YS+++SF +L  I KN   D         P+ RS DD+
Sbjct: 715 SLYSSRDSFKDLSQISKNEYSDS--------PSQRSVDDT 746

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 69/102 (67%), Gaps = 1/102 (0%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
            +E++AKI  K+LF GL KLL GW QYGLK +      + + GKL +D+I SLRSTLFE+ 
Sbjct: 916  LEIHAKIPNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEII 975

Query: 1102 IYPRG-KMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            + P G   S+++F K +GS K + KL  E++ +L KEGVL K
Sbjct: 976  VLPNGDDRSLIKFNKKTGSSKVLTKLATEIQIILQKEGVLDK 1017

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 46/53 (86%)

Query: 504 IPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           +P++K  SVT++L+S Y KL ++DDWE IEK+TKRTSSNFATLIDEIFE E++
Sbjct: 475 MPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPEEF 527

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  563 bits (1451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/358 (75%), Positives = 302/358 (84%), Gaps = 12/358 (3%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT-GNVSGTSIVGSTTPDA 73
           TIGPWKLGETLG GSTGKVQLA++  TG   AVKVISK++FN  GN S    V       
Sbjct: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSV------- 69

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPY IEREI+IMKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+ GPLPE EA
Sbjct: 70  LPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREA 129

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           I  FRQIIIG+SYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  LLETSCGS
Sbjct: 130 INCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGS 189

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FEMP
Sbjct: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
           +D EISR+AQDLI KIL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 250 NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309

Query: 314 LSESN----SSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDT 367
           L++SN    +SID +ILQNLV+LWHGR  + I  KL+E G N EK LYALLYRFK D+
Sbjct: 310 LADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDS 367

 Score =  103 bits (258), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 72/102 (70%), Gaps = 1/102 (0%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
            +E++AKI  K+L+ GL KLL GW QYGLKN+  +  N+ +TGKL +D+I  LRSTLFE+ 
Sbjct: 936  LEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIM 995

Query: 1102 IYPRGK-MSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142
            + P G   S+++F K +GS K + KL  E++ +L KEGVL K
Sbjct: 996  VLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVLDK 1037

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 78/208 (37%), Positives = 107/208 (51%), Gaps = 39/208 (18%)

Query: 638 ISAPMENEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRT 696
           +S+P+ N E +   L  DID +L  R   S  TRP+SRLDPG+   +P  E  P   K  
Sbjct: 587 VSSPLINYEFSQQELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTETLPNNLKEK 643

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGY 756
                 TEKKI+ETIRRSKFLGS  N+   L   K E    +AP  + E  +VS      
Sbjct: 644 TALLQDTEKKIIETIRRSKFLGSLLNVRGGLSPGKSE----LAP--IEESPIVS------ 691

Query: 757 ESLILPKDGNGVSQLKDSTATTAPVSDGRL--RKISEIRVPQFTRKSRHFSESNKRLSVL 814
                               TT  + + R+  R+IS++ VP FTRKS+HF+ +N R SVL
Sbjct: 692 --------------------TTPLIYNDRMEPRRISDVEVPHFTRKSKHFTTANNRRSVL 731

Query: 815 SMYSTKESFTNLVDILKNGNLDVNNQQS 842
           S+Y+ K+S  +L + L   + D+  Q S
Sbjct: 732 SLYA-KDSIKDLNEFLIKEDPDLPPQGS 758

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 59/100 (59%), Gaps = 2/100 (2%)

Query: 459 SSPTPASRNKRASVINVEKNQKRASIFSTTXXXXXXXXXXXXXXL--IPSMKRESVTTKL 516
           SSP P   +KR + INV     +A+                   L  +P+ KR S+T+K 
Sbjct: 438 SSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSKRLSYMPNTKRSSLTSKS 497

Query: 517 MSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           +S +  L +DDDWEYIEK+ KRTSSNFATLIDEIFE EK+
Sbjct: 498 LSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKF 537

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  558 bits (1437), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 260/361 (72%), Positives = 307/361 (85%), Gaps = 10/361 (2%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           N IGPWKLGETLG GSTGKVQLAR+  TGQ+ AVKVI K++F +    G +         
Sbjct: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN------DSV 69

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FEMP
Sbjct: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249

Query: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
           ++ EIS +AQDLIR+IL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309

Query: 314 LSESNS----SIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQK 369
           L+++++    +ID +ILQNLVILWHGR  E I +KL++ G N EKTLYALLYRFK ++ K
Sbjct: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369

Query: 370 E 370
           E
Sbjct: 370 E 370

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 1/100 (1%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
            +++ AKIS K+L+ GL KLL GW QYGLKN+  +  ++ ++GKL +D I SLRSTLFE+ 
Sbjct: 931  LDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIV 990

Query: 1102 IYPRGK-MSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
            I P G   S+++F K +GS K + K   E++ +L KEGVL
Sbjct: 991  ILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030

 Score = 96.7 bits (239), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 114/239 (47%), Gaps = 41/239 (17%)

Query: 638 ISAPMENEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRT 696
           +S+P+ N E +   L  DID +L  R   S  TRP+SRLDPG+   +P     P   K  
Sbjct: 586 VSSPLMNYEFSQKELLQDIDTLLTNRYQLSSYTRPISRLDPGL---TPVTGAIPHSIKEK 642

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGY 756
                 TE KI+ETIR+S+FLGS  N+ + +     +  SI    ++S   ++   ND  
Sbjct: 643 TALLQDTEMKIIETIRKSEFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMY--NDQV 700

Query: 757 ESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSM 816
           E                            +RKIS++ VP FTRKS+HF+ +N R SVLS+
Sbjct: 701 E----------------------------IRKISDVEVPHFTRKSKHFTTANNRRSVLSL 732

Query: 817 YSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDE 875
           YS KES  +L  I KN   D   Q S       +A  SE +   V EE     NS +D+
Sbjct: 733 YSLKESLEDLNQISKNEEPDSPPQGST-----DNASKSELV--DVIEEVTEQKNSQHDQ 784

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/53 (67%), Positives = 45/53 (84%)

Query: 504 IPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
           +P++ R S+TT L+S Y  L +DDDWEYI+K+TKRTSSNFATLIDEIFE EK+
Sbjct: 483 MPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEIFEPEKF 535

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  555 bits (1431), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 257/360 (71%), Positives = 306/360 (85%), Gaps = 10/360 (2%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           NTIGPW+LGETLG GSTG+VQLA++  TG + AVKVISK +F+T +  G   +      A
Sbjct: 8   NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXL------A 61

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPY IEREI++MKLL+HPNVL LYDVWETN +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 62  LPYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEA 121

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
           ++ FRQIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+ +LLETSCGS
Sbjct: 122 VKCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGS 181

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDE++GN+R LLLKVQ+G+FEMP
Sbjct: 182 PHYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMP 241

Query: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
              EIS++AQ+LI +IL VDP +R+KTRDIL HPLL+KY +IRDSKSIR LPRE+TYL P
Sbjct: 242 DATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYP 301

Query: 314 LSES----NSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQK 369
           L+++    N++ID +ILQNLV+LWHGR  + I   L++ G N EKTLYALLYRFK +  K
Sbjct: 302 LADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFKQEANK 361

 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 73/100 (73%), Gaps = 1/100 (1%)

Query: 1042 MELYAKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVN 1101
            +E++AKI A++LF GL KLL GW QYGLKN+     N+ +TGKL +DNI SLRSTLFE+ 
Sbjct: 923  LEIHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEII 982

Query: 1102 IYP-RGKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
            + P R   S+++F K +GS K +KKL  E++ VL KEGVL
Sbjct: 983  VLPNRDDRSLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

 Score =  107 bits (266), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 123/249 (49%), Gaps = 37/249 (14%)

Query: 638 ISAPMENEEKNINHLEVDIDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRT 696
           +S+P+ N E +   L  DI+ +L  R   S  TRP+S+LDPG+M   PT E  P + K  
Sbjct: 576 VSSPLINYEYSQQELLQDINTLLTNRCQLSAYTRPISKLDPGLM---PTPETIPYDIKEK 632

Query: 697 ENERLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGY 756
            +  L TE KILETIR+SK L SS N+ KE+       PS+       EE  ++ +    
Sbjct: 633 TDLLLDTEMKILETIRKSKILDSSLNLRKEVSRDADRLPSV-------EESPIASTT--- 682

Query: 757 ESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSM 816
             L+   D   V                   KIS+I+VP FTRKS+ F+ +N R SVLS+
Sbjct: 683 -PLVYNNDSKEVC------------------KISDIQVPHFTRKSKCFTPTNNRRSVLSL 723

Query: 817 YSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSNDER 876
           YS++ SF  L  IL + +   N       P     D +E +    N E      ++N+ R
Sbjct: 724 YSSRHSFKGLSRILNSKDPSANPYSHINGPLSEEIDLTEDIANMKNIENN----NNNNNR 779

Query: 877 LYDVGDSTI 885
           LYDV +S I
Sbjct: 780 LYDVSESAI 788

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 58/98 (59%), Gaps = 1/98 (1%)

Query: 460 SPTPASRNKRASVIN-VEKNQKRASIFSTTXXXXXXXXXXXXXXLIPSMKRESVTTKLMS 518
           SP P+  +KR+S  N    N     +                   +P++KR S+T+K +S
Sbjct: 428 SPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKRNSKRSSKRLSYVPNVKRGSLTSKSLS 487

Query: 519 TYAKLAEDDDWEYIEKETKRTSSNFATLIDEIFEYEKY 556
            Y  L ++DDWEYIEK+TKRTSSNFATLIDEIFE EK+
Sbjct: 488 KYTNLIDEDDWEYIEKDTKRTSSNFATLIDEIFEPEKF 525

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  402 bits (1033), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 249/355 (70%), Gaps = 23/355 (6%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           +TIGPWKLG+TLG GS+G+V+LA+N  TG+ AAVK++ K               S+ P+A
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPK-------------TKSSRPNA 99

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +L+LVLEY + GELF+ LV RG L E EA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEA 159

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           I +FRQII G +YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+T  KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++M
Sbjct: 220 SPHYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    IS EAQDLI +IL VDP +RI   DIL HPL+ KY   R SKS   +  L     
Sbjct: 278 P--QAISLEAQDLISRILVVDPNKRITINDILSHPLITKYDYKR-SKSNSDLHILSHTSP 334

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
            +  +  S   +D TILQNL ILWHG   + I ++L EP    EKT Y+LL  ++
Sbjct: 335 QICTI-RSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  406 bits (1044), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 204/355 (57%), Positives = 254/355 (71%), Gaps = 14/355 (3%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K V  + N S  S   +     
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANGN--- 112

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPYGIEREIIIMKL++HPN++ LY+VWE  ++L+LVLEY E GELF+ LV +G LPE EA
Sbjct: 113 LPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEA 172

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           + +FRQII GV+YCH   I HRDLKPENLL+D K + IKIADFGMAALET  KLLETSCG
Sbjct: 173 VHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCG 232

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++ M
Sbjct: 233 SPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHM 290

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P +  IS EAQDLI KIL VDP  RI   ++L+HPL+ KY   R SKS   +  L R   
Sbjct: 291 PQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKAR-SKSNSDLHLLSRTPQ 347

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
            +T   +S   ID +IL NL ILWHG   E I  +L + G   EK  Y+LL++++
Sbjct: 348 LVT--LQSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  404 bits (1038), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 206/355 (58%), Positives = 251/355 (70%), Gaps = 20/355 (5%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K      N   TS         
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTS--------- 109

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +LYLVLEY E GELF+ L+ RG LPE EA
Sbjct: 110 LPYGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEA 169

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           + +F+QI+ GVSYCH   I HRDLKPENLLLD K  ++KIADFGMAALET  KLLETSCG
Sbjct: 170 VHYFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCG 229

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G+++M
Sbjct: 230 SPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 287

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLT 312
           P +  IS EA+DLI KIL VDP  RI   ++L+HPLL KY   R SKS   L   D+  T
Sbjct: 288 PQN--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDS--T 342

Query: 313 P---LSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           P   + ES   ID +IL NL ILWHG   E +  KL + G   EK  Y+LL R++
Sbjct: 343 PNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  402 bits (1034), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/360 (56%), Positives = 251/360 (69%), Gaps = 29/360 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK--AVFNTGNVSGTSIVGSTTP 71
           +T+GPWKLG+TLG GS+G+V+LA+N  +G+ AA+K++ K     N   V+          
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVT---------- 105

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEH 131
            ALPYGIEREIIIMKL+ HPN++ LY+VWE  ++LYLVLEY E GELF+ L+ RG LPE 
Sbjct: 106 -ALPYGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQ 164

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETS 190
           EAI +F+QI+ GVSYCH   I HRDLKPENLLLD K   +KIADFGMAALET  +LLETS
Sbjct: 165 EAIHYFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETS 224

Query: 191 CGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF 250
           CGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G +
Sbjct: 225 CGSPHYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRY 282

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGL------ 304
           +MPS+  +S+EA+DLI KIL VDPE+RI    IL+HPLL KY    D+    GL      
Sbjct: 283 QMPSN--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKY----DNPGKGGLACPLEK 336

Query: 305 PREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           P E   +  +  S   ID TIL NL ILWHG   E + +KL + G   EK  YALL R++
Sbjct: 337 PEERPKVLDI-HSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  398 bits (1022), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 209/363 (57%), Positives = 256/363 (70%), Gaps = 25/363 (6%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           +TIGPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K        + +S  GS     
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPK--------TKSSRTGS----- 99

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE   +L+LVLEY + GELF+ LV RG LPE EA
Sbjct: 100 LPYGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEA 159

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIKIADFGMAALETEGKLLETSCG 192
           I +FRQII G +YCH   I HRDLKPENLLLD K   IKIADFGMAAL+T  KLLETSCG
Sbjct: 160 IHYFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCG 219

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++M
Sbjct: 220 SPHYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQM 277

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    +S  AQDLI +IL VDP++RI   +IL HPLL KY + R SKS   +  L     
Sbjct: 278 P--QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGNKR-SKSNSDLHILSHSKP 334

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL--YRFKCDT 367
            ++ + +S S +D TILQNL ILWHG   E I + L +P    EKT Y+LL  Y+ +   
Sbjct: 335 QISTI-KSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQQRQSK 393

Query: 368 QKE 370
           QKE
Sbjct: 394 QKE 396

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  396 bits (1018), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/362 (55%), Positives = 251/362 (69%), Gaps = 21/362 (5%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ +A+K++ K             V S     
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKK-----------FVKSNQIKQ 116

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           LPYGIEREIIIMKL++HPNV+ LY+VWE  ++LYLVLEY E GELF+ LV +G LPE EA
Sbjct: 117 LPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEA 176

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLD-HKYNIKIADFGMAALETEGKLLETSCG 192
           I +F+QI+  V+YCH   I HRDLKPENLLLD  K +IKIADFGMAALET  KLLETSCG
Sbjct: 177 IHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCG 236

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G+++M
Sbjct: 237 SPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQM 294

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKS---IRGLPREDT 309
           P    +S EA+DLI +IL VDP RRI    IL+H LL KY     SKS   +  L R   
Sbjct: 295 P--QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDLNLLNRTPN 352

Query: 310 YLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQK 369
            ++  SE +  ID TIL NL ILWHG   + +  +L +PG   EK  Y+LL+ ++   QK
Sbjct: 353 IVSFSSERD--IDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQEKQQK 410

Query: 370 EL 371
            +
Sbjct: 411 SM 412

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  398 bits (1022), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 260/389 (66%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK------------------AVF 55
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                  +  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGTVPNSYSSSM 135

Query: 56  NTGNVSGTSIVG---STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
            T NVS  SI     S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +  D NI+ LLLKVQ G+++MPS+  +S EA+DLI KIL +DPE+RI T++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPLIKK 371

Query: 292 YPSI---------RDSKSIRGLPREDTYL----TP---LSESNSSIDATILQNLVILWHG 335
           Y  +         R     RG    D +L    +P      S   ID +IL++L ILWHG
Sbjct: 372 YDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQILWHG 431

Query: 336 RDPEGIKEKLREPGANAEKTLYALLYRFK 364
              E I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  397 bits (1020), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 263/389 (67%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK------------------AVF 55
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                  +  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 56  NTGNVSGTSIVG---STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
            T NVS  SIV    S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +  D NI+ LLLKVQ G+++MP +  +S EA+DLI KIL +DP +RI T++ILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 292 YPSIRDSKSIRGLPREDT----------YLTPLSE------SNSSIDATILQNLVILWHG 335
           Y  +  +K +R + R++            L  +S       S S ID +IL++L ILWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 336 RDPEGIKEKLREPGANAEKTLYALLYRFK 364
              E I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  393 bits (1009), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 207/396 (52%), Positives = 262/396 (66%), Gaps = 53/396 (13%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSG----------- 62
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K      NV G           
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKK----NNVLGKNDACSTSSAS 129

Query: 63  -------TSIVGSTTPDAL-----------PYGIEREIIIMKLLNHPNVLRLYDVWETNT 104
                  TS + +TT +             PYGIEREI+IMKL++H NVL LY+VWE  +
Sbjct: 130 YTSNSSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKS 189

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
           +LYLVLEY + GELF+ LV RG L E EA+ +F+QII GVSYCHA  I HRDLKPENLLL
Sbjct: 190 ELYLVLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLL 249

Query: 165 DHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFA 223
           D K + IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFA
Sbjct: 250 DKKNSTIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFA 309

Query: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283
           LLTG LPF+  D +I+ LLLKVQ G+++MP +  +S+EAQDLI KILTV+P +R+ T +I
Sbjct: 310 LLTGHLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEI 365

Query: 284 LKHPLLQKYPSIRDSKSIRGLPRE--------DTYLTPLSESNS-------SIDATILQN 328
           L+HPL+ KY S+  +K  + L +         D +L    E+ +        ID TIL N
Sbjct: 366 LRHPLIVKYDSMMKTKKYKALYKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILNN 425

Query: 329 LVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           L ILWHG   E I  KL +P  + EK  Y+LL ++K
Sbjct: 426 LQILWHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  394 bits (1013), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/390 (52%), Positives = 263/390 (67%), Gaps = 44/390 (11%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK------------------AVF 55
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                  +  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 56  NTGNVSGTSIVG---STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
            T NVS  SIV    S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV RG LPE EAI +F+QI+ GVSYCH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +  D NI+ LLLKVQ G+++MP +  +S EA++LI KIL +DPE+RI T++IL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 292 YPSIRDSKSI---------RGLPREDTYL--------TPLSESNSSIDATILQNLVILWH 334
           Y ++  +K +         RG    D +L          L+  N  ID +IL++L ILWH
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKN-EIDESILRSLQILWH 430

Query: 335 GRDPEGIKEKLREPGANAEKTLYALLYRFK 364
           G   E I  KL +   + EK  Y+LL R+K
Sbjct: 431 GVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  395 bits (1015), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 197/381 (51%), Positives = 258/381 (67%), Gaps = 34/381 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVI--------------SKAVFNTGN 59
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++              +K++ ++ +
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 60  VSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
              T+    T P    YGIEREI+IMKL++HPNV+ LY+VWE  ++LYLVLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMA 178
           + LV RG LPE EA+ +F+QII GV+YCHA  I HRDLKPENLLLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238
           ALE   KLL TSCGSPHYA+PEIV G  Y G  +DVWSCG+ILFALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI--- 295
           + LLLKVQ G + MPSD  +S +A+DLI KIL VDP++R+ T +IL H L+ KY  +   
Sbjct: 306 KKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 296 -RDSKSIRGLPREDT-----YLTPLS------ESNSSIDATILQNLVILWHGRDPEGIKE 343
            R+  +   + R+ +     ++  LS      ++   ID +IL NL ILWHG     I +
Sbjct: 364 NRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCDIDTSILSNLQILWHGESKHAIID 423

Query: 344 KLREPGANAEKTLYALLYRFK 364
           KL +P  N EK  Y+LL ++K
Sbjct: 424 KLLQPNMNEEKLFYSLLLKYK 444

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  392 bits (1006), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 261/383 (68%), Gaps = 38/383 (9%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK-------------AVFNTGNV 60
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K             + F+  + 
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 61  SGTSIV----------GSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S ++I           GS      PYGIEREI+IMKL++HPNV+ LY+VWE  ++LYLVL
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YN 169
           EY + GELF+ LV +G L E EA+ +F+QII GVSYCH+  I HRDLKPENLLLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 170 IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRL 229
           IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 230 PFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           PF+  D NI+ LLLKVQ G+F MPS   +S EAQDLI +IL +DP +RI T  IL HPL+
Sbjct: 336 PFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 290 QKY-PSIRDSKSIRGLPREDTYL------TPLS-ESNSSIDATILQNLVILWHGRDPEGI 341
            KY P+ ++   + G    D ++       P+S  S + IDA+IL+NL ILWHG   E I
Sbjct: 392 LKYEPAGKN--MVSGKSNSDLHVLEHISPQPISLTSRNDIDASILKNLQILWHGTSRELI 449

Query: 342 KEKLREPGANAEKTLYALLYRFK 364
             KL +   + EK  Y+LL+++K
Sbjct: 450 IAKLLQTPMSEEKLFYSLLWQYK 472

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  392 bits (1007), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 201/389 (51%), Positives = 262/389 (67%), Gaps = 42/389 (10%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK------------------AVF 55
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                  +  
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 56  NTGNVSGTSIVG---STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
            T NVS  SI     S      PYGIEREI+IMKL++H NV+ L++VWE  ++LYLVLEY
Sbjct: 136 ITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 113 AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-YNIK 171
            + GELF+ LV +G LPE EAI +F+QI+ GVS+CH+  I HRDLKPENLLLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNRKIK 255

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           IADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 232 DEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +  D NI+ LLLKVQ G+++MP +  +S EA+DLI KIL ++PE+RI T++IL HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPLIKK 371

Query: 292 YPSIRDSKSIRGLPREDT----------YLTPLS------ESNSSIDATILQNLVILWHG 335
           Y ++  +K IR + R++            L  +S       S   ID +IL++L ILWHG
Sbjct: 372 YDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQILWHG 431

Query: 336 RDPEGIKEKLREPGANAEKTLYALLYRFK 364
              E I  KL +   + EK  Y+LL ++K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  386 bits (992), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/389 (53%), Positives = 257/389 (66%), Gaps = 31/389 (7%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNV 60
           +IN  S      +T+GPWKLG+TLG GS+G+V+LA+N   GQ AA+K++ K      G  
Sbjct: 71  SINTKSSKRRSRDTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTD 130

Query: 61  SGTSIVGSTTPDAL--------------PYGIEREIIIMKLLNHPNVLRLYDVWETNTDL 106
           + +S   STT                  PYGIEREI+IMKL++H NV+ L++VWE   DL
Sbjct: 131 NCSSNDNSTTLTTNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDL 190

Query: 107 YLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDH 166
           +LVLEY + GELF+ LV +G LPE EA+ +F+QII GV++CH+  I HRDLKPENLLLD 
Sbjct: 191 FLVLEYVDGGELFDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDK 250

Query: 167 KYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALL 225
           K   IKIADFGMAALE   KLLETSCGSPHYA+PEIV G PY G  SDVWSCG+ILFALL
Sbjct: 251 KNKIIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALL 310

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
           TG LPF+  D NIR LLLKVQ G F +P +  IS EAQDLI KIL V+P +RIK  DILK
Sbjct: 311 TGHLPFN--DDNIRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILK 366

Query: 286 HPLLQKYPSIRDSK-------SIRGLPREDTYLTPLS---ESNSSIDATILQNLVILWHG 335
           HPL+ KY      K       S   L  E   LTP +    S + ID +IL+NL ILWHG
Sbjct: 367 HPLITKYRQFFKVKFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHG 425

Query: 336 RDPEGIKEKLREPGANAEKTLYALLYRFK 364
              E I  KL +   +AEK  Y+LL+++K
Sbjct: 426 TSREIIIAKLLQYPMSAEKIFYSLLWQYK 454

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  385 bits (989), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/380 (52%), Positives = 257/380 (67%), Gaps = 33/380 (8%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPD 72
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K  +F   N +   +   ++ D
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 73  ALP--------------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
             P              YGIEREI+IMKL++HPNV+ LY+VWE  ++L+LVLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 119 FNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGM 177
           F+ LV RG L E EA+ +F+QII GVSYCH+  I HRDLKPENLLLD K N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN 237
           AALE   KLL TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 238 IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIR- 296
           I+ LLLKVQ G+F+MP +  IS EA+DLI +IL VDPE+RI+  DIL HPL++KY   + 
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYEDNKT 382

Query: 297 DSKSIRGLPREDTYLTPLS------------ESNSSIDATILQNLVILWHGRDPEGIKEK 344
           DS ++    +     + L             ++ + ID +IL+NL ILWHG   E I  K
Sbjct: 383 DSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELIISK 442

Query: 345 LREPGANAEKTLYALLYRFK 364
           L +   + EK  Y+LL ++K
Sbjct: 443 LLQTPMSEEKLFYSLLLQYK 462

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  382 bits (982), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/398 (50%), Positives = 251/398 (63%), Gaps = 51/398 (12%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK--------------------- 52
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K                     
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 53  -------AVFNTGNVSGTSI-VGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNT 104
                           GT+   G +   A PYGIEREI+IMKL++H N+L LY+VWE  +
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
           +LYLVLEY + GELF+ LV RG L E EA+ +F+QI+ GVSYCH+  I HRDLKPENLLL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 165 DHK-YNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFA 223
           D K  +IKIADFGMAALE   KLL+TSCGSPHYA+PEIV G PY G  SDVWSCG+ILFA
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283
           LLTG LPF+  D NI+ LLLKVQ G+F MP +  +S EA+DL+ KIL V+P +RI T +I
Sbjct: 336 LLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 284 LKHPLLQKY----------PSIRDSKSIRGLPREDTYLTPLSESN-------SSIDATIL 326
           L HPLL KY           S+      +G    D ++   S SN         ID +I+
Sbjct: 392 LNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVLDASNSNIVDLRSREDIDDSIV 451

Query: 327 QNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
            NL ILWHG   E I  KL +P  + EK  Y+LL  +K
Sbjct: 452 SNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  381 bits (978), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/407 (50%), Positives = 264/407 (64%), Gaps = 41/407 (10%)

Query: 2   AINGNSIPAIKD---NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT- 57
           +IN N+  + K    +T+GPWKLG+TLG GS+G+V+LA+N   G  AA+K++ K  +N  
Sbjct: 73  SINSNNTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRR 132

Query: 58  ----------GNVSGTSIVGST---------TPDAL-PYGIEREIIIMKLLNHPNVLRLY 97
                     G  SGT    S+         T  AL PYGIEREI+IMKL++HPNV+ L 
Sbjct: 133 MRDQKMKTAGGVSSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLL 192

Query: 98  DVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDL 157
           +VWE  ++LYLVLEY + GELF+ LV +G L E EA+ +F QII GVSYCH+  I HRDL
Sbjct: 193 EVWENKSELYLVLEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDL 252

Query: 158 KPENLLLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWS 216
           KPENLLLD K   IKIADFGMAALE   KLLETSCGSPHYA+PEIV G PY G  SDVWS
Sbjct: 253 KPENLLLDKKNKVIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWS 312

Query: 217 CGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPER 276
           CG+ILFALLTG LPF+  D NI+ LLLKVQ G F++P    ++ +A+DLI +IL  +PE+
Sbjct: 313 CGIILFALLTGHLPFN--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEK 368

Query: 277 RIKTRDILKHPLLQKY----PSIRDSKSI-RGLPRED----TYLTPLS---ESNSSIDAT 324
           R+   +IL HPL++KY      IR    + RG    D     Y TP +    S   ID +
Sbjct: 369 RLTINEILNHPLIKKYRNPPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQS 428

Query: 325 ILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKEL 371
           IL++L ILWHG   + + E+L   GA  EK  Y+LL+++K    K +
Sbjct: 429 ILKSLQILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKLKHSKPI 475

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  381 bits (978), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/402 (49%), Positives = 257/402 (63%), Gaps = 57/402 (14%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK--------------------- 52
           +T+GPWKLG+TLG GS+G+V+LA+N  TG+ AA+K++ K                     
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 53  ----AVFNTGNVSGTSIVGSTTPD----ALPYGIEREIIIMKLLNHPNVLRLYDVWETNT 104
               ++ NT N        +T  +      PYGIEREI+IMKLL+HPNV+ LY+VWE N 
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
           +LYLVLEY + GELF+ LV +G L E EA+ +F+QII G+SYCH+  I HRDLKPENLLL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 165 DHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFA 223
           D K   IKIADFGMAAL+   +LL+TSCGSPHYA+PEIV G  Y G  SD+WSCG+ILFA
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 224 LLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283
           LLTG LPF+  D NI+ LL+KVQ G ++MPS   IS+EA++LI +IL VDP +RI T  I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQI 384

Query: 284 LKHPLLQKY---------------------PSIRDSKSIRGLPREDTYLTPLSESNSSID 322
           L HPLL KY                      S  D   +  +P ++T +  L  + S ID
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIP-QNTEIVKL-RARSDID 442

Query: 323 ATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
            +IL+NL ILWHG   + I  KL +   + EK +Y+LL+++K
Sbjct: 443 ESILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  353 bits (907), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/426 (45%), Positives = 256/426 (60%), Gaps = 81/426 (19%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAV---FNTGNVSGT--------- 63
           IGPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K+    FN    +G          
Sbjct: 93  IGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYDNK 152

Query: 64  --------------------------SIV----GSTTPD----------ALPYGIEREII 83
                                     SI+    GS   D          +  YGIEREI+
Sbjct: 153 PHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIEREIV 212

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG 143
           IMKL++HPNV+ LY+VWE   +LYLVLEY + GELF+ LV +G L E EA+R+F+QII G
Sbjct: 213 IMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQIIRG 272

Query: 144 VSYCHALGIVHRDLKPENLLLDHKYN-IKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
           V YCH+  I HRDLKPENLLLD K   IKIADFGMAAL+    LL+TSCGSPHYA+PEIV
Sbjct: 273 VQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPEIV 332

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREA 262
            G  Y G  SDVWSCG+ILFALLTG LPF+  D +I+ LL+KVQ G ++MP  + +S++A
Sbjct: 333 MGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP--NYLSKDA 388

Query: 263 QDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPRE-------------DT 309
           +DLI +IL V+P+ R+ T  IL+HPL+ KY +    K    L ++             +T
Sbjct: 389 KDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLMRGKSNT 448

Query: 310 YLTPLS-----------ESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYA 358
            L  L             S + ID +IL+NL ILW+G   E +  KL +   + EK +Y+
Sbjct: 449 DLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKLIYS 508

Query: 359 LLYRFK 364
           LL+++K
Sbjct: 509 LLWQYK 514

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  338 bits (866), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 226/367 (61%), Gaps = 18/367 (4%)

Query: 205 IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQD 264
           +PY GF SDVWSCG+ILFALLTGRLPFDEEDGNIR LLLKVQ G+FEMP  DEIS EAQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 265 LIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDAT 324
           LI KILTVDP  RIK+R+ILKHPLLQKYPSI+DSKSIR LPREDTYL PL   N SID +
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNGSIDES 129

Query: 325 ILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQKELIXXXXXXXXX--- 381
           I+ NLV+LWHGRD   I  +L+EPGAN EKT YALL+RFK D+ +E +            
Sbjct: 130 IINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQRRSQASHIS 189

Query: 382 ---XXXXXXXXXXXXXXTTPQRRRNRESLISVTSSRKKPIX-XXXXXXXXXXXXXXXXXX 437
                             TP +++N+  +IS +SS K+P+                    
Sbjct: 190 PKRSNMRNSVSRRSITNVTP-KKKNKAPVISASSSHKRPVSFNRLSFNNGSNTAHTPPTS 248

Query: 438 XXXXXXXXXXXXXXXXTIVN-QSSPTPASRNKRASVINVEKNQKRASI-------FSTTX 489
                            ++N  +SPTP   +KR+S+ +++ +     +        S   
Sbjct: 249 ASKRASVNLSSNKRISALINPNNSPTPV--HKRSSMRDLDASAPPIPMDMLKDYNKSAPK 306

Query: 490 XXXXXXXXXXXXXLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFATLIDE 549
                         +P  KR S+TTKL++TYAK+++D+DWEYIEKET+RTS++FATL DE
Sbjct: 307 VSRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEKETRRTSADFATLCDE 366

Query: 550 IFEYEKY 556
           IFE+EKY
Sbjct: 367 IFEHEKY 373

 Score =  212 bits (540), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 142/308 (46%), Positives = 193/308 (62%), Gaps = 39/308 (12%)

Query: 634 NIRSISAPME-----NEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSSPTEEV 688
           ++RS+SAP E     ++  +  +L+ DI  +L RR FSL+TRP SRLDPGI ++S  E+ 
Sbjct: 455 HVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGI-YTSEEEDF 513

Query: 689 SPVEPKRTENERLTTEKKILETIRRSKFLGSSFNIDKEL-KLSKMEYPSIIAPQRLSEER 747
                 +     L+TEK ILETIRRSKFLGSSF+I+KEL +  +++       +R  EER
Sbjct: 514 G----SKNHGADLSTEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEER 569

Query: 748 VVSDSN------DGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKS 801
           V S++       +GYES  LPK   G +      A++ P      RKISE+ VPQFTR+S
Sbjct: 570 VASNATTANVVGNGYESQTLPKRKMGSAM----EASSEP------RKISEVEVPQFTRRS 619

Query: 802 RHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETV 861
           RHF+ SNKRLSVLSMYSTK SFTNL D LK G  DV   Q+      +   ++EF+FE+V
Sbjct: 620 RHFTASNKRLSVLSMYSTKTSFTNLADHLK-GKADVQLIQTSPPSASKMDQEAEFMFESV 678

Query: 862 NEEAEYTGNSSNDERLYDVGDSTIKD----KSALKLNFADRFN--GSNEAKQTDN---LH 912
           ++E + T ++S D RLY+V ++  KD    K A+KLNFADRFN   S  ++ TD+   + 
Sbjct: 679 DKEGKETADTSADSRLYEVAET--KDAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAAIK 736

Query: 913 LPILPPLN 920
           LP LPPL+
Sbjct: 737 LPALPPLD 744

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/93 (50%), Positives = 60/93 (64%)

Query: 1048 ISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPRGK 1107
            I   Q+FN L KLL  W  YGLK++ + P+   + GKLSSDNI SLRSTLF + +  RG+
Sbjct: 868  IEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGE 927

Query: 1108 MSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVL 1140
             S V+F K SGS K  KKLV E+E +L  +  L
Sbjct: 928  GSYVEFTKKSGSNKTFKKLVKEIEKILESKKAL 960

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  327 bits (838), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 212/298 (71%), Gaps = 13/298 (4%)

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
           YGIEREI+IMKL++HPNV+ LY+VWE  ++LYL+LEY + GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLL-LDHKYNIKIADFGMAALETEGKLLETSCGSP 194
           +F+QII GVSYCH+  I HRDLKPENLL    K +IKIADFGMAALE   KLL+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPS 254
           HYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMPK 374

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY-PSIRDSKSIRGLPREDTYL-- 311
           +  +S EA+DLI +IL V P +R+ T +IL HPL+ KY  S +    ++G    D +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 312 --TPLS---ESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFK 364
             +P +    S   ID +IL+NL ILWHG   + I  KL +   + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/39 (61%), Positives = 34/39 (87%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK 52
           +T+GPWKLG+TLG GS+G+V+LA+N  TGQ AA+K++ K
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  237 bits (605), Expect = 5e-72,   Method: Composition-based stats.
 Identities = 107/120 (89%), Positives = 117/120 (97%)

Query: 85  MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGV 144
           MKLL+H NVLRLYDVWETN++LY+VLEY EKGELFNLLVERGPLPE+EA+RFFRQIIIG+
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 145 SYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSG 204
           SYCHALGIVHRDLKPENLLLDHK+NIKIADFGMAALE++ KLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  252 bits (644), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 135/294 (45%), Positives = 193/294 (65%), Gaps = 25/294 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V +  ++ G             
Sbjct: 27  IGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR------------ 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA+  ELF+ +V+R  + E+E  R
Sbjct: 75  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRR 131

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+G  L+TSCGSP+
Sbjct: 132 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPN 191

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ LL  RLPFD+E  +I TL   +  G + +P  
Sbjct: 192 YAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP-- 247

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPL----LQKY--PSIRDSKSIRG 303
           + +S  A  LI+K+L V+P  RI   DI++ P     L +Y  PS +D+  I G
Sbjct: 248 NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFKVDLPEYLVPSEKDAIKING 301

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  250 bits (638), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/281 (45%), Positives = 186/281 (66%), Gaps = 20/281 (7%)

Query: 6   NSIPAIKDNT-IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTS 64
           N + ++ D + +G +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G  
Sbjct: 25  NKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR- 83

Query: 65  IVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
                        IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+
Sbjct: 84  -------------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQ 129

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG 184
           R  + E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G
Sbjct: 130 RNKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDG 189

Query: 185 KLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
             L+TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   
Sbjct: 190 NFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKN 247

Query: 245 VQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
           +  G + +P    +S  A DLI+++L V+P  RI   +I++
Sbjct: 248 ISNGVYTLPK--FLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  248 bits (632), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 181/270 (67%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + STGQ+ A+K+I+K V    ++ G             
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR------------ 79

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  +PE EA R
Sbjct: 80  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARR 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 137 FFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 197 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTIP-- 252

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
           + +S+ A  LI+K+L V+P  RI   +I++
Sbjct: 253 NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  247 bits (631), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 126/270 (46%), Positives = 181/270 (67%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR------------ 90

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 91  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARR 147

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 148 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 207

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 208 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 264

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S+ A  LI+K+L V+P  RI  ++I++
Sbjct: 265 -FLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 126/277 (45%), Positives = 186/277 (67%), Gaps = 20/277 (7%)

Query: 10  AIKDNT-IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS 68
           A+ D + IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I++ V +  ++ G      
Sbjct: 32  ALSDGSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR----- 86

Query: 69  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    IEREI  ++LL HP+++RLYDV ++  ++ +++EYA   ELF+ +V+R  +
Sbjct: 87  ---------IEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKM 136

Query: 129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            E+EA +FF+QII  V YCH   IVHRDLKPENLLLD  YN+KI DFG++ + T+G  L+
Sbjct: 137 SENEARKFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLK 196

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G
Sbjct: 197 TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNG 254

Query: 249 EFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
            + +P  + +S  A  LI+K+L V+P  RI   +I++
Sbjct: 255 IYTLP--NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  248 bits (633), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/277 (45%), Positives = 184/277 (66%), Gaps = 20/277 (7%)

Query: 10  AIKDNT-IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS 68
            +KD + IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I++ V    ++ G      
Sbjct: 34  GLKDGSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR----- 88

Query: 69  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    IEREI  ++LL HP++++LYDV ++  ++ +V+EYA+  ELF+ +V+R  +
Sbjct: 89  ---------IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKM 138

Query: 129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+
Sbjct: 139 SEQEARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLK 198

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G
Sbjct: 199 TSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNG 256

Query: 249 EFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
            + +P    +S  A  LI+K+L V+P  RI   +I++
Sbjct: 257 IYTLPR--FLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  247 bits (631), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 99

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  246 bits (629), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 99

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 100 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 156

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 157 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 216

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 217 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 273

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 274 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  246 bits (629), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 51  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 98

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 99  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEARR 155

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 156 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 215

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 216 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSLPK- 272

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 273 -FLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  246 bits (627), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 53  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR------------ 100

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 101 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARR 157

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 158 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 217

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 218 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 274

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 275 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  244 bits (622), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 183/283 (64%), Gaps = 20/283 (7%)

Query: 9   PAIKDNT-IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVG 67
           P + D + IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V    ++ G     
Sbjct: 34  PRLSDGSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR---- 89

Query: 68  STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGP 127
                     IEREI  ++LL HP++++LYDV ++  ++ +V+E+A   ELF+ +++R  
Sbjct: 90  ----------IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDK 138

Query: 128 LPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLL 187
           + E EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L
Sbjct: 139 MSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFL 198

Query: 188 ETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQK 247
           +TSCGSP+YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  
Sbjct: 199 KTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISN 256

Query: 248 GEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           G + +P    +S  A +LI+K+L V+P  RI   +I K    Q
Sbjct: 257 GVYILPK--FLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  243 bits (619), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 180/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q  A+K+I+K +    ++ G             
Sbjct: 39  IGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR------------ 86

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  D+ +V+EYA+  ELF+ +V+R  + E+EA +
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARK 143

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD + N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLPK- 260

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A +LI+++L V+P  RI   +I++
Sbjct: 261 -FLSPGAANLIKRMLIVNPLNRISMNEIME 289

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  242 bits (618), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 181/274 (66%), Gaps = 19/274 (6%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTP 71
           +D  IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G         
Sbjct: 24  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR-------- 75

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEH 131
                 IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+
Sbjct: 76  ------IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSEN 128

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSC 191
           EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L TSC
Sbjct: 129 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSC 188

Query: 192 GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 189 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYT 246

Query: 252 MPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
           +P    +S  A +LI+++L V+P  RI   +I++
Sbjct: 247 LPK--FLSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  243 bits (620), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 180/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K +    ++ G             
Sbjct: 46  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR------------ 93

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+E+A   ELF+ +++R  + E+EA R
Sbjct: 94  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARR 150

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 151 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPN 210

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 211 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILPK- 267

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 268 -FLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  242 bits (617), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 181/270 (67%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + STGQ+ A+K+I+K V    ++ G             
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR------------ 83

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 84  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 140

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 141 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 200

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 201 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 257

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S+ A +LI+++L V+P  RI   +I++
Sbjct: 258 -FLSQGAANLIKRMLIVNPLNRITIHEIME 286

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  241 bits (615), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 125/274 (45%), Positives = 181/274 (66%), Gaps = 19/274 (6%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTP 71
           +D  IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G         
Sbjct: 23  QDQRIGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR-------- 74

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEH 131
                 IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E 
Sbjct: 75  ------IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSER 127

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSC 191
           EA RFF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSC
Sbjct: 128 EARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSC 187

Query: 192 GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFE 251
           GSP+YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + 
Sbjct: 188 GSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYT 245

Query: 252 MPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
           +P    +S  A +LI+++L V+P  RI   +I++
Sbjct: 246 LPK--FLSPGAANLIKRMLIVNPLNRITIHEIME 277

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  243 bits (620), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 180/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 58  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR------------ 105

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 106 --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARR 162

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 163 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 222

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 223 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIPK- 279

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S+ A  LI+++L V+P  RI   +I++
Sbjct: 280 -FLSQGASSLIKRMLIVNPLNRISISEIMQ 308

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  242 bits (617), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/269 (45%), Positives = 177/269 (65%), Gaps = 19/269 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +T Q+ A+K+I+K V    ++ G             
Sbjct: 65  IGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR------------ 112

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             +EREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF  +V+R  + E+EA +
Sbjct: 113 --VEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARK 169

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 170 FFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPN 229

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P  
Sbjct: 230 YAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLPK- 286

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDIL 284
             +S  A +LI+K+L V+P  RI   +I+
Sbjct: 287 -FLSEGAANLIKKMLIVNPLNRISMTEII 314

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  241 bits (614), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 178/270 (65%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 39  IGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR------------ 86

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 87  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARR 143

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 144 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 203

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 204 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 260

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A  LI+++L V+P  RI   +I++
Sbjct: 261 -FLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  239 bits (610), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 124/270 (45%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR------------ 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 77  --IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARR 133

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 134 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 193

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 194 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 250

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A +LI+++L V+P  RI   +I++
Sbjct: 251 -FLSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  239 bits (610), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 125/270 (46%), Positives = 179/270 (66%), Gaps = 19/270 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + ST Q+ A+K+I+K V    ++ G             
Sbjct: 40  IGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR------------ 87

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E+EA R
Sbjct: 88  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARR 144

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 145 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 204

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 205 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIPK- 261

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILK 285
             +S  A +LI+K+L V+P  RI   +I++
Sbjct: 262 -FLSPGAANLIKKMLIVNPLNRITIHEIME 290

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  239 bits (610), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 132/298 (44%), Positives = 186/298 (62%), Gaps = 33/298 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +++ +TLG GS GKV+LA + +TGQ+ A+K+I+K V    ++ G             
Sbjct: 48  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR------------ 95

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             IEREI  ++LL HP++++LYDV ++  ++ +V+EYA   ELF+ +V+R  + E EA R
Sbjct: 96  --IEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARR 152

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
           FF+QII  V YCH   IVHRDLKPENLLLD   N+KIADFG++ + T+G  L+TSCGSP+
Sbjct: 153 FFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPN 212

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           YAAPE++SG  Y G   DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P  
Sbjct: 213 YAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLPK- 269

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313
             +S  A  LI+++L V+P  RI   +I++           D     GLP   TYL P
Sbjct: 270 -FLSEGAAGLIKRMLIVNPLNRISILEIMQ-----------DDWFKVGLP---TYLIP 312

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  206 bits (525), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/319 (37%), Positives = 176/319 (55%), Gaps = 25/319 (7%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTP 71
           K  + GP+ +G TLG G  GKV++      G +    V  +       +   SI    + 
Sbjct: 35  KCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKL--IKRDSISNDKSK 92

Query: 72  DALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEH 131
           +     I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +R  L EH
Sbjct: 93  EV---KIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKEH 149

Query: 132 EAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETS 190
            A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      ++ +L+ TS
Sbjct: 150 VACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTTS 209

Query: 191 CGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLK 244
           CGSP YAAPE+V S  PYQG  +D+WSCG+ILFA+L G LP+D++  N     I  L   
Sbjct: 210 CGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYY 269

Query: 245 VQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPS---------- 294
           +     + P  + I+   +DL+R+IL  DP RR+  R+I  H  L+K+            
Sbjct: 270 ITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWD 327

Query: 295 -IRDSKSIRGLPREDTYLT 312
            I  SK+I  LP+ + + +
Sbjct: 328 RISQSKNITRLPKHNKHYS 346

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  204 bits (519), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 186/345 (53%), Gaps = 53/345 (15%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG------QEAAVKVISKAVFNTGNVSGTSI 65
           K  T GP+ +G TLG G  GKV+L  + ++       ++ A+K+I +             
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRR------------- 79

Query: 66  VGSTTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                 D +P   E+EI I      +K LNHPN++RL +V + +  + +VLEYA  GE +
Sbjct: 80  ------DTIPKNSEKEIKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFY 133

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             + ++  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG   
Sbjct: 134 KYIQKKRRLKEGPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVN 193

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               E +L++TSCGSP YAAPE +V+  PY+   +DVWSCGVIL+A+L G LP+D++   
Sbjct: 194 EFLPENELMKTSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPEN 253

Query: 235 -DG-NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH------ 286
            DG +I  L   + +   + P  D I+   +DL+R+IL  DP+RRI     LKH      
Sbjct: 254 PDGDDIGKLYRYITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

Query: 287 -PLLQKYPSIRDSKS-----IRGLP-REDTYLTPLSESNSSIDAT 324
            P L   P   D  S     +R  P R DT  +    SN S+ +T
Sbjct: 312 MPFLTVMPEEWDHVSKNEGLLRQPPQRRDTAASSRPRSNCSVSST 356

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  204 bits (518), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 170/299 (56%), Gaps = 39/299 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG-----QEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ +G TLG G  GKV+L  + +TG     ++ A+K+I +              
Sbjct: 37  KQVTFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRR-------------- 82

Query: 67  GSTTPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                D +P        I REI  +K L HPN++RL +V + +  + +VLEYA  GE + 
Sbjct: 83  -----DTVPKNSDKEVKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYR 137

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-A 179
            + ++  L EH A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG    
Sbjct: 138 YIQKKRRLKEHAACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNE 197

Query: 180 LETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN- 237
              + +L++TSCGSP YAAPE +V+  PY+   +D+WSCGVI++A+L G LP+D++  N 
Sbjct: 198 FNHKNELMKTSCGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENP 257

Query: 238 ----IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
               I  L   + K   + P  + I+   +DL+R+IL  +P++R+  R + +H  LQ +
Sbjct: 258 EGDDIAKLYHYITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  202 bits (513), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 114/288 (39%), Positives = 166/288 (57%), Gaps = 29/288 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQ-----EAAVKVISK-AVFNTGNVSGTSIVGS 68
           T GP+ +G TLG G  GKV+L    +T +     + A+K+I + A+ N            
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKETK----- 90

Query: 69  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                    I REI  +K L HPN+++L +V + +  + +VLE+A  GE +  + ++  L
Sbjct: 91  ---------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRL 141

Query: 129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLL 187
            E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L+
Sbjct: 142 KETPACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELM 201

Query: 188 ETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG-NIRTL 241
           +TSCGSP YAAPE +V+  PY+   +DVWSCG+IL+A+L G LP+D++    DG +I  L
Sbjct: 202 KTSCGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKL 261

Query: 242 LLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            L + K   + P  + I+   +DL+RKIL  DP +R+  R+I KH  L
Sbjct: 262 YLYITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  201 bits (511), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 169/298 (56%), Gaps = 32/298 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLA------RNGSTG----QEAAVKVISKAVFNTGNVS 61
           K  T GP+ +G TLG G  GKV+L        + S+G    ++ A+K+I +   +  +  
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKDSSK 100

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 101 EIKIY-------------REINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKY 147

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-L 180
           +  +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG  +  
Sbjct: 148 IQRKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEF 207

Query: 181 ETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            + G+L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++ GN  
Sbjct: 208 YSHGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPD 267

Query: 238 ---IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
              I  L   + +   + P  D I+   +DL+R+IL  DP RRI  + I KH  L+ +
Sbjct: 268 GDDISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  199 bits (507), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/300 (39%), Positives = 168/300 (56%), Gaps = 26/300 (8%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS--- 68
           K  T GP+ +G TLG G  GKV+LA + S  Q+           N GN   T  V     
Sbjct: 41  KHVTFGPYVIGATLGEGEFGKVKLAWSKSAYQQC-----DNTEGNAGNKPMTFKVPKQVA 95

Query: 69  ---------TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                    T   +    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +
Sbjct: 96  IKLIKRDFITKDPSKETKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFY 155

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             +  +  L E+ A R F Q+I  V Y H+ G+VHRDLK ENLLLD++ N+ I DFG   
Sbjct: 156 KFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVN 215

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               +  +++TSCGSP YAAPE +VS  PY    +D WSCG+ILFA+L G LP+D++   
Sbjct: 216 EFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKN 275

Query: 235 -DG-NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
            DG +I  L   +     + P  + I+   +DL+RKIL +DP++RI  R I KHP L+ +
Sbjct: 276 PDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESH 333

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  201 bits (512), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 163/294 (55%), Gaps = 32/294 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLA----------RNGSTGQEAAVKVISKAVFNTGNVSGTSI 65
            GP+ +G T+G G  GKV+L            N    ++ A+K+I +   +  +     I
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKDSSKELKI 125

Query: 66  VGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
                         REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  +
Sbjct: 126 Y-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRK 172

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      +  
Sbjct: 173 KRLKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHN 232

Query: 185 KLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L++TSCGSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D++ GN     I
Sbjct: 233 ELMKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDI 292

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             L   + K   + P  D I+   +DL+RKIL  DP RRI  + I KH  L+ +
Sbjct: 293 SRLYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  199 bits (507), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/293 (39%), Positives = 167/293 (56%), Gaps = 39/293 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG-----QEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ LG TLG G  G+V+L  + +T      ++ A+K+I +              
Sbjct: 37  KHVTFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRR-------------- 82

Query: 67  GSTTPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                D +P        I REI  +K L+HPN+++L +V + +  + +VLEYA  GE + 
Sbjct: 83  -----DTIPKNSDKEIKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYK 137

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-A 179
            + ++  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG    
Sbjct: 138 YIQKKRRLKEAVACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNE 197

Query: 180 LETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE---- 234
                +L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++    
Sbjct: 198 FFAHSELMKTSCGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNP 257

Query: 235 DGN-IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
           DGN I  L   + +   + P  + I+   +DL+R+IL  DP+RRI  R I KH
Sbjct: 258 DGNDIGKLYQYITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKH 308

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  200 bits (509), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 169/300 (56%), Gaps = 40/300 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG------QEAAVKVISKAVFNTGNVSGTSI 65
           K  T GP+ +G TLG G  GKV++  + ++       ++ A+K+I +             
Sbjct: 33  KHVTFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRR------------- 79

Query: 66  VGSTTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                 D +P   E+E+ I      +K LNHPN++RL +V + +  + +VLEYA  GE +
Sbjct: 80  ------DTIPKNSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFY 133

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA- 178
             + ++  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG   
Sbjct: 134 KYIQKKRRLKESAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVN 193

Query: 179 ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--- 234
               E +L++TSCGSP YAAPE +V+  PY+   +D+WSCGVI++A+L G LP+D++   
Sbjct: 194 EFLPENELMKTSCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPEN 253

Query: 235 -DG-NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
            DG +I  L   + +   + P  D I+   +DL+R IL  DP++RI     L H  LQ +
Sbjct: 254 PDGDDIGKLYRYITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  200 bits (508), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 174/303 (57%), Gaps = 40/303 (13%)

Query: 9   PAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTG------QEAAVKVISKAVFNTGNVSG 62
           P  +  T GP+ +G TLG G  GKV+L  + +        ++ A+K+I +          
Sbjct: 29  PRKRHVTFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRR---------- 78

Query: 63  TSIVGSTTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
                    D++P   E+E+ I      +K L+HPN+++L +V + +  + +VLEYA  G
Sbjct: 79  ---------DSIPKNSEKEVKIYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGG 129

Query: 117 ELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           E +  +  +  L E  A R F Q++ GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG
Sbjct: 130 EFYKYIQRKRRLKEAIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFG 189

Query: 177 MA-ALETEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
                 +  +L++TSCGSP YAAPE +VS  PY+   SDVWSCGVIL+A+L G LP+D++
Sbjct: 190 FVNEFVSHNELMKTSCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDD 249

Query: 235 ----DGN-IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
               DGN I  L   + +   + P  + I+  ++DL+R+IL  DP++RI  R I KH  L
Sbjct: 250 PKNPDGNDIVRLYYYITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWL 307

Query: 290 QKY 292
           + +
Sbjct: 308 KPH 310

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  197 bits (501), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 118/295 (40%), Positives = 162/295 (54%), Gaps = 30/295 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQL--------ARNGSTGQEAAVKVISKAVFNTGNVSGTSIVG 67
            G + LG TLG G  GKV+L        A   S  ++ A+K+I +     G+     I  
Sbjct: 43  FGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEIKIY- 101

Query: 68  STTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGP 127
                       REI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  +  
Sbjct: 102 ------------REINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRR 149

Query: 128 LPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKL 186
           L E  A + F Q+I GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L
Sbjct: 150 LKEPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNEL 209

Query: 187 LETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRT 240
           ++ SCGSP YAAPE+V S  PY+    D+WSCG+IL+A+L G LP+D++  N     I  
Sbjct: 210 MKRSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGK 269

Query: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           L   + K   + P+   IS  A+DLIRKILT +P RRI    I KH  L+ + S 
Sbjct: 270 LYQYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  199 bits (506), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 111/287 (38%), Positives = 166/287 (57%), Gaps = 20/287 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA--RNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPD 72
           T GP+ +G TLG G  GKV+L   RN ++ QE + +V  K +          IV ++  +
Sbjct: 40  TFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLI------RRDKIVKNSEKE 93

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHE 132
                I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  +  L E  
Sbjct: 94  I---KIFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETA 150

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSC 191
             R F Q++ GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG       +  L++TSC
Sbjct: 151 GCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSC 210

Query: 192 GSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLKV 245
           GSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D++  N     I  L   +
Sbjct: 211 GSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFI 270

Query: 246 QKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
            +   + P  + IS   +DL+R++L  DP +R+  R I +H  L+ +
Sbjct: 271 TRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  198 bits (503), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/298 (39%), Positives = 165/298 (55%), Gaps = 32/298 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAR-----NGSTG-----QEAAVKVISKAVFNTGNVSGTS 64
           T GP+ LG TLG G  GKV+L       N ST      ++ AVK+I +   +        
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 65  IVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 97  IY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 184 GKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN----- 237
            +L++TSCGSP YAAPE +VS  PY+   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSD 263

Query: 238 IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           I  L   +     + P  D I    +DL+R+IL  DP+RRI  + I KH  L+ + S 
Sbjct: 264 IGRLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  193 bits (491), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 164/296 (55%), Gaps = 30/296 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLAR-------NGST-GQEAAVKVISKAVFNTGNVSGT 63
           K  T GP+ LG T+G G  GKV+          NG T G++ A+K+I +           
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQEL 107

Query: 64  SIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLV 123
            +              REI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L 
Sbjct: 108 KVY-------------REINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQ 154

Query: 124 ERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A   F Q+I GV+Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T
Sbjct: 155 RKKRLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEIST 214

Query: 183 EGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG- 236
             KL++T CGSP YAAPE+V S  PY    +D+WS GVIL+A+L G LP+D++    DG 
Sbjct: 215 NNKLMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGS 274

Query: 237 NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
           NI  L   + K   + P  D I   A+DLIRKIL + P+ R+    + +H  L+ +
Sbjct: 275 NIMRLYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  194 bits (492), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/287 (39%), Positives = 163/287 (56%), Gaps = 16/287 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA--RNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPD 72
           T GP+ +G TLG G  GKV+L   R  STG E    V  +       +   +IV ++  +
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKL--IRRDTIVKNSEKE 97

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHE 132
                I REI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  +  L E  
Sbjct: 98  I---KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEST 154

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLETSC 191
           A R F Q+I GV+Y H+  +VHRDLK ENLLLD   N+ I DFG       + + ++TSC
Sbjct: 155 ACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSC 214

Query: 192 GSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLLLKV 245
           GSP YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+D++  N     I  L   +
Sbjct: 215 GSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYI 274

Query: 246 QKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
            +   + P  + I+   +DL+RKIL  DP +R+  + I +H  L+ +
Sbjct: 275 TRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  194 bits (494), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 116/293 (39%), Positives = 167/293 (56%), Gaps = 27/293 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA---RNGST--GQEAAVKVISKAVFNTGNVSGTSIVGST 69
           T GP+ +G TLG G  GKV+L    +N ST   ++ A+K+I +           SI+   
Sbjct: 30  TFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRR----------DSILQDR 79

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129
             +     I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + ++  L 
Sbjct: 80  EKEI---KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLK 136

Query: 130 EHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGKLLE 188
           E  A + F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG         +L++
Sbjct: 137 EPIACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMK 196

Query: 189 TSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLL 242
           TSCGSP YAAPE +V+  PY+   +DVWSCG+ILFA+L G LP+D++  N     I  L 
Sbjct: 197 TSCGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLY 256

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
             +     + PS   IS   +DL+RKIL  +P +R+  R+I  H  L+ + S 
Sbjct: 257 NYITTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 122/350 (34%), Positives = 195/350 (55%), Gaps = 33/350 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVS----GTSIVGS 68
           ++G W   ET+G GS GKV+LARN  T +  A+K++++A  +F T         T+ +  
Sbjct: 93  SLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIM 152

Query: 69  TTPDALPYG--IEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
              D L     +E+EI           + ++L HP++ RL++++  +   Y++ EY   G
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGG 212

Query: 117 ELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           +L + +++ G L E  A  F RQI+  + Y HA  IVHRDLK EN+++    NIKI DFG
Sbjct: 213 QLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFG 272

Query: 177 MAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG 236
           ++ L  + K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 273 LSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 332

Query: 237 NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK-YPSI 295
           N+  L  K+++G    P    +S E   L+  +L VDP +R     ++KH  + K Y SI
Sbjct: 333 NV--LHEKIKQGRVFYPQ--FLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSI 388

Query: 296 RDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVILWHGRDPEGIKEKL 345
            D+     LP+      PL  ++ SID  +++ +  L    D E  ++KL
Sbjct: 389 PDAH----LPKR----VPL--TSESIDMKVIKEMKHLEFIEDIEQTEKKL 428

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  197 bits (500), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 100/289 (34%), Positives = 167/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVSGTSIVGSTTPD 72
           ++G W   ET+G GS GKV+LA++  TG+  A+K++++A   F     +    V +    
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 73  ALPYGIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++  HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R +   + Y HA  IVHRDLK EN+++ +   IKI DFG++ +  
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYD 283

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 284 TRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 341

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K+++G+ E P    +S E   L+ K+L VDP RR   + +++HP + K
Sbjct: 342 EKIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 117/298 (39%), Positives = 163/298 (54%), Gaps = 32/298 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG----------QEAAVKVISKAVFNTGNVS 61
           K  T GP+ LG TLG G  GKV+L    S            ++ AVK+I +   +     
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKK 93

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 94  EVKIY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRY 140

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-AL 180
           + +R  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG     
Sbjct: 141 IQKRRRLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEF 200

Query: 181 ETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            +  +L++TSCGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N  
Sbjct: 201 CSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPE 260

Query: 238 ---IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
              I  L   +     + P  D I    +DL+R+IL  DP+RRI  + I KH  L+ +
Sbjct: 261 GSDIGRLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  192 bits (488), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 110/290 (37%), Positives = 161/290 (55%), Gaps = 31/290 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGST---------GQEAAVKVISKAVFNTGNVSGTSIV 66
            GP+ +G TLG G  GKV++  + ++          ++ A+K+I +     G+     I 
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIKKGSEKEMKIF 94

Query: 67  GSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERG 126
                        REI  +K L HPN++RL +V + +  + +VLEYA  GE +  +  + 
Sbjct: 95  -------------REINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKR 141

Query: 127 PLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEGK 185
            L E  A R F Q+I GVSY H+ GIVHRDLK ENLLLD   N+ I DFG       + +
Sbjct: 142 RLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNE 201

Query: 186 LLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IR 239
           L++TSCGSP YAAPE+V +  PY+   +D+WSCG+IL+ +L G LP+D++  N     I 
Sbjct: 202 LMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIV 261

Query: 240 TLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            L   + K   + P  + I+   +DL+R IL  +P RR+ +R I KH  L
Sbjct: 262 RLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  194 bits (493), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 150/282 (53%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T Q        K V  TG+ S  ++V         
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQ--------KVVLKTGDKSDPNVV--------- 81

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  ++P + +LY+V  T T +++ LEY    EL++ L+ +  LP  E   
Sbjct: 82  ----REVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAE 137

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 138 LFAQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTV 197

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++   PY GF  D+WS GVIL+ LL G LPFDE+D      LL  QK   + P  
Sbjct: 198 YMAPEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVI 252

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           DE     EAQ+LI ++L+ DP  R  T  IL HP LQ Y ++
Sbjct: 253 DERITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  194 bits (492), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 167/298 (56%), Gaps = 32/298 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA--RNGSTG--------QEAAVKVISKAVFNTGNVSGTS 64
           T GP+ LG TLG G  GKV+L   +N S          ++ A+K+I +           S
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKR----------DS 86

Query: 65  IVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVE 124
           I      +     I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +
Sbjct: 87  ISNDYRKEV---KIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQK 143

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETE 183
           +  L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      + 
Sbjct: 144 KRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSR 203

Query: 184 GKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN----- 237
            +L++TSCGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N     
Sbjct: 204 NELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSD 263

Query: 238 IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           I  L   +     + P  D I    +DL+R++L  DP++RI  + I KH  L+ + S 
Sbjct: 264 IGRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  194 bits (493), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 112/290 (38%), Positives = 159/290 (54%), Gaps = 29/290 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           T GP+ +G TLG G  GKV+L  + S  +E +  V  K V                 D +
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRR---------------DTI 105

Query: 75  P------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
           P        I REI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + ++  L
Sbjct: 106 PKHSEKEVKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRL 165

Query: 129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
            E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG      +  L++
Sbjct: 166 KEPPACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMK 225

Query: 189 TSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----IRTLL 242
           TSCGSP YAAPE +V+  PY+   +DVWSCGVIL+A+L G LP+D++  N     I  L 
Sbjct: 226 TSCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLY 285

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             + K   + P  + I    +DL+R+IL  +P+ R+   +I  H  L+ +
Sbjct: 286 HYITKSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  193 bits (490), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 114/298 (38%), Positives = 164/298 (55%), Gaps = 32/298 (10%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLA--RNGSTG--------QEAAVKVISKAVFNTGNVS 61
           K  T GP+ LG TLG G  GKV+L   +N S          ++ AVK+I +   +     
Sbjct: 34  KHVTFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKK 93

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              I              REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  
Sbjct: 94  EVKIY-------------REINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKY 140

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-AL 180
           + ++  L E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG     
Sbjct: 141 IQKKRRLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEF 200

Query: 181 ETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-- 237
            +  +L++TSCGSP YAAPE+V S  PY+   +D+WSCGVIL+A+L G LP+D++  N  
Sbjct: 201 CSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPE 260

Query: 238 ---IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
              I  L   +     + P  D I    +DL+R+IL  DP++R+  + I KH  L  +
Sbjct: 261 GSDIGRLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  194 bits (494), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 165/284 (58%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W+  ET+G GS GKV+LA++  T +  AVK++++A     +            D L
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G + EH+A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L 
Sbjct: 294 SRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ E P    +S E   L+ K+L VDP+RR   + +++H
Sbjct: 352 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  194 bits (494), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 167/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LAR+  T +  A+K++++A  +      +     +  +AL
Sbjct: 150 SLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEAL 209

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 210 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYI 269

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y H   IVHRDLK EN+++    +IKI DFG++ L  
Sbjct: 270 IQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYD 329

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+E+ ++  L 
Sbjct: 330 SKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LH 387

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K+++G+ + P    +S E   L+ K+L VDP++R   + I+ HP + +
Sbjct: 388 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/335 (36%), Positives = 178/335 (53%), Gaps = 56/335 (16%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           T GP+ +G T+G G  GKV+L  +         K IS    ++ + +G  +    TP AL
Sbjct: 57  TFGPYIIGSTIGQGEFGKVKLGWS---------KSISNKQSHSPSANGLGLYA--TP-AL 104

Query: 75  P------------------------YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           P                          I REI  +K L HPN+++L +V + +  + +VL
Sbjct: 105 PIEVPKQVAIKLIRRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVL 164

Query: 111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNI 170
           EYA  GE +  +  +  L E  A + F Q+I GV+Y H+ G++HRDLK EN+LLD   N+
Sbjct: 165 EYASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENL 224

Query: 171 KIADFGMA-ALETEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGR 228
            I DFG      T  +L++TSCGSP YAAPE+V S  PY+    D+WSCG+ILFA+L G 
Sbjct: 225 IITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGY 284

Query: 229 LPFDEE-----DGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDI 283
           LP+D++       NI  L   +     + P  + I+   +DL+R+IL  DP++R+  R I
Sbjct: 285 LPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYI 342

Query: 284 LKH-------PLL----QKYPSIRDSKSIRGLPRE 307
           LKH       P L    +++ +I  S+SI  LP+ 
Sbjct: 343 LKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/297 (38%), Positives = 161/297 (54%), Gaps = 37/297 (12%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQL----ARNGSTGQEAAVKVISKAVFNTGNVSGTSIVG 67
           K  T GP+ +G TLG G  GKV+L    AR     +  A+K+I +               
Sbjct: 38  KQVTFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRR--------------- 82

Query: 68  STTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
               D +P   E+EI I      +KLL+HPN++RL +V + +  + +VL+YA  GE +  
Sbjct: 83  ----DTVPKNSEKEIKIYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKY 138

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           + ++  L E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG     
Sbjct: 139 IQKKRRLKEPPACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEF 198

Query: 182 TEGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN--- 237
            +  L+ TSCGSP YAAPE +VS  PY    +DVWSCGVIL+A+L G LP+D++  N   
Sbjct: 199 HKNDLMRTSCGSPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEG 258

Query: 238 --IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             I  L   +     + P  + I    +DL+++IL  +PE R+   DI +H  LQ +
Sbjct: 259 EDIAKLYQYITHTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 165/284 (58%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W+  ET+G GS GKV+LAR+  T +  AVK++++A     +            D L
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 173

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 174 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 233

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G + EH+A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 234 IQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 293

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L 
Sbjct: 294 SRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 351

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ E P    +S E   L+ K+L VDP+RR   + +++H
Sbjct: 352 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 171/294 (58%), Gaps = 19/294 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LAR+  T +  A+K++++A+    +   +     T  + L
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMPPPRTEQEVL 217

Query: 75  PY--GIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 218 ERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 277

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 278 IQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFD 337

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 338 RKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 395

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK---YP 293
            K+++G+ + P  + +S E   L+ K+L VDP RR   + +++HP + +   YP
Sbjct: 396 EKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/294 (39%), Positives = 162/294 (55%), Gaps = 40/294 (13%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA------RNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS 68
           T GP+ +G TLG G  GKV+L        +    ++ A+K+I +                
Sbjct: 68  TFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR---------------- 111

Query: 69  TTPDALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
              DA+  G E+EI I      +K L HPN++RL +V + +  + +VLEYA  GE +  +
Sbjct: 112 ---DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYI 168

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALE 181
            ++  L E  A   F Q++ GV Y H  G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 169 QKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFS 228

Query: 182 TEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG 236
              +L++TSCGSP YAAPE+V S  PY+   +D+WSCG+ILFA+L G LP+D++    DG
Sbjct: 229 KFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDG 288

Query: 237 N-IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           N I  L   +     + P  + IS  A+DL+R IL   P++R   + ILKH  L
Sbjct: 289 NDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  192 bits (489), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 101/284 (35%), Positives = 165/284 (58%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W+  ET+G GS GKV+LA++  T +  AVK++++A     +            D L
Sbjct: 127 SLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 186

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 187 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 246

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G + EH+A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 247 IQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYD 306

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L 
Sbjct: 307 SRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 364

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ E P    +S E   L+ K+L VDP+RR   + +++H
Sbjct: 365 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  187 bits (474), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 166/297 (55%), Gaps = 36/297 (12%)

Query: 16  IGPWKLGETLGLGSTGKVQLA-----------RNGS-------TGQEAAVKVISKAVFNT 57
            G + LG+TLG G  GKV+L             +GS         ++ A+K+I +   + 
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLSA 115

Query: 58  GNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGE 117
              S   +              REI  +K+L HPN+++L +V + +  + +VLEYA  GE
Sbjct: 116 SKESEIKLY-------------REINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGE 162

Query: 118 LFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGM 177
            +  +  +  L E +A   F Q+I GVSY H+ G+VHRDLK ENLLLD   N+ I DFG 
Sbjct: 163 FYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGF 222

Query: 178 AALETE-GKLLETSCGSPHYAAPEIVSGI-PYQGFASDVWSCGVILFALLTGRLPFDEED 235
               T+  KL+ T CGSP YAAPE+V+ + PY    +D+WSCGVIL+A+L G LP+D++ 
Sbjct: 223 VNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDP 282

Query: 236 GNIR-TLLLKVQKGEFEMP--SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            NI  T ++K+ K     P    + I+   +DL+R++L +DP +R+  + IL+H  +
Sbjct: 283 KNINGTDIVKLYKYIENQPLKFPEYINMVPRDLLRRMLEIDPAKRMSMKHILQHAWI 339

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  189 bits (481), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 111/294 (37%), Positives = 161/294 (54%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG-----QEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ +G TLG G  GKV+L    ++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKK--------- 89

Query: 67  GSTTPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
                DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 90  -----DADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV+Y H  G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS  PY+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMNTSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             L   + +   + P  + I+   +DL+R+IL  +P RR+  R I +H  L+ +
Sbjct: 265 ARLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  191 bits (484), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 100/284 (35%), Positives = 165/284 (58%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W+  ET+G GS GKV+LA++  T +  AVK++++A     +            D L
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVL 175

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 176 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYI 235

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G + EH+A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 236 IQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYD 295

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+E+ ++  L 
Sbjct: 296 SRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LH 353

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ E P    +S E   L+ K+L VDP+RR   + +++H
Sbjct: 354 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  190 bits (483), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 164/290 (56%), Gaps = 23/290 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVSGTSIVGSTTPD 72
           ++G W   ET+G GS GKV+LA+N  T +  A+K++++A  +F +   +     G T P 
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKH-NGYTIPL 125

Query: 73  ALPYGIE----------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
           +    IE                RE  + ++L HP++ RLY++   +   Y++ EY   G
Sbjct: 126 SEKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGG 185

Query: 117 ELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           +L + +++ G L E  A  F RQI   + Y H+  IVHRDLK EN+++    NIK+ DFG
Sbjct: 186 QLLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFG 245

Query: 177 MAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG 236
           ++ L  +   L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 246 LSNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 305

Query: 237 NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
           N+  L  K+++G+   P    +S E   L+ K+L VDP +R     ++ H
Sbjct: 306 NV--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  191 bits (485), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/348 (32%), Positives = 187/348 (53%), Gaps = 32/348 (9%)

Query: 4   NGNSIPAIKDNT-------IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--V 54
           N N+ P I + T       +G W   ET+G GS GKV+LA++  T +  A+K++++A   
Sbjct: 142 NRNTAPIISNETKQFHRRSLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKA 201

Query: 55  FNTGNVSGTSIVGSTTPDALPYGIEREII----------IMKLLNHPNVLRLYDVWETNT 104
           F     S                +E+EI           + ++L HP++ RL+++   + 
Sbjct: 202 FLHKEQSMPPPKNEQEIAERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSN 261

Query: 105 DLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL 164
             Y++ EY   G+L + +++ G L EH A +F R I   + Y H   IVHRDLK EN+++
Sbjct: 262 HFYMLFEYVSGGQLLDYIIQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMI 321

Query: 165 DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFAL 224
            +   IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS G++L+ L
Sbjct: 322 SNSGEIKIIDFGLSNVFDNRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVL 381

Query: 225 LTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDIL 284
           + G++PFD+E+ ++  L  K+++G+ E P  + +S E   L+ K++ VDP +R   R ++
Sbjct: 382 VCGKVPFDDENSSV--LHEKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVV 437

Query: 285 KHPLLQKYPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
           +HP + +     D   +  LPR    LTP      +ID  +L+ +  L
Sbjct: 438 EHPWMTRG---YDFPPLSYLPRR-IPLTP-----EAIDNNVLREMFRL 476

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  190 bits (483), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 165/284 (58%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+KV+++A     +   T     T  + L
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLPPPQTEQEIL 238

Query: 75  PY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 239 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 298

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 299 IQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 358

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             + L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 359 TTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 416

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ + P    +S E   L+ K+L VDP++R   R +++H
Sbjct: 417 EKIKQGKVDYPQ--HLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  189 bits (481), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 164/297 (55%), Gaps = 34/297 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G W   ET+G GS GKV+LA++  T +  A+K++++A         T        +  P
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRA---------TKAFLHKEQNLPP 156

Query: 76  YGIEREII---------------------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAE 114
              E+EI+                     + ++L HP++ RL+++   +   Y++ EY  
Sbjct: 157 PKSEQEILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVS 216

Query: 115 KGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIAD 174
            G+L + +++ G L EH A +F R I   + Y HA  IVHRDLK EN+++     IKI D
Sbjct: 217 GGQLLDYIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIID 276

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE 234
           FG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E
Sbjct: 277 FGLSNVYDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDE 336

Query: 235 DGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
             ++  L  K+++G  E P  + +S E   L+ K+L VDPERR   + +++HP + +
Sbjct: 337 VSSV--LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNR 389

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  188 bits (478), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 161/284 (56%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVSGTSIVGSTTPD 72
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A   F     S  +        
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIM 200

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 201 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 260

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A RF R I   + Y HA  IVHRDLK EN+++     IK+ DFG++ L  
Sbjct: 261 IQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYD 320

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 321 NRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 378

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ E      +S E   L+ K+L VDP+RR   + ++ H
Sbjct: 379 EKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  188 bits (477), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 165/304 (54%), Gaps = 34/304 (11%)

Query: 4   NGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGT 63
           +G  +      ++G W   ET+G GS GKV+LA++  T +  A+K++++A         T
Sbjct: 63  SGTELKQFHRKSLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRA---------T 113

Query: 64  SIVGSTTPDALPYGIEREII---------------------IMKLLNHPNVLRLYDVWET 102
           +          P   E EI+                     + ++L HP++ RL+++   
Sbjct: 114 NAFLHKEQSLPPPKKEEEILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTM 173

Query: 103 NTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENL 162
           +   Y++ EY   G+L + +++ G L EH A +F R I   + Y HA  IVHRDLK EN+
Sbjct: 174 SNHFYMLFEYVSGGQLLDYIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENI 233

Query: 163 LLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILF 222
           ++     IKI DFG++ L  + K L T CGS ++AAPE++   PY G   DVWS GV+L+
Sbjct: 234 MISTSGEIKIIDFGLSNLFDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLY 293

Query: 223 ALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRD 282
            L+ G++PFD+E+ ++  L  K+++G+ E P    +S E   L+ K+L VDP RR   + 
Sbjct: 294 VLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQ 349

Query: 283 ILKH 286
           +++H
Sbjct: 350 VVEH 353

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  186 bits (471), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/344 (36%), Positives = 177/344 (51%), Gaps = 45/344 (13%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGS-----TGQEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ +G TLG G  GKV+L    +       ++ A+K+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRR-------------- 84

Query: 67  GSTTPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
            S   DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 85  DSIKKDADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY------ 292
             L   + +   + P  + I+   +DL+R+IL  +P RR+  R I +H  L+ +      
Sbjct: 265 ARLYQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSI 322

Query: 293 -PSIRDSK--------SIRG-LPREDTYLTPLSESNSSIDATIL 326
            P+  D +        S RG + R  TY +P S    S D   L
Sbjct: 323 QPNYWDEQLRKERPQLSTRGDVGRHTTYSSPTSPDPKSRDRNSL 366

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  187 bits (475), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LAR+  T +  A+K++++A  +  +         +  +AL
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEAL 134

Query: 75  --PYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 135 ERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 194

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 195 IQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYD 254

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 255 PKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LH 312

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K+++G+ E P    +S E   L+ K+L VDP +R   + ++ H  +Q+
Sbjct: 313 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  186 bits (471), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +K+ + +G GS GKV LA +  T Q        K V  TGN +  ++V         
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQ--------KVVLKTGNKNDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  + P++ +LY+V  T + +++ LEY    EL+  L+ +  +   E+ +
Sbjct: 77  ----REVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD K   KI DFG         +LET CG+  
Sbjct: 133 LFAQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDEED   +T    + +  F   +D
Sbjct: 193 YMAPELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEED-ETKTKWKIINEEPFY--ND 249

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPS 294
           D +S++A+DLI ++L  DP +R +   +L HP LQ Y S
Sbjct: 250 DVVSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  187 bits (474), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 167/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W+  ET+G GS GKV+L ++  T +   +K++++A     +   T        + L
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEIL 161

Query: 75  PYG--IEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 162 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 221

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 222 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 281

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 282 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 339

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K++KG+ + PS   +S EA  L+ +++ +DP +R   ++++ HP + +
Sbjct: 340 EKIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 161/294 (54%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG-----QEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ +G TLG G  GKV+L  + ++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKK--------- 89

Query: 67  GSTTPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
                DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 90  -----DADKEVKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV+Y H  G+VHRDLK ENLL+D   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L+ TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMRTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             L   + +   + P  + I+   +DL+R+IL  +P RR+  R I +H  L+ +
Sbjct: 265 ARLYQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  186 bits (473), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 165/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVSGTSIVGSTTPD 72
           ++G W+  ET+G GS GKV+L ++  T +   +K++++A   +     S  S        
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVL 162

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 163 ERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 222

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y H+  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 223 IQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 282

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 283 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 340

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K++KG+ + PS   +S EA  L+ K++ VDP RR   + ++ HP + +
Sbjct: 341 EKIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/298 (33%), Positives = 169/298 (56%), Gaps = 19/298 (6%)

Query: 7   SIPAIKD---NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGT 63
           S P IK     ++G W   ET+G GS GKV+LAR+  T +  A+K++++A     +   +
Sbjct: 86  SKPEIKQFHRKSLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQS 145

Query: 64  SIVGSTTPDALPY--GIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLE 111
                   + L     +E+EI           + ++L HP++ RL+++   +   Y++ E
Sbjct: 146 LAPPKNENEMLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFE 205

Query: 112 YAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIK 171
           Y   G+L + +++ G L EH A +F R +   + Y HA  IVHRDLK EN+++     IK
Sbjct: 206 YVSGGQLLDYIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIK 265

Query: 172 IADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPF 231
           I DFG++ +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PF
Sbjct: 266 IIDFGLSNVFDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPF 325

Query: 232 DEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           D+E+ ++  L  K+++G+ E P  + +S E   L+ K+L VDP +R     +++HP +
Sbjct: 326 DDENSSV--LHEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 167/289 (57%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA--VFNTGNVSGTSIVGSTTPD 72
           ++G W+  ET+G GS GKV+L ++  T +   +K++++A   +     S  S    +   
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEIL 154

Query: 73  ALPYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 155 ERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 214

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 215 IQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFD 274

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I  L 
Sbjct: 275 YRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LH 332

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K++KG+ + PS   +S E   L+ +++ VDP RR   +++++HP + +
Sbjct: 333 EKIKKGKVDYPS--HLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  181 bits (460), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 111/293 (37%), Positives = 159/293 (54%), Gaps = 33/293 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA-----RNGSTG------QEAAVKVISKAVFNTGNVSGT 63
           T GP+ +G TLG G  GKV++       +G+ G      ++ A+K+I +           
Sbjct: 46  TFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRR----------D 95

Query: 64  SIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLV 123
           +IV ++  +   Y   REI  +K L HPN++ L ++ + +  + +VLEYA  GE +  + 
Sbjct: 96  TIVRNSDKETKIY---REINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQ 152

Query: 124 ERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALET 182
            +  L E  A R F Q++ GV Y H+ G+VHRDLK ENLLLD   N+ I DFG       
Sbjct: 153 RKRRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSN 212

Query: 183 EGKLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN---- 237
           E  L++TSCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+D++  N    
Sbjct: 213 ENVLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGD 272

Query: 238 -IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            I  L   +     + P  D ++   +DL+R+IL  DP RR     I  H  L
Sbjct: 273 DISKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  186 bits (471), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 169/293 (57%), Gaps = 24/293 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVI---SKAVFNTGNVSGTSIVGSTTP 71
           ++G W+  ET+G GS GKV+L ++  T +   +K++   SKA  +  +    S+      
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQH----SLPPPKNE 158

Query: 72  DAL---PYGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
           + L      +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L
Sbjct: 159 NELLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 218

Query: 119 FNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G L EH A +F R I   + Y HA  IVHRDLK EN+++ +   IKI DFG++
Sbjct: 219 LDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLS 278

Query: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238
            +    K L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+E+ +I
Sbjct: 279 NIFDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI 338

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
             L  K++KG+ + PS   +S +A  L+ +++ VDP +R   +++  HP + +
Sbjct: 339 --LHEKIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  182 bits (463), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 161/294 (54%), Gaps = 29/294 (9%)

Query: 12  KDNTIGPWKLGETLGLGSTGKVQLARNGSTG-----QEAAVKVISKAVFNTGNVSGTSIV 66
           K  T GP+ +G TLG G  GKV+L    ++      ++ A+K+I +              
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKK--------- 89

Query: 67  GSTTPDA-LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
                DA     I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  +
Sbjct: 90  -----DADKEIKIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRK 144

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV+Y H  G+VHRDLK ENLLLD   N+ I DFG       + 
Sbjct: 145 RRLKESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDN 204

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGN-----I 238
           +L++TSCGSP YAAPE +VS   Y+   +DVWSCGVIL+A+L G LP+D++  N     I
Sbjct: 205 ELMKTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDI 264

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             L   + +   + P  + I+   +DL+R+IL  +P RRI  + I +H  L+ +
Sbjct: 265 ARLYKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  184 bits (467), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 111/297 (37%), Positives = 161/297 (54%), Gaps = 40/297 (13%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQ-------EAAVKVISKAVFNTGNVSGTSIVGS 68
            GP+ L  TLG G  GKV+L  + ++ Q       + A+K+I ++               
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSI------------- 127

Query: 69  TTPDALPYG------IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                LP G      + REI  +K L HPN+++L DV + +  + +VLEYA  GE +  +
Sbjct: 128 -----LPKGSNKEIKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYI 182

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALE 181
             +  L E  A + F Q+I GV Y H+ G+VHRDLK ENLLLD   N+ I DFG      
Sbjct: 183 QRKKRLKEINASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFF 242

Query: 182 TEGKLLETSCGSPHYAAPEIV-SGIPYQGFASDVWSCGVILFALLTGRLPFDEE----DG 236
              +L+ T CGSP YAAPE+V S  PY+   +D+WSCG+IL+A+L G LP+D++    DG
Sbjct: 243 QTNELMLTPCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDG 302

Query: 237 N-IRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
           N I  L   +     + P  + I    +DL+RKIL  + ++RI  R I+ H  L+ +
Sbjct: 303 NDIARLYYYITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  184 bits (466), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/299 (32%), Positives = 163/299 (54%), Gaps = 34/299 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A          S +       L
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT--------KSFIHKQQQQQL 162

Query: 75  P------------YGIEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEY 112
           P              +E+EI           + ++L HP++ RL+++   +   Y++ EY
Sbjct: 163 PPPSNEEELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEY 222

Query: 113 AEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKI 172
              G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I
Sbjct: 223 VSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRI 282

Query: 173 ADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFD 232
            DFG++ L    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD
Sbjct: 283 IDFGLSNLYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFD 342

Query: 233 EEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +E+ ++  L  K+++G+ E P    +S +   L+ K+L VDP +R   + ++ H  +QK
Sbjct: 343 DENASV--LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  182 bits (462), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 161/289 (55%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A  +  +         T  + +
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLPPPKTEEELM 153

Query: 75  PYGIE------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
               +            RE  + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 154 ERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 213

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ L  
Sbjct: 214 IQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLYD 273

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+E+ ++  L 
Sbjct: 274 NKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--LH 331

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K++KG+ E P    +S E   L+ K+L VDP +R   + +  H  +Q+
Sbjct: 332 EKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  182 bits (462), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 95/293 (32%), Positives = 162/293 (55%), Gaps = 22/293 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A      +    + G   P   
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT--KSFMHKQQLQGLPPPATE 107

Query: 75  PYGIE----------------REIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGEL 118
              +E                RE  + ++L HP++ RL+++   +   Y++ EY   G+L
Sbjct: 108 EELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQL 167

Query: 119 FNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
            + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++     I+I DFG++
Sbjct: 168 LDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLS 227

Query: 179 ALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNI 238
            +    K L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+E+ ++
Sbjct: 228 NMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV 287

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
             L  K+++G+ E P    +S +   L+ K+L VDP +R   + ++ H  +QK
Sbjct: 288 --LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  181 bits (460), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/333 (31%), Positives = 180/333 (54%), Gaps = 31/333 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
           ++G W   ET+G GS GKV+LA++  T +  A+K++++A     +         T  + L
Sbjct: 180 SLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVL 239

Query: 75  --PYGIEREI----------IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + ++L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 240 ERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 299

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A +F R I   + Y H   IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 300 IQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFN 359

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 360 PKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 417

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK---YPSIRDSK 299
            K+++G+ E P    +S E   L+ K+L VDP +R   + ++ H  +Q+   +P+     
Sbjct: 418 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQRGYDFPA----- 470

Query: 300 SIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
                P    +  PL+    ++D T++Q +  L
Sbjct: 471 -----PSYIPHRVPLTA--DALDPTVIQEMYRL 496

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  180 bits (456), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 110/294 (37%), Positives = 158/294 (53%), Gaps = 37/294 (12%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEA---AVKVISKAVFNTGNVSGTSIVGSTTP 71
           T GP+ +G TLG G  GKV+L  + S   E+   A+K+I +                   
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRR------------------- 92

Query: 72  DALPYGIEREIII------MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVER 125
           D +P   E+E+ I      +K L HPN++ L +V + +  + +VL YA  GE +  + ++
Sbjct: 93  DTIPKNSEKEVKIYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKK 152

Query: 126 GPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMA-ALETEG 184
             L E  A R F Q+I GV Y H  G+ HRDLK ENLLLD   N+ I DFG      +  
Sbjct: 153 RRLKEPAACRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRN 212

Query: 185 KLLETSCGSPHYAAPE-IVSGIPYQGFASDVWSCGVILFALLTGRL-----PFDEEDGNI 238
            L++TSCGSP YAAPE +V+   Y+   +DVWSCGVIL+A+L G L     P + +  +I
Sbjct: 213 DLMKTSCGSPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDI 272

Query: 239 RTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             L   + K   + P  + I+   +D++R+IL  DP +RI    ILKH  LQ +
Sbjct: 273 AKLYNYITKTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  180 bits (456), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/284 (33%), Positives = 160/284 (56%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDAL 74
            +G W   ET+G GS GKV++A++  T +  A+K+I++A     +            +AL
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLPPPQNEQEAL 195

Query: 75  PYG--IEREII----------IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                +E+EI           + + L HP++ RL+++   +   Y++ EY   G+L + +
Sbjct: 196 ERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 255

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L EH A +F R I   + Y HA  IVHRDLK EN+++     IKI DFG++ +  
Sbjct: 256 IQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMFD 315

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
               L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 316 PRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 373

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+ + P    +S E   L+ K+L VDP +R   + +++H
Sbjct: 374 EKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  178 bits (452), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/332 (33%), Positives = 170/332 (51%), Gaps = 29/332 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T +        K V  T + S  ++V         
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHR--------KVVLKTSDKSDPNLV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  + P + +LY+V  T T +++ LEY    EL+  L+    +P  E  +
Sbjct: 77  ----REVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 133 LFAQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D   +T    V   +F   +D
Sbjct: 193 YMAPELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDD-ETKTKWKIV--NDFPNFND 249

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
           + +S EA+DLI+++L   P  R     IL HP LQ Y  I  S++ + + R+   +T   
Sbjct: 250 NFVSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQRLGMTQF- 308

Query: 316 ESNSSIDATILQNLVILWHGRDPEGIKEKLRE 347
              S ++  +L+ L     G D + IK  +++
Sbjct: 309 --RSRLERKLLKRLK--QSGFDAQSIKASIQK 336

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  177 bits (449), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/284 (34%), Positives = 157/284 (55%), Gaps = 16/284 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPD-- 72
           ++G W    T+G GS GKV+LAR+       AVK++++A         ++    +  D  
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQQSAPAPQSKADIK 173

Query: 73  ----------ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                     A      RE  + ++L+H N+ +LY +   +   Y++ EY   G+L + +
Sbjct: 174 ERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLDYI 233

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E  A  F R I  G++Y HA  +VHRDLK EN++L     IKI DFG++ L  
Sbjct: 234 IQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNLFD 293

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
               L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++PFD+E+ N   L 
Sbjct: 294 PRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSN--ALH 351

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
            K+++G+   P+   +S E   L+ K+LTV+P+RR   ++I+ H
Sbjct: 352 EKIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  176 bits (445), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 159/305 (52%), Gaps = 38/305 (12%)

Query: 9   PAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGS 68
           P +K+  +G +K+ + +G GS GKV LA +  T          K V  T N S  +IV  
Sbjct: 30  PDLKE--VGNYKILDQIGEGSFGKVYLASHRLTH--------CKVVLKTSNKSDPNIV-- 77

Query: 69  TTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPL 128
                      RE+   +  ++P + +LY+V  T + +++  EY    +L++ ++    +
Sbjct: 78  -----------REVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRV 126

Query: 129 PEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE 188
           P    I  F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG          LE
Sbjct: 127 PSSACIELFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLE 186

Query: 189 TSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG 248
           T CG+  Y APE++    Y GF  D+WS GVIL+ +L G +PFDE+D           K 
Sbjct: 187 TICGTTVYMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET---------KT 237

Query: 249 EF----EMP--SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIR 302
           E+    EMP  +D  +S +A+DL+ K+L+ DP  R   ++IL HP LQ Y S+   K+ R
Sbjct: 238 EWKIMNEMPVFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDR 297

Query: 303 GLPRE 307
            L ++
Sbjct: 298 LLRKQ 302

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  176 bits (445), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 161/289 (55%), Gaps = 16/289 (5%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA- 73
           ++  W   ET+G GS GKV+LA+N ++ +  A+K++ +A     + +      +   +A 
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 74  -----LPYGIER------EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL 122
                L   I R      E  + ++L HPNV +LY++   +   Y+  E+   G+L + +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYI 182

Query: 123 VERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET 182
           ++ G L E+ A +  R I+  + Y HA  IVHRDLK EN++L     IK+ DFG++ +  
Sbjct: 183 IQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYD 242

Query: 183 EGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLL 242
             K L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  N   L 
Sbjct: 243 PRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALH 300

Query: 243 LKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
            K++KG+   P    +S +   L+ KIL VDP++R   + ++ H  + K
Sbjct: 301 EKIKKGKVTYPQ--FLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  175 bits (444), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 110/345 (31%), Positives = 178/345 (51%), Gaps = 29/345 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ E +G GS GKV LA +  T ++    VI  +V N  N                
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKV---VIKSSVKNDPN---------------- 83

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             I RE+   +   +  + +LY++  T + +++ LEY    EL++ +++   +P  E I+
Sbjct: 84  --IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQ 141

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG      E   LET CG+  
Sbjct: 142 LFSQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTV 201

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE+    PY GF  D+WS GVIL+ +L+G +PFDE+D       +  ++ E+   + 
Sbjct: 202 YMAPELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NS 258

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
             ++ E +DL+RK+L  D   R   R+IL+H  LQ Y +   +++   + R+    T   
Sbjct: 259 KFMTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGTTVLTQTDNLIARQRKGATNF- 317

Query: 316 ESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
             +S ++  +L+ L     G D + IK+ + +   ++   L+ LL
Sbjct: 318 --HSKLERRVLKRLNRC--GFDTQSIKQSVIKKKCDSLAGLWCLL 358

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  174 bits (441), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 150/279 (53%), Gaps = 24/279 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA++  T         +K V  + + +  +IV         
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTH--------TKVVLKSSDKNDPNIV--------- 77

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  ++P + +LY+V  T T +++ LEY    EL++ ++    +P  E ++
Sbjct: 78  ----REVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQ 133

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+ GV Y H+L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 134 LFAQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTV 193

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ ++ G +PFDE+D       +  Q  +    ++
Sbjct: 194 YMAPELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NE 250

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPS 294
           + ++ +A+DLI ++L  +P  R     ILKHP LQ + S
Sbjct: 251 NIVTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 155/292 (53%), Gaps = 24/292 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           IG +K+ + +G GS GKV LA +  T Q        K V  TGN    ++V         
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQ--------KVVLKTGNKRDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  + P + +LY+V  T + +++VLEY    EL+  L++   L   E+ +
Sbjct: 77  ----REVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  
Sbjct: 133 LFSQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS G+IL+ ++ G +PFDE+D +I+T  LK+   E +  + 
Sbjct: 193 YMAPELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQ 249

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPRE 307
           + IS +A DLI+ +L  +P  RI    +L HP LQ +  +   K+ + L ++
Sbjct: 250 EWISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVLLKQ 301

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  172 bits (437), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 149/279 (53%), Gaps = 28/279 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K  SK                T P+ + 
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLKSSSK----------------TDPNVV- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  +HP + +LY++  T T +++ LEY    EL++ L+    +P  E  R
Sbjct: 77  ----REVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD + N K+ADFG          LET CG+  
Sbjct: 133 LFAQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+ G +PFDEED   RT    +     E P  
Sbjct: 193 YMAPELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEED-ETRTEWKIIN----EEPDY 247

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
           +E   +  + +LI+ +L  DP++R    +ILKH  L+ Y
Sbjct: 248 NEKIFNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  162 bits (411), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 151/294 (51%), Gaps = 29/294 (9%)

Query: 6   NSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSI 65
           NS   IK  T   + +G  LG G  GKV   R+  +G   A+KV+ K             
Sbjct: 100 NSNLRIKSFTKDDFDIGLKLGKGKFGKVFCVRHKESGFICALKVMQKT------------ 147

Query: 66  VGSTTPDALPYGIEREII----IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
                 D L Y +ER+ I    I   LNHPN+ +LY  +     +YL++EY   GEL+  
Sbjct: 148 ------DILQYKLERQFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKT 201

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALE 181
           L   GP     A  +  QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + + 
Sbjct: 202 LEIHGPFENAVATNYVYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIIN 261

Query: 182 TEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTL 241
            +G    T CG+  Y +PEIV    Y     D+W+ G++ + LL G  PF+E   N + L
Sbjct: 262 PKGLRRRTFCGTIDYLSPEIVDYKEYD-HNVDIWALGIVAYELLVGSPPFEE---NTKDL 317

Query: 242 LL-KVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPS 294
              ++++G+   P   +++ EA+D I +IL ++P++R+  ++I+ HP + KY S
Sbjct: 318 TYERIRRGDIVFPK--QVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  164 bits (415), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 156/296 (52%), Gaps = 31/296 (10%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           ++ G+T+G G+ G V+ A   STG+E AVK+I K      ++    +             
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGNDIQLQMLYD----------- 89

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L HPN++     +E+   +Y+V + A  GELF+ +++RG   E +A+    
Sbjct: 90  --ELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVV 147

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  +VHRDLKPEN+L      K  I IADFG+A  LE EG L+  + GS 
Sbjct: 148 QILKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSL 207

Query: 195 HYAAPEIV--SGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEF 250
            Y APE++  SG    G   D+WS G+I + LL G  PF  E  DG +  ++   +   F
Sbjct: 208 GYVAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAF 264

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPR 306
             P  DEIS EA+  I + +T+DP +R    ++LK P +        SK  +G  R
Sbjct: 265 HSPYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWIT-------SKGFKGAER 313

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/272 (36%), Positives = 151/272 (55%), Gaps = 24/272 (8%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG GS G V+ AR  STG   AVK++ K      +V    +               
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGNDVQLQMLYD------------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E++I++ LNHPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   QI
Sbjct: 95  ELMILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL LD   N  + + DFG+A  L+ +G L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----FEM 252
            APE+++   + G   D+WS GVI + LL G  PF  E  ++   L +   G+    F  
Sbjct: 215 VAPEVLTSNGH-GKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHK 271

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDIL 284
           P  + IS+EA+  I ++LT+ P++R    D+L
Sbjct: 272 PYWNNISKEAKLFILRVLTISPKKRPTATDLL 303

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 175/350 (50%), Gaps = 39/350 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K   K   N  NV               
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK---NDPNVV-------------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  ++  + RLY+V  T T +++ LEY    EL+  L+    +   E  R
Sbjct: 77  ----REVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  + Y H+L  VHRDLK EN+LLD K N K+ DFG          L+T CG+  
Sbjct: 133 LFAQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP-- 253
           Y APE+     Y GF  D+W+ GVIL+ ++ G +PFDE+D   +T    V     EMP  
Sbjct: 193 YMAPELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDD-EAKTKWKIVN----EMPEI 247

Query: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY--PSIRDSKSI-RGLPREDTY 310
           ++D +S +A+DLI ++L  DP  R     IL HP LQ Y  P +  ++ I R   R   +
Sbjct: 248 NEDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPYGIPLMEKTQKILRKQRRGSVH 307

Query: 311 LTPLSESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
                  +S ++  +L+ L  +  G D + +K  +++   +A   L+ LL
Sbjct: 308 F------HSKLERKLLKRLKQM--GFDTQSMKASVQKKKCDALSGLWLLL 349

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  169 bits (427), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 149/282 (52%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +++ + +G GS GKV LA +  T Q        K V  TG  S  ++V         
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQ--------KVVLKTGAKSDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +   +P + +LY+V  T T +++ LEY    EL++ L+ +  +P  E  R
Sbjct: 77  ----REVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  
Sbjct: 133 LFAQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPS- 254
           Y APE++    Y G+  D WS G+IL+ +L G +PFDE+D  +RT L    K   E P+ 
Sbjct: 193 YMAPELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAV 247

Query: 255 -DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
            D+  S +A+DLI ++L  +  +R    ++L+HP LQ Y ++
Sbjct: 248 LDEYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  169 bits (427), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 145/282 (51%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +++   +G GS GKV LA +  T ++  +K  +K+  N                   
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLKSSAKSDPN------------------- 74

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             + RE+   +    P + +LY++  T T +++ LEY    EL+  L+    +P  E  R
Sbjct: 75  --VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSR 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   + Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  
Sbjct: 133 LFAQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  DVWS GVIL+ LL G +PFDEE    +    K+     EMPS 
Sbjct: 193 YMAPELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSF 247

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           D   +  +A DL+ K+L  DP  R   +++L+HP LQ Y ++
Sbjct: 248 DSTLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  168 bits (426), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 147/281 (52%), Gaps = 28/281 (9%)

Query: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73
           N +G +K+ + +G GS GKV LA +  T ++  +K   K                T P+ 
Sbjct: 34  NEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLKSSDK----------------TDPNV 77

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
           +     REI   +  + P + +LY+V  T T +++V+EY    EL++ L+ +  +   E+
Sbjct: 78  V-----REIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDES 132

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
            R F QI+  V Y H+L  VHRDLK EN+LLD   N K+ DFG     ++   LET CG+
Sbjct: 133 ARIFAQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGT 192

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
             Y APE++    Y G+  D+W+ G++L+ ++ G +PFDE+D     L +     +++  
Sbjct: 193 TVYMAPELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNK 252

Query: 254 --SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
             +DD I     DL+ ++L+ DP  R     IL HP L  Y
Sbjct: 253 YFNDDSI-----DLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  161 bits (408), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 151/275 (54%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ AR  +TG++ AVK++ K      NV    +               
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQMLYD------------- 100

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+
Sbjct: 101 ELAILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQL 160

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHY 196
           I  VSY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++   L+    GS  Y
Sbjct: 161 ISAVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGY 220

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL+G   F  E  +G +          +F  P 
Sbjct: 221 VAPEVLTREGH-GKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPY 279

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS+EA+D I + LT+DP  R    ++L+ P +
Sbjct: 280 WDNISQEAKDFILRALTIDPNDRPTAEELLQDPWI 314

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  167 bits (424), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 145/277 (52%), Gaps = 24/277 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T Q+  +K+ SK   N  NV               
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK---NDPNVV-------------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  ++ ++ +LY+V  T   +++ LEY    EL+  L+ +  +P  E   
Sbjct: 77  ----REVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSE 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H++  VHRDLK EN+LLD K + K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++   PY+G+  D WS G+IL+ ++ G +PFDE D  ++T    V         +
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD-EVKTKYKIVHYN--PTYDN 249

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
           D I    ++LI ++L  DP +R     +L+HP LQ Y
Sbjct: 250 DYIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 145/282 (51%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T Q        K V  TG     ++V         
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQ--------KVVLKTGEKKDPNVV--------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+++  +P  E  +
Sbjct: 77  ----REVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSK 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  
Sbjct: 133 LFAQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPS- 254
           Y APE++    Y G+  D WS G+IL+ +L G +PFDEED  +    LK+     EMP  
Sbjct: 193 YMAPELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPI 247

Query: 255 -DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
            D   +  A+DLI K+L   P  R     +L+HP LQ Y +I
Sbjct: 248 VDAYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  167 bits (422), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 107/345 (31%), Positives = 173/345 (50%), Gaps = 29/345 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +++ + +G GS GKV LA +  T Q+  +K+ SK   N  NV               
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK---NDPNVV-------------- 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
               RE+   +  ++  + +LY+V  T   +++ LEY    EL+  L+ +  +P  E   
Sbjct: 77  ----REVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSH 132

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI+  V Y H++  VHRDLK EN+LLD K   K+ DFG         +LET CG+  
Sbjct: 133 LFSQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTV 192

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++   PY+G+  D WS G+IL+ ++ G +PFDEED +I+T    V    F    D
Sbjct: 193 YMAPELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DD 249

Query: 256 DEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTPLS 315
           + I    +DLI ++L  DP +R     +L+HP +  + S    K+ + + R+        
Sbjct: 250 NFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQSQGCKHF- 308

Query: 316 ESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALL 360
             +S ++  +L+ L     G D + IK+ + +   +A    + LL
Sbjct: 309 --HSKLERRLLKKLK--QSGFDTQAIKQSVNKKKCDALAGTWQLL 349

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  159 bits (402), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 148/270 (54%), Gaps = 20/270 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ AR  S+G+  AVK++ K       + G S+      D        
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKA-----LKGQSVQLQMLYD-------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++E+G   E +A+   +QI
Sbjct: 95  ELSILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSPHY 196
           + GV Y H   IVHRDLKPEN+L  +K +   + I DFG+A  L+ + +L+  + GS  Y
Sbjct: 155 LQGVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  DG I           F  P 
Sbjct: 215 VAPEVLTSSGH-GKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPY 273

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDIL 284
            + +S+ A++ I   LTV P+RR    D++
Sbjct: 274 WNNVSKTAKEFILWALTVSPKRRPTATDLI 303

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  158 bits (400), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 156/309 (50%), Gaps = 28/309 (9%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG GS G V+ AR  STG++ AVK++ K       V    +               
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQMLYD------------- 86

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HP+++   D +E+    Y+V + A  GELF+ ++ RG   E++A++   Q+
Sbjct: 87  ELSILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQL 146

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L        ++ IADFG+A  L+    ++  + GS  Y
Sbjct: 147 LDAVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGY 206

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++ +   G A D+WS GVI + LL+G   F  E  +G +           F  P 
Sbjct: 207 VAPEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPY 265

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK--------YPSIRDSKSIRGLPR 306
            D+IS EA+  I   LT++PE R     +L HP +           PS+R+    R   R
Sbjct: 266 WDKISDEAKKFILSALTIEPEERPTAEQLLSHPWITSTMSHDADLLPSVREGFDARKKFR 325

Query: 307 EDTYLTPLS 315
           E   +  L+
Sbjct: 326 EAVEIVKLN 334

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  164 bits (416), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 103/307 (33%), Positives = 161/307 (52%), Gaps = 42/307 (13%)

Query: 3   ING-NSIPA----IKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNT 57
           +NG N IP+    +KD +I      E +G G+   V+ A   STG+  AVK+I+K     
Sbjct: 180 LNGLNGIPSQQGILKDFSIND----EVVGQGAFATVKKAVERSTGRTFAVKIINKRKV-M 234

Query: 58  GNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGE 117
           GN+SG               + RE+ I++ L+HP ++RL   +E     YLV+E+   G+
Sbjct: 235 GNLSG---------------VTRELEILRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGD 279

Query: 118 LFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADF 175
           L + +   G + E       RQI+  V+Y H  GI HRD+KP+N+L+  D    +KI DF
Sbjct: 280 LMDFVAAHGSVGEDAGREITRQILEAVAYMHEKGISHRDIKPDNILIEQDDPVLVKITDF 339

Query: 176 GMAALETEGKLLETSCGSPHYAAPEIVSG----------IPYQGFASDVWSCGVILFALL 225
           G+A ++  G  ++T CG+  Y APE++SG          I Y     D+WS G +++ +L
Sbjct: 340 GLAKVQGNGTFMKTFCGTLAYVAPEVISGKNAATENDDRIEYSSLV-DMWSIGCLVYVIL 398

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGEF-EMP-SDDEISREAQDLIRKILTVDPERRIKTRDI 283
           T  LPF       + L  ++ +G + E P  D  +S EA+D I  ++ VDP  R+  +D 
Sbjct: 399 TAHLPF--SGSTQQELYEQINRGSYHEGPLKDYRVSEEARDFIESLIQVDPNNRLTAKDA 456

Query: 284 LKHPLLQ 290
           LKH  ++
Sbjct: 457 LKHEWIK 463

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 153/290 (52%), Gaps = 36/290 (12%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
           + E +G G+   V+ A   +TG+  AVK+ISK            ++G+        G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK----------RKVIGNMD------GVTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ +++ LNHP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LTAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGIPYQG----------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-V 245
           PE++ G               ++S  D+WS G +++ +LTG LPF    G+ +  L K +
Sbjct: 364 PEVIRGKDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQI 420

Query: 246 QKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYP 293
            +G + E P  D  IS EA+D I  +L VDP  R+     L HP ++  P
Sbjct: 421 GRGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  163 bits (413), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/298 (32%), Positives = 157/298 (52%), Gaps = 39/298 (13%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   +TG+  AVK+I+K            +VG+        G+ RE+
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINK----------RKVVGNMD------GVSREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 236 EVLQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            + Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G +++T CG+  Y APE
Sbjct: 296 AIQYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPE 355

Query: 201 IVSGIP--------------YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLL-KV 245
           ++ G                Y     D+WS G ++F +LTG LPF    G+ +  L  ++
Sbjct: 356 VIGGFTGATGEEETEEERIEYSSLV-DMWSMGCLVFVILTGHLPF---SGSTQEQLYEQI 411

Query: 246 QKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSI 301
           +KG + E P  D  IS EA+D I  +L VD  +R+   D L HP +++  S  D+ S+
Sbjct: 412 RKGSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  157 bits (398), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 151/277 (54%), Gaps = 24/277 (8%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ A+N  TG++ AVK++ K       V   ++               
Sbjct: 39  FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYD------------- 85

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   +I
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEI 145

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +LL    GS  Y
Sbjct: 146 LSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGY 205

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----FEM 252
            APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   GE    F  
Sbjct: 206 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHR 262

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           P  D +S +A+  I K L +DP +R    ++L+ P +
Sbjct: 263 PYWDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  155 bits (392), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 147/279 (52%), Gaps = 19/279 (6%)

Query: 13  DNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPD 72
           D  +  +++G  LG G  GKV   R+  +G   A+KV++K      NV            
Sbjct: 112 DLKLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNFNVQKQ--------- 162

Query: 73  ALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHE 132
                 +REI I   LNH N+ +LY  +  + ++YLV+EY   GEL+ LL + GP+ +  
Sbjct: 163 -----FKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDIT 217

Query: 133 AIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCG 192
           A  +  Q+   ++Y H   I+HRDLKPEN+L+     IK+ DFG +      +  +T CG
Sbjct: 218 ASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCG 277

Query: 193 SPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEM 252
           +  Y +PE++S   Y     DVW+ G++ + L+ G  PF EED   +T   ++ K + + 
Sbjct: 278 TIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPF-EEDTKEQT-YKRIAKSDLKF 334

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           P +  +S EA+DLI  +L V P  R   + ++ HP ++K
Sbjct: 335 PPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  162 bits (410), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 157/310 (50%), Gaps = 42/310 (13%)

Query: 2   AINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVS 61
           AI        KD +I    + E +G G+   V+ A   +TG+  AVK+ISK         
Sbjct: 185 AIMARKTGIFKDFSI----IDEVVGQGAFATVKKAIERTTGKTFAVKIISK--------- 231

Query: 62  GTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNL 121
              ++G+        G+ RE+ +++ LNHP ++RL   +E     Y+V+E+   G+L + 
Sbjct: 232 -RKVIGNMD------GVTRELEVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDF 284

Query: 122 LVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAA 179
           +   G + E       RQI+  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A 
Sbjct: 285 VAAHGAVGEDAGREISRQILAAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAK 344

Query: 180 LETEGKLLETSCGSPHYAAPEIVSGI-------------PYQGFASDVWSCGVILFALLT 226
           ++  G  ++T CG+  Y APE++ G               Y     D+WS G +++ +LT
Sbjct: 345 VQGNGSFMKTFCGTLAYVAPEVIRGKDSSVSPDECEERNEYSSLV-DMWSMGCLVYVILT 403

Query: 227 GRLPFDEEDGNIRTLLLK-VQKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDI 283
           G LPF    G+ +  L K + +G + E P  D  IS EA+D I  +L VDP  R+     
Sbjct: 404 GHLPF---SGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKA 460

Query: 284 LKHPLLQKYP 293
           L HP ++  P
Sbjct: 461 LDHPWIKMNP 470

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  156 bits (395), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 151/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   GE    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRF 260

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
             P  D +S +A+  I K L +DP +R     +L+ P +
Sbjct: 261 HRPYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  162 bits (411), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 149/294 (50%), Gaps = 28/294 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K                     T D   
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             I RE+   +  + P + +LY+V  T T +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++T    V     E P+ 
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNY 251

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPRE 307
           D   I  +A+DLI ++L  +P+ R     +L H  LQ Y S+   ++ + L R+
Sbjct: 252 DSTLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  154 bits (390), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 85/259 (32%), Positives = 137/259 (52%), Gaps = 19/259 (7%)

Query: 33  VQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPN 92
           V   R+  TG   A+K++ K+   T NV+                   EI I   LNH N
Sbjct: 140 VYCCRHIKTGFICAIKIMDKSEILTYNVTKQ--------------FRNEIEIQSNLNHEN 185

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152
           + +LY  +  +  +YL++EY   GEL+++L + GP  +  A  F  Q+   + Y H   I
Sbjct: 186 LTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKRI 245

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRDLKPEN+L+D    IKI DFG +     G   +T CG+  Y +PE+++   Y G   
Sbjct: 246 IHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGLI- 304

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTV 272
           DVW+ G+I + L+ G  PF+E+   +     +++  +   P+   +S++A++LI  +L +
Sbjct: 305 DVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCDLNFPA--HVSQDAKNLISSLLKL 360

Query: 273 DPERRIKTRDILKHPLLQK 291
           +P  RI   D+LKHP + K
Sbjct: 361 NPSERITLTDVLKHPWINK 379

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 150/291 (51%), Gaps = 38/291 (13%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
           + E +G G+   V+ A   +TG+  AVK+ISK            ++G+        G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK----------RKVIGNMD------GVTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ +++ LNHP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGI-------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK- 244
           PE++ G               Y     D+WS G +++ +LTG LPF    G+ +  L K 
Sbjct: 364 PEVIRGKDTSVSPDEYEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQ 419

Query: 245 VQKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYP 293
           + +G + E P  D  IS EA+D I  +L VDP  R      L HP ++  P
Sbjct: 420 IGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  160 bits (406), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 105/292 (35%), Positives = 160/292 (54%), Gaps = 26/292 (8%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + H N+++  D
Sbjct: 88  GGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLL----SEIQIHKSMRHFNIVQFID 143

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E +T++Y++LE    G L +LL  R  L E E +RFF   I+G V Y H+  ++HRDL
Sbjct: 144 CFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQIVGAVKYMHSRRVIHRDL 202

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y APE+++G  + G  +  D+
Sbjct: 203 KLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG-KHTGHSYEVDI 261

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WSCGV+++ALL G+ PF  ++ NI  +  +++ G++  P D  IS+EA  LIR IL++DP
Sbjct: 262 WSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKCISQEALTLIRDILSIDP 319

Query: 275 ERRIKTRDILKHPLLQKYPSIRDSKSIRGL--PREDTYLTPLSESNSSIDAT 324
                    L+ P L +   I D    RG+  PR D  +   + S  ++DA 
Sbjct: 320 ---------LERPSLDE---IIDYVWFRGIFPPRIDASVLSSAPSYENLDAA 359

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  161 bits (408), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 153/296 (51%), Gaps = 38/296 (12%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
           + E +G G+   V+ A   +TG+  AVK+ISK            ++G+        G+ R
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK----------RKVIGNMD------GVTR 243

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ +++ L+HP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI
Sbjct: 244 ELEVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQI 303

Query: 141 IIGVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           +  V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y A
Sbjct: 304 LEAVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVA 363

Query: 199 PEIVSGI-------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK- 244
           PE++ G               Y     D+WS G +++ +LTG LPF    G+ +  L K 
Sbjct: 364 PEVIRGKDSSVSPDEYEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQDQLYKQ 419

Query: 245 VQKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDS 298
           + +G + E P  D  IS EA+D I  +L VDP  R+     L HP ++  P +  S
Sbjct: 420 IGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  161 bits (407), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 93/285 (32%), Positives = 151/285 (52%), Gaps = 35/285 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   +TG+  AVK+I+K     GN+ G               + RE+
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKV-MGNLDG---------------VTREL 249

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP+++ L   +E   + Y+V+E+   G+L + +   GP+ E       RQI+ 
Sbjct: 250 TVLQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILE 309

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  + T CG+  Y APE
Sbjct: 310 AVKYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPE 369

Query: 201 IVSG--------IP-----YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQK 247
           +V+G        +P     +     D+WS G +++ +LTG LPF       + L  ++ K
Sbjct: 370 VVNGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGK 427

Query: 248 GEF-EMP-SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
             + E+P  D  IS +A+D I  +L VDP  R+     L+HP +Q
Sbjct: 428 ASYHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  154 bits (390), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 148/275 (53%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ AR  S+ ++ AVK++ K      +V    +               
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGNDVQLQMLYD------------- 86

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++++G   E +A+    Q+
Sbjct: 87  ELSILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQL 146

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++   L+    GS  Y
Sbjct: 147 LDAVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGY 206

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL+G  PF  E  +G +          +F  P 
Sbjct: 207 VAPEVLTKEGH-GKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPY 265

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS EA+D I K LT+DPE R    +++  P +
Sbjct: 266 WDSISDEAKDFILKALTIDPEERPSAEELMNDPWI 300

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 153/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN++   D +E+N   Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + IADFG+A  L+++ +L+  + GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   +   L +   G+    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTF 260

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
             P  D +S +A+  I K L ++P +R    ++L+ P +
Sbjct: 261 HRPYWDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 152/289 (52%), Gaps = 40/289 (13%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  AVK+ISK            ++GS        G+ RE+
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISK----------RKVMGSNMD-----GVSREL 250

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++RL   +E + + Y+++E+   G+L + +   G + E       RQI+ 
Sbjct: 251 EVLQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 310

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            + Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 311 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPE 370

Query: 201 IVSGI----------------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK 244
           I+SG                  Y     D+WS G +++ +LTG LPF    G+ +  L K
Sbjct: 371 IISGKNDGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYK 426

Query: 245 -VQKGEF-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
            + +G + E P  D  IS EA+D I  +L V P  R+     L+HP ++
Sbjct: 427 QISRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 149/296 (50%), Gaps = 28/296 (9%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ AR   T ++ AVK++ K      +V    +               
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGNDVQLQMLYD------------- 93

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I+++L HPN++   D +E+    Y+V + A  GELF+ ++ +G   E +A+    QI
Sbjct: 94  ELSILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQI 153

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+    L+  + GS  Y
Sbjct: 154 LSAVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGY 213

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI++ LL G   F  E  DG +           F  P 
Sbjct: 214 VAPEVLTNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPY 272

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK--------YPSIRDSKSIR 302
            D IS EA++ I + LT+DP  R    +++K P +          YP IR    +R
Sbjct: 273 WDNISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLR 328

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 103/304 (33%), Positives = 165/304 (54%), Gaps = 14/304 (4%)

Query: 34  QLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNV 93
           Q    G   +   +K  S  +F    V+  SI    T   L      EI I K + H N+
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTRRKLL----SEIQIHKSMKHQNI 201

Query: 94  LRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR-QIIIGVSYCHALGI 152
           ++  D +E + ++Y++L     G L  LL +R  L E E +RFF  QI   + Y H+  +
Sbjct: 202 VQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQICGAIKYMHSRRV 260

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG-- 209
           +HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y APE++ G  + G  
Sbjct: 261 IHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLLG-KHSGHS 319

Query: 210 FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKI 269
           +  D+WS GV++FALL G+ PF  +D N  T+  +++  E+  P +  IS+EA+ LI+ I
Sbjct: 320 YEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKSISQEAKTLIQDI 377

Query: 270 LTVDPERRIKTRDILKHPLLQ-KYPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQN 328
           L  DP  R    +I+++   +  +PS+  +     +P  D +LTP +ES ++    ++Q+
Sbjct: 378 LINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP-NESLNNFRNCMIQS 436

Query: 329 LVIL 332
            +IL
Sbjct: 437 GLIL 440

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/279 (32%), Positives = 149/279 (53%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG G+ G V+ ARN  TG++ AVK++ K       +   ++             
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLEALYD----------- 85

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN++   D +E+    Y++ + A+ GELF+ ++++G   E +A+R   
Sbjct: 86  --ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILV 143

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           +I+  V Y H+  IVHRDLKPENLL   K +   + +ADFG+A  L+++ +L+    GS 
Sbjct: 144 EILSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSL 203

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----F 250
            Y APE+++   + G   D+WS GVI + LL G   F  E   ++  L +   GE    F
Sbjct: 204 GYVAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRF 260

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
             P  D +S +A+  I K L +DP  R     +L  P +
Sbjct: 261 HRPYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/283 (34%), Positives = 152/283 (53%), Gaps = 34/283 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   +TG+  AVK+I+K     GN+ G               + RE+
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKV-MGNLDG---------------VTREL 234

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            ++K LNHP ++ L   +E N   Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 235 EVLKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILE 294

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 295 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 354

Query: 201 IV-SGIPY-------QGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGE 249
           ++ S   Y         ++S  D+WS G +++ +LTG LPF    G+ +  L K + +G 
Sbjct: 355 VIGSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGS 411

Query: 250 F-EMP-SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           + E P  D  IS EA+D I  +L VDP  R+     L+HP ++
Sbjct: 412 YHEGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 145/277 (52%), Gaps = 24/277 (8%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G TLG GS G V+ AR  STG+  AVK++ K      +V    +               
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQMLYD------------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL L  K +  + + DFG+A  L  E +L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----FEM 252
            APE+++     G   D+WS GV+ + LL G  PF  E  ++   L +   G     F  
Sbjct: 215 VAPEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHK 271

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           P    IS +A+D I + LTV P  R    ++L H  +
Sbjct: 272 PYWSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 146/281 (51%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A    TG+  AVK+I+K     GN+ G               + RE+
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKV-MGNMDG---------------VTREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ LNHP ++ L   +E     YLV+E+   G+L + +   G + E       RQ++ 
Sbjct: 236 EVLRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y HA+GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGEF- 250
           ++SG          Y     D+WS G +++ +LTG LPF    G+ +  L K +  G + 
Sbjct: 356 VISGKNSEEKEGNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYH 411

Query: 251 EMP-SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           E P  D  IS +A+D I   L V+P  R+     LKHP ++
Sbjct: 412 EGPLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  160 bits (404), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/282 (35%), Positives = 143/282 (50%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    L   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D  ++T    V     E P  
Sbjct: 197 YMAPELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKY 251

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           D   I  +A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 252 DSKFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 144/280 (51%), Gaps = 31/280 (11%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A    TG+  AVK+ISK            +VG         G+ RE+
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISK----------RKVVGVMD------GVAREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++ L   +E     YLV+E+   G+L + +   G + E       RQI+ 
Sbjct: 236 EVLQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H++GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF-E 251
           ++SG          Y     D+WS G +++ +LTG LPF     N   L  ++  G + E
Sbjct: 356 VISGKNSGEKEGNTYSSLV-DMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHE 412

Query: 252 MP-SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
            P  D  IS +A+D I   L VDP  R+     L+HP ++
Sbjct: 413 GPLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  155 bits (392), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/314 (32%), Positives = 156/314 (49%), Gaps = 46/314 (14%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           + LG+ LG G    V+ A+N +TG+  AVK+      N            TT        
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQ-NDDQKKNKQFREETT-------- 243

Query: 79  EREIIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
               I+MK+ +HPN++ L D     + +T    YLVLE  + GELF+ +V++  LP+ E+
Sbjct: 244 ----ILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEES 298

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHK-------------------YNIKIAD 174
              F+QI+ G+ Y H+  I+HRD+KPEN+LL+ +                     +KIAD
Sbjct: 299 KAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIAD 358

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFD 232
           FG+A    E +   T CG+P Y APE++     +G+ S  D+WS GVIL+  L G  PF 
Sbjct: 359 FGLAKFTGEMQFTNTLCGTPSYVAPEVLVK---KGYTSKVDLWSAGVILYVCLCGFPPFS 415

Query: 233 EEDG--NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           ++ G  +++  ++   K  F  P  DEI   A  LI  +L +DPE R        HP L 
Sbjct: 416 DQLGPPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLD 474

Query: 291 KYPSIRDSKSIRGL 304
               +  S +++ L
Sbjct: 475 SVSHLDVSHNLKRL 488

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  159 bits (403), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 141/282 (50%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D WS GVIL+ L+TG LPFD++D   +T    V     E P  
Sbjct: 197 YMAPELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDD-EAKTKWKIVN----EEPKY 251

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           D   I  +A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 252 DPKLIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSV 293

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/283 (32%), Positives = 149/283 (52%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A    TG+  AVK+ISK     GN+ G               + RE+
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKV-MGNIDG---------------VTREL 235

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ LNHP ++RL   +E +   YL++E+   G+L + +   G + E       +Q++ 
Sbjct: 236 EVLRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLE 295

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H +GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 296 AVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPE 355

Query: 201 IVSGI----------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGE 249
           ++SG            Y     D+WS G +++ +LTG LPF    G+ +  L K + +G 
Sbjct: 356 VISGKNSEDKSQNKNKYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGS 411

Query: 250 F-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           + E P  D  IS EA++ I  +L V+P+ R+     L HP ++
Sbjct: 412 YHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  159 bits (401), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 150/278 (53%), Gaps = 30/278 (10%)

Query: 25  LGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIII 84
           +G G+   V+ A   STG+  AVK+I K                   D    G++RE+ +
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHK---------------RKVMDKFD-GVKRELDV 241

Query: 85  MKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGV 144
           ++ LNHP +++L D +E N + Y+++E+   G+L + +   G + E       RQ++  V
Sbjct: 242 LQKLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAV 301

Query: 145 SYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            Y H  GI HRDLKP+N+++  D    IKI DFG+A ++ +   L T CG+  Y APE++
Sbjct: 302 KYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVI 361

Query: 203 SGIPYQG------FAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF-EMP 253
            G   +       ++S  D+WS G +++ +LTG LPF  +  N   L  ++++G + E P
Sbjct: 362 DGKNAEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGP 419

Query: 254 -SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
             D  IS EA++ I  +L VDP+ R+     L+HP ++
Sbjct: 420 LKDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  157 bits (398), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 139/230 (60%), Gaps = 9/230 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           EI I K + H N+++  D +E +T++Y++LE    G L +LL  R  L E E +RFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G V Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  + +   T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDD 256
           PE+++G  + G  +  D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G+F  P D 
Sbjct: 245 PEVLTG-KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDK 301

Query: 257 EISREAQDLIRKILTVDPERRIKTRDILKHPLLQK-YPSIRDSKSIRGLP 305
            IS EA  LI+ IL++DP  R    +I+ +   +  +PS  D+  +   P
Sbjct: 302 FISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  152 bits (385), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 143/271 (52%), Gaps = 20/271 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG GS G V+ AR  S+G+  A+K++ K      +V    +               
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQMLYD------------- 94

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A+R   QI
Sbjct: 95  ELSILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQI 154

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSPHY 196
           +  V Y H+  IVHRDLKPENLL         + + DFG+A  L+ + +L+  + GS  Y
Sbjct: 155 LKAVEYLHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGY 214

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+V+     G   D+WS GV+ + LL G  PF  E  +G +    +      F  P 
Sbjct: 215 VAPEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPY 273

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILK 285
              IS EA+D I + LTV+P  R    ++L+
Sbjct: 274 WSNISNEAKDFILRALTVNPHDRPTATELLQ 304

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  159 bits (402), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/282 (34%), Positives = 142/282 (50%), Gaps = 28/282 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALP 75
           +G +K+ + +G GS GKV LA +  T ++  +K                     T D   
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK---------------------TSDKND 76

Query: 76  YGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIR 135
             I RE+   +  + P + +LY+V  T + +++ LEY    EL++ L+    +   E   
Sbjct: 77  PNIVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGE 136

Query: 136 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPH 195
            F QI   V Y H++  VHRDLK EN+LLD   N K+ DFG          LET CG+  
Sbjct: 137 LFAQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTV 196

Query: 196 YAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSD 255
           Y APE++    Y GF  D+WS GVIL+ L+TG LPFD++D   +T    V     E P  
Sbjct: 197 YMAPELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EAKTKWKIVN----EEPKY 251

Query: 256 DE--ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI 295
           D   I  +A+DLI ++L  +P  R     +L+HP LQ Y S+
Sbjct: 252 DAKVIPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSV 293

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  157 bits (397), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 92/240 (38%), Positives = 142/240 (59%), Gaps = 12/240 (5%)

Query: 51  SKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S  VF    V+  SI    T   L      EI I K + HPN+++  D +E +T++Y++L
Sbjct: 94  SGKVFAAKTVAKISIKSEKTRKKL----LSEIQIHKSMKHPNIVQFTDCFEDDTNVYILL 149

Query: 111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDLKPENLLLDHKYN 169
           E    G L +LL +R  L E E +RFF   I+G + Y H+  I+HRDLK  N+  D  +N
Sbjct: 150 EICPNGSLMDLLKQRKQLTEPE-VRFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFN 208

Query: 170 IKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDVWSCGVILFALLT 226
           +KI DFG+AA L  + +   T CG+P+Y APE+++G  + G  F  D+WS GV+++ALL 
Sbjct: 209 LKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-KHTGHSFEVDIWSIGVMIYALLI 267

Query: 227 GRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
           G+ PF  ++ N  T+  +++  +F  P D  IS EA+ LI+ IL++DP  R    +I+++
Sbjct: 268 GKPPFQAKEVN--TIYERIKVCDFSFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  158 bits (399), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 150/283 (53%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  A K+ISK     GN+ G               + RE+
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKV-MGNMDG---------------VTREL 240

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ LNHP ++RL   +E +   YL++E+   G+L + +   G + E       RQ++ 
Sbjct: 241 EVLRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 300

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
           GV Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 301 GVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 201 IVSGIP----------YQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGE 249
           +++G            Y     D+WS G +++ +LTG LPF    G+ +  L K ++ G 
Sbjct: 361 VIAGKANAEENEKRNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGS 416

Query: 250 F-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           + E P  D  IS EA+D I  +L V+P  R   +  L+HP ++
Sbjct: 417 YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (397), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 140/252 (55%), Gaps = 12/252 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K ++HPN+++  D
Sbjct: 91  GGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKL----LSEIQIHKSMSHPNIVQFID 146

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E ++++Y++LE    G L  LL  R  L E E +RFF   I G + Y H+  ++HRDL
Sbjct: 147 CFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDL 205

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y APE++ G  + G  F  D+
Sbjct: 206 KLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDI 264

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+L+ALL G+ PF   D N  T+  +++  +F  P D  IS E + LIR IL++DP
Sbjct: 265 WSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDP 322

Query: 275 ERRIKTRDILKH 286
             R    +I+ +
Sbjct: 323 IERPSLTEIMDY 334

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 139/252 (55%), Gaps = 12/252 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + HPN+++  D
Sbjct: 91  GGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKL----LSEIQIHKSMAHPNIVQFVD 146

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E ++++Y++LE    G L  LL  R  L E E +RFF   I G + Y H+  ++HRDL
Sbjct: 147 CFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDL 205

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y APE++ G  + G  F  D+
Sbjct: 206 KLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDI 264

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+L+ALL G+ PF   D N  T+  +++  +F  P D  IS E + LIR IL++DP
Sbjct: 265 WSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDP 322

Query: 275 ERRIKTRDILKH 286
             R    +I+ +
Sbjct: 323 IERPSLTEIMDY 334

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 140/252 (55%), Gaps = 12/252 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K ++HPN+++  D
Sbjct: 91  GGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKL----LSEIQIHKSMSHPNIVQFID 146

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E ++++Y++LE    G L  LL  R  L E E +RFF   I G + Y H+  ++HRDL
Sbjct: 147 CFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQICGAIKYMHSRRVIHRDL 205

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y APE++ G  + G  F  D+
Sbjct: 206 KLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDI 264

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+L+ALL G+ PF   D N  T+  +++  +F  P D  IS E + LIR IL++DP
Sbjct: 265 WSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKPISDEGKILIRDILSLDP 322

Query: 275 ERRIKTRDILKH 286
             R    +I+ +
Sbjct: 323 IERPSLTEIMDY 334

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 133/210 (63%), Gaps = 8/210 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           EI I K + HPN+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I+G + Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDD 256
           PE+++G  + G  F  DVWS GV+++ALL G+ PF  ++ N  T+  +++  +F  P D 
Sbjct: 239 PEVLTG-KHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDK 295

Query: 257 EISREAQDLIRKILTVDPERRIKTRDILKH 286
            IS EA+ LI+ IL++DP  R    +I+++
Sbjct: 296 PISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  149 bits (377), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/257 (33%), Positives = 133/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPN 92
           V   R+  TG   A+KV+ KA     N+                   RE+ I   LNHPN
Sbjct: 105 VYCVRHKETGFICALKVMDKAEIVQYNLQKQ--------------FRREVEIQTSLNHPN 150

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152
           + +LY  +     +YL++EY   GEL+ LL   GP  +  A RF  QI   ++Y H   I
Sbjct: 151 LTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQI 210

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRDLKPEN+L+     IK+ DFG + +   G   +T CG+  Y +PE++    Y     
Sbjct: 211 IHRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KV 269

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTV 272
           DVW+ GV+ + L+ G  PF+E+   +     ++ K + + P  + +S + +DLI K+L  
Sbjct: 270 DVWALGVLTYELIVGSPPFEEDTKEL--TYKRILKNDIKFP--ETVSHDVKDLISKLLKY 325

Query: 273 DPERRIKTRDILKHPLL 289
           +P  RI  RD++KHP +
Sbjct: 326 NPSERISMRDVMKHPWI 342

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/208 (39%), Positives = 127/208 (61%), Gaps = 8/208 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           EI I K + HPN++   D +E +T++Y++LE    G L +L+ +R  L E E +RFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLE-TSCGSPHYAA 198
           I G V Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA+    +  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDD 256
           PE++ G  + G  F  D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D 
Sbjct: 258 PEVLMG-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDK 314

Query: 257 EISREAQDLIRKILTVDPERRIKTRDIL 284
            +S EA+ LI  IL VDP  R   R+I+
Sbjct: 315 YVSSEAKTLIADILCVDPVERPSIREII 342

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/252 (37%), Positives = 139/252 (55%), Gaps = 12/252 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + HPN+++  D
Sbjct: 91  GGFARCFQIKDDSGDIFAAKTVAKASIKSEKTRKKL----LSEIQIHKSMAHPNIVQFID 146

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E ++++Y++LE    G L  LL  R  L E E +RFF   I G + Y H+  ++HRDL
Sbjct: 147 CFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQICGAIKYMHSRRVIHRDL 205

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  E +   T CG+P+Y APE++ G  + G  F  D+
Sbjct: 206 KLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-KHSGHSFEVDI 264

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+L+ALL G+ PF   D N  T+  +++  +F  P D  IS E + LIR IL++DP
Sbjct: 265 WSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKPISDEGKILIRDILSLDP 322

Query: 275 ERRIKTRDILKH 286
             R    +I+ +
Sbjct: 323 IERPSLTEIMDY 334

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 150/279 (53%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG GS G V+ AR  STG+  AVK++ K     GN     +            +
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALK-GNCVQIEM------------L 84

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN++     +E+    Y+  + A  GELF+ ++ RG   E +A+R   
Sbjct: 85  YDELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIV 144

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSP 194
           Q++ G+ Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++   L+  + GS 
Sbjct: 145 QLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSL 204

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG----EF 250
            Y APE+++ +   G   D+WS GVI + LL G  PF  E  ++   L +   G    +F
Sbjct: 205 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKF 261

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
             P  D IS EA++ I + L ++P +R    ++L+ P +
Sbjct: 262 HRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  156 bits (395), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 147/283 (51%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  AVK+I+K     GN+ G               + RE+
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKV-MGNMDG---------------VTREL 240

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E       RQI+ 
Sbjct: 241 DVLRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 300

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 301 AVKYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 360

Query: 201 IVSG----------IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGE 249
           ++ G          I Y     D+WS G +++ +LTG LPF    G+ +  L K + +G 
Sbjct: 361 VIGGKNSAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGS 416

Query: 250 F-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           + E P  D  IS EA+D I  +L V P +R+     L HP ++
Sbjct: 417 YHEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  151 bits (381), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 145/270 (53%), Gaps = 22/270 (8%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ ARN    Q  A+K++ K       +                 +  
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQM---------------LYD 102

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q+
Sbjct: 103 ELSILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQM 162

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LD--HKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y
Sbjct: 163 LTAVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGY 222

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P 
Sbjct: 223 VAPEVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPY 281

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDIL 284
            + IS+EA+  I + LT+ P RR    ++L
Sbjct: 282 WNNISKEAKQFILRALTLTPARRPTAAELL 311

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 153/279 (54%), Gaps = 13/279 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + H NV++  D
Sbjct: 91  GGFARCFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLL----SEIQIHKSMKHQNVVQFID 146

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E +T++Y++LE    G L +LL +R  L E E +RFF   I G + Y H+  ++HRDL
Sbjct: 147 CFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQICGAIKYMHSRRVIHRDL 205

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y APE++ G  + G  +  D+
Sbjct: 206 KLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMG-KHSGHSYEVDI 264

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+L+ALL G+ PF  +D N  T+  +++  +F  P +  IS EA+ LI+ +L++DP
Sbjct: 265 WSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKHISNEAKVLIQDLLSLDP 322

Query: 275 ERRIKTRDILKHPLLQK-YPSIRDSKSIRGLPREDTYLT 312
             R    +I+ +   +  +P   +S  +  +P  D  LT
Sbjct: 323 LERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTLT 361

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  150 bits (380), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 148/279 (53%), Gaps = 21/279 (7%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREII 83
           TLG GS G V+ A+   + ++ AVK++ K              G   P      I  E+ 
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKN--------GGLEP------IYDELN 115

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG 143
           I++ L+HPN+++  D +ET +  Y+V + A  GELF+ ++  G   E +A+    QI+  
Sbjct: 116 IIQHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKA 175

Query: 144 VSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHYAAP 199
           V Y H+  I+HRDLKPENLL LD   +  I +ADFG+A  LE +  ++    GS  Y AP
Sbjct: 176 VEYLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAP 235

Query: 200 EIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPSDDE 257
           E+ +   + G  SD+WS GVI + LL G  PF  E  DG +  +       +F+ P  D 
Sbjct: 236 EVFTSDGH-GKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDG 294

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIR 296
           IS  A++ I +IL +DP  R    ++L  P +Q   S+R
Sbjct: 295 ISELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 147/281 (52%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  AVK+ISK     GN+ G S               RE+
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKV-MGNMEGVS---------------REL 242

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++RL   +E     Y+V+E+   G+L + +   G + E       RQI+ 
Sbjct: 243 EVLQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILE 302

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H+ GI HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 303 AVKYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 362

Query: 201 IVSGI--------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGEF- 250
           ++ G          Y     D+WS G +++ +LTG LPF    G+ +  L K + +G + 
Sbjct: 363 VIGGKGETNEERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYH 418

Query: 251 EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           E P  D  IS EA+  I  +L V+P  R+     L+HP ++
Sbjct: 419 EGPLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/279 (33%), Positives = 151/279 (54%), Gaps = 24/279 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           ++ G+TLG GS G V+ A   S  +E A+K++ K       V    +             
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQMLYD----------- 75

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I+K L+HPN++   + +ET+  +Y+V + A  GELF+ ++++G   E +A++   
Sbjct: 76  --ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILI 133

Query: 139 QIIIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMAALETEG-KLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPENLL L  K +  + IADFG+A    +G +L+  + GS 
Sbjct: 134 QILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSL 193

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE----F 250
            Y APE+++ +   G   D+WS GVI + LL+G   F  E   +   L +   G+    F
Sbjct: 194 GYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKF 250

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
             P  D IS +A++ I K L ++P++R    ++L  P +
Sbjct: 251 HKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 154/287 (53%), Gaps = 24/287 (8%)

Query: 11  IKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTT 70
           +  N    +  G+TLG G+ G V+ AR  ST ++ AVK++ K       + G S+     
Sbjct: 24  VASNAKTDYIFGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKA-----LEGNSVQLQML 78

Query: 71  PDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPE 130
            D        E+ I++ LNHPN++   D +ET    ++V + A  GELF+ +V++G   E
Sbjct: 79  YD--------ELSILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTE 130

Query: 131 HEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKL 186
            +AI+   QI+  V Y H+  IVHRDLKPENLL   + +   + +ADFG+A  L++  +L
Sbjct: 131 EDAIKILVQILGAVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDEL 190

Query: 187 LETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQ 246
           +  + GS  Y APE+++   + G   D+WS GVI + LL G   F  E  ++   L +  
Sbjct: 191 IFKAAGSLGYVAPEVLTSDGH-GKPCDIWSIGVITYTLLCGYSAFAAE--SVEGFLDECT 247

Query: 247 KGE----FEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           + +    F  P  D +S +A+  I + LT+DP +R     +L+ P +
Sbjct: 248 QNDKPVVFHKPYWDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  150 bits (380), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 149/273 (54%), Gaps = 20/273 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           ++ G+TLG GS G V+ A+  S+ +E AVK++ K       +    +             
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRMLY------------ 78

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
            +E+ I+K L+H N++   + +ET+  LY+V + A  GELF+ ++  G   E +A++   
Sbjct: 79  -QELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIV 137

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPENLL    +    + IADFG+A  L++  +L+  + GS 
Sbjct: 138 QILSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSL 197

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEM 252
            Y APE+++ +   G   D+WS GVI + LL G   F  E  +G +   +   Q  +F+ 
Sbjct: 198 GYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQK 256

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
           P  D IS+ A++ I K L + PE+R    ++LK
Sbjct: 257 PYWDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 89/239 (37%), Positives = 136/239 (56%), Gaps = 10/239 (4%)

Query: 51  SKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S  +F    V+  SI    T   L      EI I K + H N+++  D +E +T++Y++L
Sbjct: 116 SGKIFAAKTVAKISIKSEKTRKKL----LSEIQIHKSMKHVNIVQFIDCFEDDTNVYILL 171

Query: 111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNI 170
           E    G L +LL +R  L E E   F  QI   + Y H+  ++HRDLK  N+  D KYN+
Sbjct: 172 EICPNGSLMDLLKKRKSLTEPEVRFFTTQICGAIKYMHSRKVIHRDLKLGNIFFDRKYNL 231

Query: 171 KIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDVWSCGVILFALLTG 227
           KI DFG+AA L  + +   T CG+P+Y APE++ G  + G  +  D+WS GV+++AL+ G
Sbjct: 232 KIGDFGLAATLANDRERKYTVCGTPNYIAPEVLMG-KHSGHSYEVDIWSIGVMIYALIIG 290

Query: 228 RLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
           R PF  +D N  T+  +++  +F  P D  IS EA+ LI+ IL++DP  R    +I+ +
Sbjct: 291 RPPFQSKDVN--TIYERIKCRDFSFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDY 347

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  149 bits (376), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 145/274 (52%), Gaps = 20/274 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +++G  LG G  GKV   ++  +G  +A+KV+ K    + N                   
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ--------------F 220

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF-NLLVERGPLPEHEAIRFF 137
           +RE+ +   LNHPN+++++  ++    +YL++EY   GEL+ +L    GP  +  A  + 
Sbjct: 221 KREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYI 280

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            QI   + Y H+  I+HRD+KPEN++L     IK+ADFG +         +T CG+  Y 
Sbjct: 281 YQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYL 340

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           APE+V+   Y  +  D+W+ G++ + L+ G  PF+EE  ++     ++   +   P    
Sbjct: 341 APELVTFKEYD-YNVDIWALGILTYELIVGNPPFEEETKDL--TYKRIINVDLNFP--QT 395

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +S +A+DLI ++L  DP +R+   D++KHP + K
Sbjct: 396 VSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  149 bits (377), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 143/275 (52%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      NV    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ +  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPY 274

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS +A+  I K L +DP  R    ++L  P +
Sbjct: 275 WDSISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 149/283 (52%), Gaps = 35/283 (12%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  AVK+ISK            ++G+        G+ RE+
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISK----------RKVMGNMD------GVTREL 244

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E       RQI+ 
Sbjct: 245 EVLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 304

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H+  I HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 305 AVKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPE 364

Query: 201 IVSG----------IPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGE 249
           I+SG            Y     D+WS G +++ +LTG LPF    G+ +  L K V+ G 
Sbjct: 365 IISGSNNLEENEERNEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGS 420

Query: 250 F-EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           + E P  D  IS EA++ I  +L V+P  R+     L+HP ++
Sbjct: 421 YHEGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  147 bits (370), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 148/281 (52%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  +     +  T+         
Sbjct: 59  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTN--------- 109

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                  E  ++KL+ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 110 ------DERRMLKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVA 163

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A   T   +  T CG+
Sbjct: 164 KFYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT--TVTWTLCGT 221

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS G++++ +L G  PF   D        K+  G    P
Sbjct: 222 PDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYP 278

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
           S    + +  DL+ K++T D  RRI      T++I  HP  
Sbjct: 279 S--FFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/258 (34%), Positives = 143/258 (55%), Gaps = 14/258 (5%)

Query: 34  QLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNV 93
           Q    G   +   +K  S  +F    V+  SI    T   L      EI I K ++H N+
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLL----SEIQIHKSMSHTNI 140

Query: 94  LRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIV 153
           ++  D +E N ++Y++LE    G L  L+ +R  + E E   F  QI  G+ Y H+  ++
Sbjct: 141 VQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQICGGIQYMHSNRVI 200

Query: 154 HRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHYAAPEIVSGIPYQG- 209
           HRDLK  N+  D  YN+KI DFG+AA+   + E K   T CG+P+Y APE++ G  + G 
Sbjct: 201 HRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPNYIAPEVLMG-KHSGH 257

Query: 210 -FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRK 268
            +  D+WS GV+L+ALL G+ PF  +D N  T+  ++++  F  P D +IS++A+ LI  
Sbjct: 258 SYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKISQDAKYLIDD 315

Query: 269 ILTVDPERRIKTRDILKH 286
           IL+++P  R   ++I+ +
Sbjct: 316 ILSLNPMERPSIQEIMDY 333

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  146 bits (368), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 97/289 (33%), Positives = 150/289 (51%), Gaps = 19/289 (6%)

Query: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
           MA    ++P  K  ++  ++LG+ LG G  GKV   R+ STG   A+KV+ K      N+
Sbjct: 86  MAHENKNLPKFKSLSLDDFELGKKLGKGKFGKVYCVRHRSTGFICALKVMEKEEIIKYNL 145

Query: 61  SGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFN 120
                              RE+ I   LNHPN+ + Y  +     +YL++EY   GE++ 
Sbjct: 146 QRQ--------------FRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYK 191

Query: 121 LLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL 180
           LL   GP  +  A  +  QI   + Y H   I+HRD+KPEN+L+     IK+ DFG + +
Sbjct: 192 LLRSHGPFNDILASDYVYQIANALDYMHKKNIIHRDIKPENILIGFNNIIKLTDFGWSII 251

Query: 181 ETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRT 240
                  +T CG+  Y +PE++    Y     D W+ GV+ F LLTG  PF+EE  +  T
Sbjct: 252 NPPDSRRKTVCGTIDYLSPEMIESREYDH-TIDAWALGVLAFELLTGAPPFEEEMKD--T 308

Query: 241 LLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
              ++   + ++PS+  IS++AQDLI K+L  DP+ R++  D+  HP +
Sbjct: 309 TYKRIAALDIKIPSN--ISQDAQDLILKLLKYDPKDRMRLEDVKMHPWI 355

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  146 bits (368), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 132/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPN 92
           V   R+ STG   A+KV+ K      N+                   RE+ I   LNHPN
Sbjct: 118 VYCVRHRSTGYICALKVMEKEEIIKYNLQKQ--------------FRREVEIQTSLNHPN 163

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152
           + + Y  +     +YL++EY   GE++ LL   GP  +  A  +  QI   + Y H   I
Sbjct: 164 LTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNI 223

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE+V    Y     
Sbjct: 224 IHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDH-TI 282

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTV 272
           D W+ GV+ F LLTG  PF+EE  +  T   ++   + +MPS+  IS++AQDLI K+L  
Sbjct: 283 DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIKMPSN--ISQDAQDLILKLLKY 338

Query: 273 DPERRIKTRDILKHPLL 289
           DP+ R++  D+  HP +
Sbjct: 339 DPKDRMRLGDVKMHPWI 355

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     V  T+         
Sbjct: 68  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 119

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 120 -----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVA 172

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 173 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 230

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 231 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 287

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 288 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     V  T+         
Sbjct: 66  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 117

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 118 -----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVA 170

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 171 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 228

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 229 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP 285

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 286 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 142/275 (51%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      N+    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ +  L+  + GS  Y
Sbjct: 156 LGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS +A+  I K L ++P  R    ++L  P +
Sbjct: 275 WDNISVDAKRFILKALILNPADRPTATELLDDPWI 309

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 150/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     V  T+         
Sbjct: 67  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 118

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 119 -----ERRM--LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVA 171

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y HA  I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 172 KFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 229

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 230 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 286

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 287 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 148/278 (53%), Gaps = 20/278 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG GS G V+ A+  ST +  AVK+I K      +V    +             
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGNDVQLQMLYD----------- 95

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++RG   E +A++   
Sbjct: 96  --ELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIII 153

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMAALETEG-KLLETSCGSP 194
           Q++  + Y H+  IVHRDLKPEN+L         + IADFG+A    +G  L+  + GS 
Sbjct: 154 QMLKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQLVIADFGIAKELKDGDDLIFKAAGSL 213

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEM 252
            Y APE+++   + G   D+WS GVI + LL G   F  E  +G +      +   +F  
Sbjct: 214 GYVAPEVLTTNGH-GKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHE 272

Query: 253 PSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           P  + +SREA++ I K LT++P+ R    ++L  P ++
Sbjct: 273 PYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 83/260 (31%), Positives = 136/260 (52%), Gaps = 19/260 (7%)

Query: 32  KVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHP 91
           +V   R+  TG   A+KV+ K      NV                   RE+ I   LNH 
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQEIMQYNVQKQ--------------FRREVEIQSSLNHQ 167

Query: 92  NVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALG 151
           N+ +LY  +  +  +YL++EY   GEL+ LL  +GPL +  A  +  Q+   + Y H   
Sbjct: 168 NLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRN 227

Query: 152 IVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA 211
           I+HRD+KPEN+L+     +K+ DFG + +   G   +T CG+  Y +PE+++   Y    
Sbjct: 228 IIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-K 286

Query: 212 SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILT 271
            DVW+ GV+ F L+    PF+E+   + +   ++ +G+ + P  + IS +AQDLI K+L 
Sbjct: 287 VDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NHISSDAQDLITKLLR 342

Query: 272 VDPERRIKTRDILKHPLLQK 291
            + + RI  R++ +HP + K
Sbjct: 343 HNSKDRISLREVKQHPWITK 362

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  153 bits (386), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 106/336 (31%), Positives = 166/336 (49%), Gaps = 46/336 (13%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   +TG+  AVK+I+K     GNV G               + RE+
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKV-MGNVDG---------------VTREL 264

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ LNHP ++ L   +E +   YL++E+   G+L + +   G + E       RQI+ 
Sbjct: 265 EVLRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 324

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H  GI HRDLKP+N+L+  D    +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 325 AVRYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPE 384

Query: 201 IVSGIPYQGFAS---------DVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGEF 250
           ++ G   +G  +         D+WS G +++ +LTG LPF    G+ +  L K +  G +
Sbjct: 385 VIGGKNPEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSY 441

Query: 251 -EMPSDDE-ISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSI------------R 296
            E P  D  IS EA+D I  +L ++P  R+     L+HP L    SI             
Sbjct: 442 HEGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSIGAEIAVSLSQSLS 501

Query: 297 DSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
            ++++ G+  E  YL   SE  S+  A   +  VIL
Sbjct: 502 QARALEGMD-EAEYLVAQSEVASNRKAPTHEKRVIL 536

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 123/214 (57%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
           + REI I  +LNHPN+ +LY  +     +Y+V+EY  +GEL+ LL   GP  +  A  + 
Sbjct: 147 VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYV 206

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            QI   + Y H   I+HRD+KPEN+L+     +K+ DFG + +  +G   +T CG+  Y 
Sbjct: 207 YQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYL 266

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           +PEI++   Y     D+W+ GV+ + L+ G   F+EE   +     ++ KGE + P  + 
Sbjct: 267 SPEIITSKEYD-HTVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EH 321

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +    +DLI++IL ++P +R+  ++I +HP + K
Sbjct: 322 LPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 118/214 (55%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
             RE+ I   L HPN+ RLY  +     +YL++EY   GEL+  L   GP  +  A  F 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFV 227

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            Q+   ++Y H+  I+HRD+KPEN+LL  +  +K+ DFG +         +T CG+  Y 
Sbjct: 228 HQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYL 287

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           +PE++    Y     DVW+ GV+ + LL G  PF+E+   +     ++ K +   P  D+
Sbjct: 288 SPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQ 342

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +S  A+DLI ++L  DP+ RI  +D+ +HP ++K
Sbjct: 343 VSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.336
           YBR274W
          Length = 534

 Score =  149 bits (377), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 155/311 (49%), Gaps = 42/311 (13%)

Query: 8   IPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQE--AAVKVISKAVFNTGNVSGTSI 65
           +P IKD  IG     ET+G GS G V+ AR   + Q    A+K I               
Sbjct: 9   LPKIKDVIIG-----ETIGQGSFGIVKSARIKDSNQNNIFAIKFIH-------------- 49

Query: 66  VGSTTPDALPYGI-EREI-----IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
                P A   GI EREI     I MK  NHPN+L+  D   TN  L++VLE A+ G+LF
Sbjct: 50  ----LPSANDKGITEREISREVSIHMKCSNHPNILKFIDCNVTNKFLWMVLEMADGGDLF 105

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCH-ALGIVHRDLKPENLLLDHKYNIKIADFGMA 178
           + +     +  H A  +F+Q+I  + Y H   GI HRD+KPEN+LLD   N+K+ADFG+A
Sbjct: 106 DKIEPDYGVDSHIAQFYFQQLIRALDYLHNTCGIAHRDIKPENILLDKDGNLKLADFGLA 165

Query: 179 AL----ETEGKLLETSCGSPHYAAPEIVS-GIPYQGFASDVWSCGVILFALLTGRLPFD- 232
           +     +   +L     GSP Y APEI++   PY    +D+WS GV+LF LL G++P++ 
Sbjct: 166 SSFKRKDGTMRLSHDQRGSPPYMAPEILTLNSPYHANITDIWSVGVLLFVLLAGQVPWEL 225

Query: 233 --EEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
              ED +    +     G        +I  +  +L+RKIL  DP +R     +  H    
Sbjct: 226 PVNEDSDYNAFI--KNNGNINAGPWSKIKLDQLNLLRKILHSDPSKRATLTTLKSHRWFL 283

Query: 291 KYPSIRDSKSI 301
           K     +SK +
Sbjct: 284 KKNMYANSKGL 294

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 149/277 (53%), Gaps = 28/277 (10%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDALPYG 77
           +++  TLG GS G+V L R+   G+  A+KV+ K  +     +  T+             
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEHTND------------ 140

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
            ER +  +KL+ HP ++RL+  ++ + +L++V++Y E GELF+LL +    P   A  + 
Sbjct: 141 -ERRM--LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYA 197

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            ++++ + Y HA  I++RDLKPEN+LLD   +IK+ADFG A  +    +  T CG+P Y 
Sbjct: 198 AEVVLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYI 255

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P    
Sbjct: 256 APEVIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFPQG-- 310

Query: 258 ISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
              +  DL+ +++T D  +R+      +RD+  HP  
Sbjct: 311 FHPDVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  147 bits (372), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 142/275 (51%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      NV    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS + +  I K L ++P  R    ++L  P +
Sbjct: 275 WDNISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/272 (32%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  V     +  T+                E 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN---------------DER 92

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            ++KL++HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A  +  ++I+
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y HA  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE++
Sbjct: 153 ALEYLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVI 210

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREA 262
           +  PY   + D WS G+++F +L G  PF   D        K+ +G+   P       + 
Sbjct: 211 ATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDV 265

Query: 263 QDLIRKILTVDPERRIKT-----RDILKHPLL 289
            DL+ K++T D  RR+       +D+  HP  
Sbjct: 266 VDLLSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  153 bits (386), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/230 (34%), Positives = 130/230 (56%), Gaps = 19/230 (8%)

Query: 106 LYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLD 165
            Y++ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK EN+++ 
Sbjct: 8   FYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIMIS 67

Query: 166 HKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALL 225
               IKI DFG++ +    K L T CGS ++AAPE++   PY G   DVWS GV+LF L+
Sbjct: 68  TSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFVLV 127

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILK 285
            G++PFD+E+ ++  L  K+++G+ E P    +S E   L+ K+L VDP +R   + ++ 
Sbjct: 128 CGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQVVN 183

Query: 286 HPLLQK---YPSIRDSKSIRGLPREDTYLTPLSESNSSIDATILQNLVIL 332
           H  +Q+   +P+          P    +  PL+    ++DAT+++ +  L
Sbjct: 184 HQWMQRGYDFPA----------PSYIPHRVPLTA--DALDATVIKEMYRL 221

>Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}
           similar to Ashbya gossypii ACR142W
          Length = 872

 Score =  152 bits (385), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 144/281 (51%), Gaps = 31/281 (11%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A    TG+  AVK+ISK     GNV G               + RE+
Sbjct: 194 EVVGQGAFATVKKAVERKTGKTFAVKIISKRKV-MGNVEG---------------VTREL 237

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            ++  LNHP ++ L   +E     YL++E+   G+L + +   G + E       RQI+ 
Sbjct: 238 EVLHRLNHPRIVSLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILE 297

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V Y H   I HRDLKP+N+L+  D    +KI DFG+A ++  G  ++T CG+  Y APE
Sbjct: 298 AVKYIHQQEISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPE 357

Query: 201 IVSG-------IPYQGFAS--DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF- 250
           ++ G       +    ++S  D+WS G +++ +LTG LPF         L  ++ +G + 
Sbjct: 358 VIDGKSLEEKSVNKNLYSSLVDMWSIGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYH 415

Query: 251 EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           E P  D +IS EA+D I  +L V+P  R+     LKHP +Q
Sbjct: 416 EGPLKDFKISDEARDFIDALLQVNPRDRLTAAKALKHPWIQ 456

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  145 bits (366), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/257 (32%), Positives = 132/257 (51%), Gaps = 19/257 (7%)

Query: 33  VQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPN 92
           V   R+ STG   A+KV+ K      N+                   RE+ I   LNHPN
Sbjct: 118 VYCVRHKSTGYICALKVMEKEEIIRYNLQRQ--------------FRREVEIQMSLNHPN 163

Query: 93  VLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGI 152
           + + Y  +     +YL++EY   GE++ LL   GP  +  A  +  QI   + Y H   I
Sbjct: 164 LTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHKKNI 223

Query: 153 VHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS 212
           +HRD+KPEN+L+     IK+ DFG + +       +T CG+  Y +PE++    Y     
Sbjct: 224 IHRDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTVCGTIDYLSPEMIESREYDH-TI 282

Query: 213 DVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTV 272
           D W+ G++ F LLTG  PF+EE  +  T   ++   + ++PS+  +S++AQDLI K+L  
Sbjct: 283 DAWALGILAFELLTGAPPFEEEMKD--TTYKRIAALDIKIPSN--VSQDAQDLILKLLKY 338

Query: 273 DPERRIKTRDILKHPLL 289
           DP+ R++  D+  HP +
Sbjct: 339 DPKDRMRLEDVKMHPWI 355

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  146 bits (368), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 80  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTN--------- 130

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                  E  ++KL+ HP ++R++  ++   +L++V++Y E GELF+LL +    P   A
Sbjct: 131 ------DERRMLKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVA 184

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++++ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+
Sbjct: 185 KFYAAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-SVTWTLCGT 242

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS G+++F +L G  PF   D        K+ +G+   P
Sbjct: 243 PDYIAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP 299

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
                  +  DL+ K++T D  RRI      ++DI +HP  
Sbjct: 300 P--FFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  151 bits (382), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 136/251 (54%), Gaps = 10/251 (3%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + H NV++  D
Sbjct: 100 GGFARCFQIKDESGKIFAAKTVAKISIKSEKTRKKLL----SEIQIHKSMRHFNVVQFID 155

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLK 158
            +E +T++Y++LE    G L  LL +R  + E E   F  QI   + Y H+  ++HRDLK
Sbjct: 156 CFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQICGAIKYMHSRRVIHRDLK 215

Query: 159 PENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDVW 215
             N+  D  YN+KI DFG+AA L  + +   T CG+P+Y APE++ G  + G  +  D+W
Sbjct: 216 LGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMG-KHSGHSYEVDIW 274

Query: 216 SCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPE 275
           S GV+++ALL G+ PF  +D N+  +  +++  +F  P D  IS EA+ LI  IL+ DP 
Sbjct: 275 SIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEAKTLIHDILSTDPL 332

Query: 276 RRIKTRDILKH 286
            R    +I+ +
Sbjct: 333 ERPSIEEIIDY 343

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  151 bits (381), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 136/239 (56%), Gaps = 10/239 (4%)

Query: 51  SKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVL 110
           S  +F    V+  SI    T   L      EI I K + HPN+++  D +E +T++Y++L
Sbjct: 98  SGKIFAAKTVAKISIKSEKTRKKLL----SEIQIHKSMKHPNIVQFIDCFEDDTNVYILL 153

Query: 111 EYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNI 170
           E    G L +LL +R  L E E   F  QI+  + Y H   ++HRDLK  N+  D  YN+
Sbjct: 154 EICPNGSLMDLLKKRKVLTEPEVRYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNL 213

Query: 171 KIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDVWSCGVILFALLTG 227
           KI DFG+AA L  + +   T CG+P+Y APE+++G  + G  +  D+WS GV+++ALL G
Sbjct: 214 KIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLAG-KHSGHSYEVDIWSIGVMIYALLIG 272

Query: 228 RLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKH 286
           + PF  ++ NI  +  +++ G++  P +   S+E   LI+ IL++DP  R    +I+ +
Sbjct: 273 KPPFQAKEVNI--IYERIKSGDYIFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDY 329

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  151 bits (381), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 88/237 (37%), Positives = 140/237 (59%), Gaps = 9/237 (3%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           EI I K + + N+++  D +E +T++Y++LE    G L +LL +R  L E E +RFF   
Sbjct: 130 EIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 188

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAA 198
           I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y A
Sbjct: 189 ICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 248

Query: 199 PEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDD 256
           PE++ G  + G  +  D+WS GV+L+ALL G+ PF  +D N  T+  +++  +F  P D 
Sbjct: 249 PEVLMG-KHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDK 305

Query: 257 EISREAQDLIRKILTVDPERRIKTRDILKHPLLQK-YPSIRDSKSIRGLPREDTYLT 312
            IS EA+ LI+ +L++DP  R    +I+ +   +  +P   +S  +  +P  D  LT
Sbjct: 306 YISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQLT 362

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  144 bits (364), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 143/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ KA V     +  T+              ER +
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTND-------------ERRM 102

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
             +KL+ HP ++R++  ++ + +L++V++Y E GELF LL +    P   A  +  ++ +
Sbjct: 103 --LKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTL 160

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H   I++RDLKPEN+LLD   +IKI DFG A  E E  +  T CG+P Y APE++
Sbjct: 161 ALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVI 218

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREA 262
           +  PY   + D WS GV+++ +L G  PF   D        K+  G+   P     + + 
Sbjct: 219 ATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQ--FFNSDV 273

Query: 263 QDLIRKILTVDPERRI-----KTRDILKHPLL 289
            DL+ K+LT D  RRI       +DI  HP  
Sbjct: 274 IDLLSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  145 bits (367), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 123/214 (57%), Gaps = 5/214 (2%)

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
             RE+ I   LNHPN+ +LY  +  +  +YL++EY   GEL+ LL   GP  +  A RF 
Sbjct: 199 FRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFV 258

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            QI   +++ H  GI+HRDLKPEN+L+     +K+ DFG + +  +G   +T CG+  Y 
Sbjct: 259 YQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYL 318

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           +PE++    Y     DVW+ GV+ + L+ G  PF+E+   +     ++ KGE   P    
Sbjct: 319 SPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRFPG--T 373

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           +S++ +DLI ++L  DP+ RI  ++++ HP + +
Sbjct: 374 VSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  146 bits (369), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 94/275 (34%), Positives = 143/275 (52%), Gaps = 20/275 (7%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G TLG GS G V+ AR  ST ++ A+K++ K      NV    +               
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLY-------------E 95

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E+ I++ L+HPN++   D +E+    Y+V + A  GELF+ ++ RG   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQI 155

Query: 141 IIGVSYCHALGIVHRDLKPENLL-LDHKYN--IKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  V Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ +  L+  + GS  Y
Sbjct: 156 LGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +           F +P 
Sbjct: 216 VAPEVLTQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPY 274

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            D IS +A+  I K L ++P  R    ++L  P +
Sbjct: 275 WDNISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 32/281 (11%)

Query: 23  ETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           E +G G+   V+ A   STG+  A K+ISK     GN  G               ++RE+
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKL-MGNWDG---------------VDREL 233

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            +++ L+HP ++RL   +E     YL++E+   G+L + +   G + E       RQ++ 
Sbjct: 234 AVLRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLE 293

Query: 143 GVSYCHALGIVHRDLKPENLLL--DHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPE 200
            V+Y H+ GI HRDLKP+N+L+  D    +K+ DFG+A ++  G  ++T CG+  Y APE
Sbjct: 294 AVAYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPE 353

Query: 201 IVSGI---------PYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEF- 250
           ++ G           Y     D+WS G +++ +LTG LPF         L  ++ +G + 
Sbjct: 354 VIGGKNDNTEEEKNEYSSLV-DMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYH 410

Query: 251 EMPSDD-EISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290
           E P  D  IS EA+D I  +L V+P  R      L+HP ++
Sbjct: 411 EGPLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  146 bits (369), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 146/271 (53%), Gaps = 22/271 (8%)

Query: 21  LGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIER 80
            G+TLG G+ G V+ ARN +  ++ AVK++ K       ++                +  
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKGDELNM---------------LYD 100

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           E++I++ L+HP++++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q+
Sbjct: 101 ELMILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQM 160

Query: 141 IIGVSYCHALGIVHRDLKPENLLL---DHKYNIKIADFGMA-ALETEGKLLETSCGSPHY 196
           +  + Y H+  +VHRDLKPEN+L         + I+DFG+A  L +E  L+  + GS  Y
Sbjct: 161 LEAIEYMHSKNVVHRDLKPENVLYLNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMGY 220

Query: 197 AAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEE--DGNIRTLLLKVQKGEFEMPS 254
            APE+++   + G   D+WS GVI + LL G  PF  E  +G +  +        F  P 
Sbjct: 221 VAPEVLTTSGH-GKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFHKPY 279

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILK 285
            + IS EA++ I K LT+DP  R    ++L+
Sbjct: 280 WNSISVEAKEFILKALTLDPSERPTATELLQ 310

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 144/273 (52%), Gaps = 26/273 (9%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREII 83
           TLG GS G+V L R+   G+  A+KV+ K +     V     V  T  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEI-----VVRLKQVEHTNDERL--------- 137

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG 143
           ++ ++ HP ++R++  ++ +  ++++++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 144 VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVS 203
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 204 GIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQ 263
             PY   + D WS G++++ +L G  PF   D N      K+   E   P     + + +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPP--FFNEDVK 310

Query: 264 DLIRKILTVDPERRI-----KTRDILKHPLLQK 291
           DL+ +++T D  +R+      T D+  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  148 bits (373), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 104/313 (33%), Positives = 164/313 (52%), Gaps = 27/313 (8%)

Query: 1   MAINGNSIPAIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNV 60
           M     S+P IKD      +LG T+G GS G V+ AR      +++V V  K V    ++
Sbjct: 1   MVFTQESLPVIKDV-----ELGGTIGEGSFGCVRSAR---LKFDSSVVVAVKFV----HL 48

Query: 61  SGTSIVGSTTPDALPYGIEREIIIM-KLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELF 119
              +  G +  D     + RE+++  K   H NVLR+ D       L+++LE A+ G+LF
Sbjct: 49  PTCAESGLSQKD-----VSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLF 103

Query: 120 NLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAA 179
           + +     +    A  +F+Q+I  ++Y H +G+ HRD+KPEN+LLD K N+K+ADFG+A+
Sbjct: 104 DKIEPDVGVDPDVAQFYFQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLAS 163

Query: 180 -LETEGKLLETSC---GSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFD--- 232
               +   L  S    GSP Y APEI+S   Y    +D+WS GV+LF LLTG +P+    
Sbjct: 164 QFRRKDGTLRVSTDQRGSPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPA 223

Query: 233 EEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKY 292
           +ED N    +    +G+  +   + +     +L+RKIL  DP +R+    +  HP L   
Sbjct: 224 KEDDNYEWFV--NNEGKVSLGPWERVELRQMNLLRKILQPDPRKRVSLEKLRHHPWLTSR 281

Query: 293 PSIRDSKSIRGLP 305
             + +S+ +   P
Sbjct: 282 SKLANSEGLCNNP 294

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score =  144 bits (363), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 137/264 (51%), Gaps = 19/264 (7%)

Query: 32  KVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHP 91
           +V   ++  TG   A+K + K+     NV                   RE+ I   L+HP
Sbjct: 129 RVYCVKHKKTGFICAMKAMEKSELVQYNVQKQ--------------FRREVEIQSSLSHP 174

Query: 92  NVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALG 151
           N+ +LY  +  +  +YL++EY   GEL+ +L  RGP  +  A  +  Q+   + + H   
Sbjct: 175 NLTKLYGFFHDDKRVYLLMEYLVNGELYKVLKARGPFNDIVASHYVYQMADALDFMHQKN 234

Query: 152 IVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA 211
           I+HRD+KPEN+L+     +K+ DFG + +   G   +T CG+  Y +PE+++   Y    
Sbjct: 235 IIHRDVKPENILMGFGNVVKLTDFGWSIISARGVRRKTLCGTIDYLSPELITSREYDD-K 293

Query: 212 SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILT 271
            DVW+ GV+ + L+    PF+E+  +  +   ++  G+ + P  D IS +AQDLIRK+L 
Sbjct: 294 VDVWALGVLTYELIVNSPPFEEDSKD--STYKRIVSGDLKFP--DTISSDAQDLIRKLLR 349

Query: 272 VDPERRIKTRDILKHPLLQKYPSI 295
              + RI  +D+ +HP + K+ S 
Sbjct: 350 HKAKDRISLQDVKRHPWILKHKSF 373

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  V     +  T+         
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTN--------- 90

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                  E  ++KL+ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 91  ------DERRMLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 144

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++ +G+ Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG 
Sbjct: 145 KFYAAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGP 202

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS GV++F +L G  PF   D        K+ +G+   P
Sbjct: 203 PDYIAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP 259

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
           +      +  DL+ K++T D  RRI      ++DI  HP  
Sbjct: 260 T--FFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWF 298

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/293 (29%), Positives = 146/293 (49%), Gaps = 26/293 (8%)

Query: 4   NGNSIPAIKDN-------TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFN 56
           +G  +P + D+       T+  +++G+ LG G  GKV   ++  TG   A+K + K    
Sbjct: 78  HGTRVPILNDHNDKFENMTLQDFEIGKILGKGKFGKVYCVKHRETGLICALKAMEKK--- 134

Query: 57  TGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKG 116
                   IV  T          RE+ I     H N+ +LY  +     +YL++EY   G
Sbjct: 135 -------EIVQYTIQKQF----RREVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYG 183

Query: 117 ELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFG 176
           EL+  L   GPL E  A  F  Q+   + Y H+  I+HRD+KPEN+L+     IK+ DFG
Sbjct: 184 ELYKFLKNNGPLNETLASYFVYQMANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFG 243

Query: 177 MAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG 236
            +    +G+  +T CG+  Y +PE++    Y     DVW+ GV+ + LL G  PF+E+  
Sbjct: 244 WSVYNEDGQKRKTLCGTIDYLSPELIKSREYNN-KVDVWALGVLTYELLVGSPPFEEDTK 302

Query: 237 NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            +     ++ + + + P +  +S +A+DLI ++L  +P +RI   ++  H  +
Sbjct: 303 EM--TYRRILRCDLKFPLN--VSPQARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {ON}
           Anc_1.182
          Length = 408

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 143/261 (54%), Gaps = 23/261 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNVSGTSIVGSTTPDALPYG 77
           +++  TLG GS G+V L R+   G+  A+KVI K  V     +  T+             
Sbjct: 98  FQIMRTLGTGSFGRVHLVRSIHNGRFYALKVIKKNTVVRLKQIEHTN------------- 144

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
              E  ++ ++NHP ++R++  ++ +  ++++++Y E GELF+LL      P   A  + 
Sbjct: 145 --DERRMLSVVNHPFLVRMWGTFQDSEQIFMIMDYIEGGELFSLLRRSQKFPNPVAKFYA 202

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            ++ + + Y H+L I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y 
Sbjct: 203 AEVCLALEYLHSLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYI 260

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           APE+VS  PY   + D WS G++++ +L+GR PF +    I+T    +       PS   
Sbjct: 261 APEVVSSKPYNK-SVDWWSFGILIYEMLSGRTPFYDR-STIKT-YENILSAPLTFPS--Y 315

Query: 258 ISREAQDLIRKILTVDPERRI 278
           +  + QDL+ +++T D  +R+
Sbjct: 316 LHEDVQDLLNRLITRDLSKRL 336

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/264 (34%), Positives = 151/264 (57%), Gaps = 14/264 (5%)

Query: 81  EIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQI 140
           EI I K + H N+++  D +E +T++Y++LE    G L  LL +R  L E E +RFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 141 IIG-VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEGKLLETSCGSPHY 196
           I G + Y H+  ++HRDLK  N+  D  YN+KI DFG+AA+   + E K   T CG+P+Y
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKF--TVCGTPNY 308

Query: 197 AAPEIVSGIPYQG--FASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPS 254
            APE++ G  + G  +  DVWS GV+++ALL G+ PF  +D N  T+  +++  +F  P 
Sbjct: 309 IAPEVLMG-KHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPK 365

Query: 255 DDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQK-YPSIRDSKSIRGLPREDTYLTP 313
           +  IS EA+ L++ +L++DP  R    +I+ +   +  +P    S  +  +P  +  +T 
Sbjct: 366 EKPISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVPYYENRIT- 424

Query: 314 LSESNSSIDATILQNLVILWHGRD 337
           L ES  +    ++++ ++   G D
Sbjct: 425 LEESFINFKNCVIKSGLLTTDGTD 448

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  147 bits (370), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 133/294 (45%), Gaps = 42/294 (14%)

Query: 22  GETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIERE 81
           G+ LG G    V+ ARN  TG+  AVK+                      D        E
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIFHPQ--------------QNDDDKRTKKFTEE 246

Query: 82  IIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRF 136
             I+  + HPN+++L D     V +T    YLVLE    GELF  +V +  L E E    
Sbjct: 247 TKILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKAL 306

Query: 137 FRQIIIGVSYCHALGIVHRDLKPENLLL-------------------DHKYNIKIADFGM 177
           FRQ++ G+ Y H+  I+HRD+KPEN+LL                   +    +KIADFG+
Sbjct: 307 FRQLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGL 366

Query: 178 AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDG- 236
           A    E K   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF E+   
Sbjct: 367 AKFTGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAP 425

Query: 237 -NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
            +++  +L+  K  F  P  D I      LI  +L V+P  R    D L HP  
Sbjct: 426 PSMKEQILQ-GKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  144 bits (362), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 149/281 (53%), Gaps = 28/281 (9%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+   G+  A+KV+ K  +     V  T+         
Sbjct: 69  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQVEHTND-------- 120

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                ER +  +KL+ HP ++R++  ++   ++++V++Y E GELF+LL +    P   A
Sbjct: 121 -----ERRM--LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVA 173

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y H   I++RDLKPEN+LLD   +IKI DFG A  E +  +  T CG+
Sbjct: 174 KFYAAEVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVQ-TVTWTLCGT 231

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS GV+++ +L G  PF   D        K+ +G+   P
Sbjct: 232 PDYIAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP 288

Query: 254 SDDEISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
                  +  DL+ K++T D  RRI      +RDI  HP  
Sbjct: 289 P--YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  145 bits (366), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 90/287 (31%), Positives = 153/287 (53%), Gaps = 24/287 (8%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +  G+TLG G+ G V+ AR  ST +  AVK++ K      +V    +             
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQLLYD----------- 88

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
             E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++ +G   E +A++   
Sbjct: 89  --ELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVT 146

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYN---IKIADFGMAA-LETEGKLLETSCGSP 194
           QI+  V Y H+  IVHRDLKPEN+L     +   + +ADFG+A  L++  +L+  + GS 
Sbjct: 147 QILSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSL 206

Query: 195 HYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKG----EF 250
            Y APE+++     G   D+WS GV+ + LL+G  PF  E  ++   L +  +G    +F
Sbjct: 207 GYVAPEVLT-TSGHGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 251 EMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRD 297
             P  D IS +A++ I + L + P +R    ++L+ P +    S ++
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 141/250 (56%), Gaps = 12/250 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + H N+++  D
Sbjct: 104 GGFARCFQIKDESGKIFAAKTVAKISIKSEKTKRKL----LSEIQIHKSMKHSNIVQFID 159

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG-VSYCHALGIVHRDL 157
            +E + ++Y++LE    G L +LL +R  L E E +RFF   I G + Y H+  I+HRDL
Sbjct: 160 CFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQICGAIKYLHSRRIIHRDL 218

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+K+ DFG+AA L  + +   T CG+P+Y APE++ G  + G  F  D+
Sbjct: 219 KLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMG-KHSGHSFEVDI 277

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  +S+EA+ LI  IL+++P
Sbjct: 278 WSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKYVSKEAEILIHDILSLNP 335

Query: 275 ERRIKTRDIL 284
            +R    DI+
Sbjct: 336 LQRPTIIDII 345

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  143 bits (360), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 144/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  V     +  T+                E 
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTN---------------DER 92

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            ++KL++HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A  +  ++I+
Sbjct: 93  RMLKLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVIL 152

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+P Y APE++
Sbjct: 153 ALEYLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVI 210

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREA 262
           +  PY   + D WS G+++F +L G  PF   D        K+ +G+   P       + 
Sbjct: 211 ATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYPP--FFHPDV 265

Query: 263 QDLIRKILTVDPERRIKT-----RDILKHPLL 289
            DL+ K++T D  RR+       +D+  HP  
Sbjct: 266 VDLLCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  144 bits (362), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREII 83
           TLG GS G+V L R+   G+  A+KV+ K +     V     V  T  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEI-----VVRLKQVEHTNDERL--------- 137

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG 143
           ++ ++ HP ++R++  ++    ++++++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 144 VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVS 203
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 204 GIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQ 263
             PY   + D WS G++++ +L G  PF   D N      K+   E   P     + + +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPP--FFNEDVK 310

Query: 264 DLIRKILTVDPERRI-----KTRDILKHPLLQK 291
           DL+ +++T D  +R+      T D+  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  149 bits (376), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 90/252 (35%), Positives = 141/252 (55%), Gaps = 12/252 (4%)

Query: 39  GSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYD 98
           G   +   +K  S  +F    V+  SI    T   L      EI I K + H N+++  D
Sbjct: 110 GGFARCFQIKDDSGKIFAAKTVAKLSIKTEKTRKKLL----SEIQIHKSMRHANIVQFID 165

Query: 99  VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR-QIIIGVSYCHALGIVHRDL 157
            +E  T++Y++LE    G L  LL +R  L E E +RFF  QI  G+ Y H+  ++HRDL
Sbjct: 166 CFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQICGGIKYMHSRRVIHRDL 224

Query: 158 KPENLLLDHKYNIKIADFGMAA-LETEGKLLETSCGSPHYAAPEIVSGIPYQG--FASDV 214
           K  N+  D  YN+KI DFG+AA L  + +   T CG+P+Y APE++ G  + G  +  D+
Sbjct: 225 KLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMG-KHSGHSYEVDI 283

Query: 215 WSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDP 274
           WS GV+++ALL G+ PF  +D N  T+  +++  +F  P +  IS EA+ L++ +L++DP
Sbjct: 284 WSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKYISSEARILVQDLLSLDP 341

Query: 275 ERRIKTRDILKH 286
             R    ++L +
Sbjct: 342 LERPSIMEVLDY 353

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 143/272 (52%), Gaps = 28/272 (10%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNVSGTSIVGSTTPDALPYGIEREI 82
           TLG GS G+V L R+   G+  A+KV+ K  +     V  T+                E 
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTN---------------DER 157

Query: 83  IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIII 142
            ++ +++HP  +R++  ++    ++++++Y E GELF+LL +    P   A  +  ++ +
Sbjct: 158 RMLSVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCL 217

Query: 143 GVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIV 202
            + Y H++ I++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y APE+V
Sbjct: 218 ALEYLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVV 275

Query: 203 SGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREA 262
           S  PY   + D WS G+++F +L G  PF   D N       +   E + PS      +A
Sbjct: 276 STKPYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFPS--IFHPDA 330

Query: 263 QDLIRKILTVDPERRI-----KTRDILKHPLL 289
           QDL+ +++T D  +R+      + D+ +HP  
Sbjct: 331 QDLLCRLITRDLSKRLGNLQNGSEDVKRHPWF 362

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  145 bits (365), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 144/277 (51%), Gaps = 28/277 (10%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISK-AVFNTGNVSGTSIVGSTTPDALPYG 77
           +++  TLG GS G+V L R+   G+  A+KV+ K  V     V  T+             
Sbjct: 145 FQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTN------------- 191

Query: 78  IEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFF 137
              E  ++ +++HP ++R++  ++ +  L+++++Y E GELF+LL +    P   A  + 
Sbjct: 192 --DERNMLSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPVAKFYA 249

Query: 138 RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYA 197
            ++ + + Y H+ GI++RDLKPEN+LLD   +IK+ DFG A    +  +  T CG+P Y 
Sbjct: 250 AEVCLALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYI 307

Query: 198 APEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDE 257
           APE+VS  PY   + D WS GV+++ +L G  PF   D N       +       P    
Sbjct: 308 APEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YDSNTIKTYENILNAPVRFPP--F 362

Query: 258 ISREAQDLIRKILTVDPERRI-----KTRDILKHPLL 289
              +AQDLI K++T D  +R+      + D+  HP  
Sbjct: 363 FHSDAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWF 399

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  143 bits (361), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 143/273 (52%), Gaps = 26/273 (9%)

Query: 24  TLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREII 83
           TLG GS G+V L R+   G+  A+KV+ K +     V     V  T  + L         
Sbjct: 92  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEI-----VVRLKQVEHTNDERL--------- 137

Query: 84  IMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIG 143
           ++ ++ HP ++R++  ++    ++++++Y E GELF+LL +    P   A  +  ++ + 
Sbjct: 138 MLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLA 197

Query: 144 VSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVS 203
           + Y H+  I++RDLKPEN+LLD   +IKI DFG A    +  +  T CG+P Y APE+VS
Sbjct: 198 LEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPD--VTYTLCGTPDYIAPEVVS 255

Query: 204 GIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQ 263
             PY   + D WS G++++ +L G  PF   D N      K+   E   P     + + +
Sbjct: 256 TKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFPP--FFNEDVK 310

Query: 264 DLIRKILTVDPERRI-----KTRDILKHPLLQK 291
           DL+ +++T D  +R+      T D+  HP  ++
Sbjct: 311 DLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  145 bits (367), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/299 (33%), Positives = 141/299 (47%), Gaps = 46/299 (15%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           + LG  LG G    V+  +N  TGQ  AVK+      +    S                 
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIFHPQQNDDQKKSKQ--------------F 242

Query: 79  EREIIIMKLLNHPNVLRLYD-----VWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
             E  I+  ++HPN++ L D     + +  T  YLVLE  + GELF+ +V++  L + E 
Sbjct: 243 REETNILMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDET 302

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLL--------DHK-----------YNIKIAD 174
              F QI+ G+ Y H   I+HRD+KPEN+LL        D K             +KIAD
Sbjct: 303 KAIFTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIAD 362

Query: 175 FGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFAS--DVWSCGVILFALLTGRLPFD 232
           FG+A    E +   T CG+P Y APE++     +G+ S  D+WS GVIL+  L G  PF 
Sbjct: 363 FGLAKFTGEMQFTNTLCGTPSYVAPEVLIK---KGYTSKVDMWSSGVILYVCLCGFPPFS 419

Query: 233 EEDG--NIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLL 289
           ++ G   ++  +L+  K  F  P  D I      LI  +L +DPE+R    D   HP L
Sbjct: 420 DQLGPPALKEQILQA-KFAFYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  142 bits (358), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 143/274 (52%), Gaps = 21/274 (7%)

Query: 19  WKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGI 78
           +++G  LG G  GKV   R+  +G   A+K I K      N              L   +
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEKNEILQFN--------------LLKQL 145

Query: 79  EREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEAIRFFR 138
           +RE+ I   ++HPN+++LY  +     +YL++E++  GEL+  L   GP  +  A  +  
Sbjct: 146 KREVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIY 205

Query: 139 QIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGSPHYAA 198
           QI   + Y H   I+HRD+KPEN+L+     +K+ADFG + L  EG   +T CG+  Y +
Sbjct: 206 QIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLS 265

Query: 199 PEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLK-VQKGEFEMPSDDE 257
           PE+++   Y     DVW+ GV+ + L+ G  PF+E   N + L  K + K +   P  + 
Sbjct: 266 PEMITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFP--ES 319

Query: 258 ISREAQDLIRKILTVDPERRIKTRDILKHPLLQK 291
           IS++A+DLI K+L  D  +R+    +  HP + K
Sbjct: 320 ISKDAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 145/265 (54%), Gaps = 23/265 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKA-VFNTGNVSGTSIVGSTTPDA 73
           T+  +++  TLG GS G+V L R+    +  A+KV+ K  +F    +  T+         
Sbjct: 70  TLKDFQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTND-------- 121

Query: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133
                ER+I  +K++ HP ++R++  ++ + +L++V++Y E GELF+LL +    P   A
Sbjct: 122 -----ERKI--LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVA 174

Query: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193
             +  ++I+ + Y H+  I++RDLKPEN+LLD   +IKI DFG A  +    +  T CG+
Sbjct: 175 KFYAAEVILALDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGT 232

Query: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253
           P Y APE+++  PY   + D WS G++++ +L G  PF   D        K+  G+   P
Sbjct: 233 PDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYP 289

Query: 254 SDDEISREAQDLIRKILTVDPERRI 278
           S      +  DL+ +++T D  RR+
Sbjct: 290 S--FFHPDVIDLLARLITADLTRRL 312

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  145 bits (366), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 91/303 (30%), Positives = 147/303 (48%), Gaps = 42/303 (13%)

Query: 10  AIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGST 69
           A +++    + +G+ LG G    V+  RN  TGQ  A+K+    + +    +        
Sbjct: 173 ARQESVFDKYIIGKELGSGHYAIVKEGRNKKTGQSVAIKIFHPQLNDDQKKN-------- 224

Query: 70  TPDALPYGIEREIIIMKLLNHPNVLRLYDVW-----ETNTDLYLVLEYAEKGELFNLLVE 124
                 +    E  I+  ++HPN++ L D +     ++    YLVL+  + GELF+ +V 
Sbjct: 225 ------HQFREETDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVR 278

Query: 125 RGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLL-------------------D 165
           +  L ++E    F+QI+ G+ Y H   I+HRD+KPEN+LL                   +
Sbjct: 279 KTSLSQNETKALFKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDE 338

Query: 166 HKYNIKIADFGMAALETEGKLLETSCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALL 225
               +KIADFG+A    E +   T CG+P Y APE++    Y     D+WS GV+L+  L
Sbjct: 339 IDIQVKIADFGLAKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCL 397

Query: 226 TGRLPFDEEDGNIRTLLLKVQKGEFEM--PSDDEISREAQDLIRKILTVDPERRIKTRDI 283
            G  PF ++ G   TL  ++ +G+F    P  DEI+     LI  +L V+P +R    D+
Sbjct: 398 CGFPPFSDQLGP-PTLKEQILQGKFAFFSPYWDEINDSVLHLISNLLVVNPAQRYSIEDM 456

Query: 284 LKH 286
           + H
Sbjct: 457 INH 459

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 106,399,613
Number of extensions: 4603457
Number of successful extensions: 20696
Number of sequences better than 10.0: 2090
Number of HSP's gapped: 17003
Number of HSP's successfully gapped: 2437
Length of query: 1142
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1021
Effective length of database: 39,606,813
Effective search space: 40438556073
Effective search space used: 40438556073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)