Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR372C (VPS74)5.442ON34534518120.0
Smik_4.6385.442ON34634717270.0
Skud_4.6415.442ON34634717090.0
Suva_2.5445.442ON34634716930.0
TDEL0D025905.442ON33034514300.0
CAGL0A02926g5.442ON32834514190.0
KAFR0D050605.442ON32634514070.0
KNAG0B042005.442ON34434513970.0
SAKL0G02706g5.442ON33234513780.0
NCAS0F034305.442ON33234613740.0
ZYRO0F10208g5.442ON33234713530.0
TBLA0A064805.442ON33435013340.0
KLTH0F15884g5.442ON32934513330.0
Kpol_1016.25.442ON32834513240.0
Ecym_45135.442ON33334313250.0
Kwal_55.213995.442ON32934513230.0
NDAI0B057205.442ON36536613180.0
KLLA0E02355g5.442ON32434313070.0
ACL165C5.442ON33134312401e-172
TPHA0J026105.442ON32934512351e-171
Kpol_1062.245.442ON2762739181e-124
TBLA0A027805.442ON3873048651e-114
NCAS0H020905.442ON3452845904e-73
KAFR0C051107.39ON89174800.20
ZYRO0F02794g8.24ON17376701.7
Ecym_24866.329ON63062721.9
TDEL0A038805.524ON169667722.0
KLTH0E09504g2.396ON38523684.7
TDEL0C048103.339ON142055694.7
YAL024C (LTE1)7.74ON143592685.7
KLTH0C09966g3.106ON760147678.4
YJL016W5.164ON561566610.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR372C
         (345 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   702   0.0  
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   669   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   662   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   656   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   555   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   551   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   546   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   542   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   535   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   533   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   525   0.0  
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   518   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   518   0.0  
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   514   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   514   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   514   0.0  
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   512   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   508   0.0  
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   482   e-172
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   480   e-171
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   358   e-124
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   337   e-114
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   231   4e-73
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    35   0.20 
ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar...    32   1.7  
Ecym_2486 Chr2 (954148..956040) [1893 bp, 630 aa] {ON} similar t...    32   1.9  
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....    32   2.0  
KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {...    31   4.7  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    31   4.7  
YAL024C Chr1 complement(101565..105872) [4308 bp, 1435 aa] {ON} ...    31   5.7  
KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conser...    30   8.4  
YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative p...    30   10.0 

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/345 (100%), Positives = 345/345 (100%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR
Sbjct: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV
Sbjct: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY
Sbjct: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK
Sbjct: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/347 (95%), Positives = 340/347 (97%), Gaps = 3/347 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58
           MSTLQRRRVNRADSGDTSS+  SANN   KGDKIA++AVD DDDNGTNKKIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVD-DDDNGTNKKIAYDPEESKL 59

Query: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118
           RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR
Sbjct: 60  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 119

Query: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178
           KRFDLSERLIEVID SKTGEVLLDETLQLMKNDEPL+ISNWIDLLSGETWNLLKINYQLK
Sbjct: 120 KRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298
           EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQ+PFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDL 299

Query: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           EKETELG+SVNLNKEVKEE+E+NPGH+LQLEVIAGVFEVFSRMDMLL
Sbjct: 300 EKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/347 (94%), Positives = 337/347 (97%), Gaps = 3/347 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58
           MSTLQRRRVNRADSGDTSS+ S +NN  +KGDKIANI +D DDD+G NKKIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGID-DDDSGANKKIAYDPEESKL 59

Query: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118
           RDNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSAR
Sbjct: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178
           KRFDLSERL+EV+D SKTGEVLLDETLQLMKNDEPL+ISNWIDLLSGETWNLLKINYQLK
Sbjct: 120 KRFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298
           EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI+RAEEIMAQFSQYPFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDL 299

Query: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           EKETELGVSVNLNKEVKEEIENN GHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 300 EKETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/347 (93%), Positives = 335/347 (96%), Gaps = 3/347 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58
           MSTLQRRRVNRADSGDTSS+ S++NN  + GDK +N  VDGDD NG NKKIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDD-NGINKKIAYDPEESKL 59

Query: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118
           RDNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSAR
Sbjct: 60  RDNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSAR 119

Query: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178
           KRFDLSERL+EVID SKTGEVLLDETLQLMKNDEPL+ISNWIDLLSGETWNLLKINYQLK
Sbjct: 120 KRFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179

Query: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN
Sbjct: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239

Query: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298
           EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIM+ FSQYPFDL
Sbjct: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDL 299

Query: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           EK+T+LGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL
Sbjct: 300 EKDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  555 bits (1430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/345 (77%), Positives = 305/345 (88%), Gaps = 15/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS LQRRRVNR DSGD SS+ +S  N               +  T+K++AYDPEE+K+ +
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFN---------------ETTTSKRVAYDPEEAKITE 45

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           N+  P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCIIIELALRGKIRI+DDSARKR
Sbjct: 46  NVKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKR 105

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERLIEV+D+SKTGEVLLDETLQLMK DEPL+I+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 106 FDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQV 165

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNEY
Sbjct: 166 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEY 225

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+ Q++QYPFDL+K
Sbjct: 226 FPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDK 285

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
            TE G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 286 ATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/345 (77%), Positives = 308/345 (89%), Gaps = 17/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MSTLQRRRVN++++                  +N   D +DD  ++ KIAYDPEESKL++
Sbjct: 1   MSTLQRRRVNKSENA-----------------SNGIEDREDDGTSSGKIAYDPEESKLQN 43

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           +   PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALR KIRILD  AR R
Sbjct: 44  DSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMR 103

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERLIEVIDSSKTGEVLLDETLQLM NDEPLSI+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 104 FDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQV 163

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN Y
Sbjct: 164 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSY 223

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI+AQFSQYPFDL+K
Sbjct: 224 FPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQK 283

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           E++ G+SVNLNKE++EE+E+NPG DL+LEVIAGVFEVFSRMDMLL
Sbjct: 284 ESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/345 (77%), Positives = 296/345 (85%), Gaps = 19/345 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MSTLQRRR NR+DS               D   N++   D      +K+AYDPEE+KLRD
Sbjct: 1   MSTLQRRRKNRSDSN-------------ADDSENVSESQD------RKVAYDPEEAKLRD 41

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           N++IP LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDSARKR
Sbjct: 42  NVSIPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKR 101

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERL+EVID SKTGEVLLDE LQLMKNDEPL+I+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 102 FDVSERLVEVIDGSKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQV 161

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSRNMEL+YN Y
Sbjct: 162 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSY 221

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           F ETTSFK IR +AL+C SYGANVLENVL++L+YEKRD+AISRAEEI+AQF+QYPFDL K
Sbjct: 222 FAETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSK 281

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
            TELG+SVNLNKEV+ E+  NP   LQLEVIAGV EVFSRMDMLL
Sbjct: 282 NTELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  542 bits (1397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/345 (73%), Positives = 302/345 (87%), Gaps = 1/345 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MSTLQRRRVNR+DS +  ++ S          +N A + ++ +G  +K+AYDPEE+KLRD
Sbjct: 1   MSTLQRRRVNRSDSNEGETV-SGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRD 59

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           N  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDSARKR
Sbjct: 60  NYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKR 119

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERL+EV+D SKTGEVLLDETLQLMKNDEPL+I+NWIDLLSGETWNL+KINYQLKQV
Sbjct: 120 FDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQV 179

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRNMELS+N Y
Sbjct: 180 RERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSY 239

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++ +F QYPFDLEK
Sbjct: 240 FPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEK 299

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           + + G+S NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 300 QGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/345 (75%), Positives = 296/345 (85%), Gaps = 13/345 (3%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS LQRRRVNR +S       +S+             D +D+N  ++K+AYDPEE+KL++
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSS-------------DSNDENAKDRKVAYDPEEAKLKE 47

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALR KIR+LDD ARKR
Sbjct: 48  NTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKR 107

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+S+RLIEVID SKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQV
Sbjct: 108 FDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQV 167

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNEY
Sbjct: 168 RERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEY 227

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           F E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI+AQFS++PF L+K
Sbjct: 228 FSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDK 287

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
            TE G+SVNLNKEV+ EI  NPG DLQLEV+AGVFEVFSRMD LL
Sbjct: 288 ATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/346 (74%), Positives = 302/346 (87%), Gaps = 15/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MSTLQRRRVN+ DS          +N  G    N+  D D+DN    K+AYDPEE+++R+
Sbjct: 1   MSTLQRRRVNKDDS----------DNETGSVTPNVERDSDNDN----KVAYDPEEARMRN 46

Query: 61  -NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 119
               +P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCI+IELALRGKI+ILDDSARK
Sbjct: 47  VGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARK 106

Query: 120 RFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQ 179
           RF+LSERL++VID +KTGEVLLDETLQLMKNDEPLSI++WIDLLSGETWN++KINYQLKQ
Sbjct: 107 RFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQ 166

Query: 180 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 239
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSYN 
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNN 226

Query: 240 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLE 299
           YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E++AQFS++PFDLE
Sbjct: 227 YFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLE 286

Query: 300 KETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
             T LG+SVNLN+EV++E+ + PG+DLQLEVIAGV EVFSRMD LL
Sbjct: 287 TPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/347 (74%), Positives = 299/347 (86%), Gaps = 17/347 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58
           MS LQRRRVNR DS       S +NN  T+G       ++  +D+ ++KK+AYDPEE KL
Sbjct: 1   MSGLQRRRVNRVDS-------SGSNNEPTRG-------LEAQEDS-SSKKVAYDPEEVKL 45

Query: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118
            DN+ +P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSAR
Sbjct: 46  TDNVEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSAR 105

Query: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178
           KRFD+SERLIEV DSSKTGEVLLDE LQLMK DEPLSI+NWIDLLSGETWN LKINYQLK
Sbjct: 106 KRFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLK 165

Query: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN
Sbjct: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYN 225

Query: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298
           +YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+ QFS+YPFDL
Sbjct: 226 DYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDL 285

Query: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           + +TE G+S+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 286 DTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  518 bits (1334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/350 (69%), Positives = 294/350 (84%), Gaps = 21/350 (6%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNK-----KIAYDPEE 55
           MSTLQRRR                   + D + +   D +D+  TN+     ++AYDPEE
Sbjct: 1   MSTLQRRR----------------KQARSDSVGSSGTDSNDNEPTNRQAESRRVAYDPEE 44

Query: 56  SKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDD 115
            K+R+N+++P LTLMEEV+L+GLRD+EGYLSFWND+ISYALRGCIIIELALRGKIRILDD
Sbjct: 45  DKIRNNMSVPQLTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDD 104

Query: 116 SARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINY 175
            ARKRF+LSERL+EV+DSSKTGEVLLDE LQ+M+NDEPL+ISNW+DLLSGETWN+ KINY
Sbjct: 105 PARKRFELSERLVEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINY 164

Query: 176 QLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMEL 235
           QLKQVRER++KGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS+LV+R  E 
Sbjct: 165 QLKQVRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEF 224

Query: 236 SYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYP 295
           +YN+YFPETTSFK IRT++LIC +YGANVLENVL +LEY+KRD  ++RAEE++ QFSQYP
Sbjct: 225 TYNDYFPETTSFKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYP 284

Query: 296 FDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           FDLEK+TE G S+NLN  VKEEIE +P + L LEV+AGVFEVFS+MD+LL
Sbjct: 285 FDLEKQTEFGTSINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 296/345 (85%), Gaps = 16/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS LQRRRVN+++S     I S       D + N     D+ +G  K++AYDPEE+KLRD
Sbjct: 1   MSGLQRRRVNKSES-----ISSQ------DPVVN-----DETDGEGKRVAYDPEEAKLRD 44

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           +   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++L+D ARKR
Sbjct: 45  DTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKR 104

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERL+EVI+++KTGEVLLDE L LMKNDEPL+I+NWIDLLSGETWN +KI+YQLKQV
Sbjct: 105 FDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQV 164

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNEY
Sbjct: 165 RERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEY 224

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI+AQFSQ+PF L+K
Sbjct: 225 FPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDK 284

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           +TE G+SVNLNKEV+EE+ +N    LQLE +AGVFEVFSRMD LL
Sbjct: 285 QTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/345 (71%), Positives = 295/345 (85%), Gaps = 17/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS+LQRRR+NR +S DT+    S+N+             D++   + KIAYDPEE+KL+D
Sbjct: 1   MSSLQRRRLNRINS-DTAE---SSND-------------DEERSKSTKIAYDPEEAKLKD 43

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           ++ +PTLTLMEEV+L+GL D++GYLSFWND+ISY LRGCIIIELALR KIRILDD ARKR
Sbjct: 44  DVTVPTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKR 103

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FDLSERL+EV+D SKTGEVLLDE LQLMKNDEPLSI+NWIDLLSGETWN  KINYQLKQV
Sbjct: 104 FDLSERLVEVVDGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQV 163

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RER++KGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSR MEL+YNEY
Sbjct: 164 RERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEY 223

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FPETT +K+IRT+ALIC SY ANVLENVL++LEYEKRD AI+R+E I+++F+QYPF L+K
Sbjct: 224 FPETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDK 283

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
            +++ VS+NL+K V++EI  NPG  LQLE +AGVF+VFS+MDM+L
Sbjct: 284 ASDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/343 (71%), Positives = 293/343 (85%), Gaps = 11/343 (3%)

Query: 3   TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 62
           +LQRRRVN+A+ G TS   +   + +           D+D+  + K+AYDPE+ KLR+N 
Sbjct: 2   SLQRRRVNKAEVGGTSVELTQRKHGE-----------DEDDKGSHKVAYDPEDQKLRENT 50

Query: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122
             PTLTLMEEVLLMGL+D+EGYLSFWNDSISY+LRGCI+IELALRGKIR+++D+ARKRFD
Sbjct: 51  KEPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFD 110

Query: 123 LSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRE 182
           LSERL+EVI++SKTGE LLDETL LMK++EPLSI NWIDLLSGETWNLLKI+YQLKQVRE
Sbjct: 111 LSERLVEVIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRE 170

Query: 183 RLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFP 242
           RLAKGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE+IKRR+LSVLV RN+ L Y EYFP
Sbjct: 171 RLAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFP 230

Query: 243 ETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKET 302
           E+ +FK +RT+ALICG+YGANVLENVL++L+YEKR++  SRAEEI+ QFSQYPF L+K+ 
Sbjct: 231 ESVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDV 290

Query: 303 ELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           E G+SVNL  +VKEEI  NPG  LQLEV+AGVFEVFSRMD  L
Sbjct: 291 ETGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/345 (71%), Positives = 295/345 (85%), Gaps = 16/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS LQRRRVN+++S   S                  V  ++  G +K++AYDPEE+ L+D
Sbjct: 1   MSGLQRRRVNKSESNYDSE----------------PVISEEAEGESKRVAYDPEEAMLKD 44

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           N  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++++DSARKR
Sbjct: 45  NATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKR 104

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FD+SERL+EVI+++KTGEVLLDE L LMKNDEPL+I+NWIDLLSGETWN +KI+YQLKQV
Sbjct: 105 FDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQV 164

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNEY
Sbjct: 165 RERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEY 224

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI+AQFSQ+PF L+K
Sbjct: 225 FPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDK 284

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           +TE G+SVN+NKE++EEI+ N    L+LEV+AGVFEVFSRMD LL
Sbjct: 285 QTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  512 bits (1318), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/366 (71%), Positives = 300/366 (81%), Gaps = 22/366 (6%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGT----NKKIAYDPEES 56
           MSTLQRRR    D  +   +   ++N    +I       ++ + +    + KIAYDPEE+
Sbjct: 1   MSTLQRRR-RPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEA 59

Query: 57  KLRDNIN-----------------IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGC 99
           KL +N N                  PTLTLMEEVLLMGLRD+EGYLSFWND+ISYALRGC
Sbjct: 60  KLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGC 119

Query: 100 IIIELALRGKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNW 159
           I+IELALRGKIRILDDSARKRFDLSERLIEV D SKTGEVLLDETLQLMKNDEPL+I+NW
Sbjct: 120 ILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANW 179

Query: 160 IDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEA 219
           IDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEA
Sbjct: 180 IDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEA 239

Query: 220 IKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDK 279
           IKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL++L+YEK D 
Sbjct: 240 IKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDN 299

Query: 280 AISRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFS 339
           AI+RA+E++AQFS++PFDLEK T   VSVNLN+ V++E++ NPG+DLQLEVIAGV EVFS
Sbjct: 300 AIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFS 359

Query: 340 RMDMLL 345
           RMD LL
Sbjct: 360 RMDTLL 365

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  508 bits (1307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/343 (71%), Positives = 285/343 (83%), Gaps = 20/343 (5%)

Query: 3   TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 62
           +LQRRRVN+ D+ ++              I  I      DN  + KI YD +E+KLRDN 
Sbjct: 2   SLQRRRVNKGDTTES--------------IPQI------DNEHDHKIVYDEQEAKLRDNT 41

Query: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122
           ++P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCI+IELALRGKIR +DD ARKR+D
Sbjct: 42  SVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYD 101

Query: 123 LSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRE 182
           +SERLIEVID SKTGEVLLDE+L LMKND P SI  WIDLLSGETWNLLKINYQLKQVRE
Sbjct: 102 VSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRE 161

Query: 183 RLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFP 242
           RLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YFP
Sbjct: 162 RLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFP 221

Query: 243 ETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKET 302
           +  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI+AQFS++PF L+K+T
Sbjct: 222 QDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQT 281

Query: 303 ELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
             GVSVNLNKE+ +E+ N+PG DLQLEV+AGVFEVFSRMD LL
Sbjct: 282 STGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  482 bits (1240), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/343 (67%), Positives = 280/343 (81%), Gaps = 13/343 (3%)

Query: 3   TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNI 62
           +LQRRRVN+          ++ N T G    N +   D++ G   K+AYDPEE KLR+N 
Sbjct: 2   SLQRRRVNK----------TAGNETVGGASLNRS---DEEEGMTHKVAYDPEEQKLRENT 48

Query: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122
             PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCI+IELALRG+I+++DD+ R+RFD
Sbjct: 49  REPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFD 108

Query: 123 LSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRE 182
            SERLIEV+D SKTGE LLDE L LMK  EPL+I NW+DLLSGETWN LKINYQL+QVRE
Sbjct: 109 PSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRE 168

Query: 183 RLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFP 242
           RLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E FP
Sbjct: 169 RLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFP 228

Query: 243 ETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKET 302
           ET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++ QFSQYPF L+K+ 
Sbjct: 229 ETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDI 288

Query: 303 ELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           E G+SVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 289 ETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  480 bits (1235), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 230/345 (66%), Positives = 281/345 (81%), Gaps = 16/345 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRD 60
           MS +QRRR+NR  + D S  HS               D D       K+A+DPEE+K++D
Sbjct: 1   MSGVQRRRINRISNEDESD-HS---------------DNDQSRSNVSKVAFDPEEAKIKD 44

Query: 61  NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKR 120
           ++++P LTLMEEV+L+GL D EGYLSFWND+ISY LRGCI+IELALRGKIRI+DDSARK 
Sbjct: 45  DVSVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKS 104

Query: 121 FDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQV 180
           FDLSERLIEVID+SKTGEVLLDETLQLMKNDEP SI +WIDLLSGETWN  K+NYQLKQV
Sbjct: 105 FDLSERLIEVIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQV 164

Query: 181 RERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEY 240
           RERL+KGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE++KRR++S LV R + L YNEY
Sbjct: 165 RERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEY 224

Query: 241 FPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEK 300
           FPE+T+FK+IRT++LI  +Y ANVLENVL TLEYEKRDKA+SRAE ++  F  YPF L  
Sbjct: 225 FPESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVN 284

Query: 301 ETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
           E +  +S+NLN+ V++EI+ NP   LQLEV+AGVF+VF++MD+++
Sbjct: 285 EPDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  358 bits (918), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%)

Query: 70  MEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIE 129
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCI+IELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 130 VIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 189
           V++  KTGE LLDETLQ+MK++E  SIS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 190 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 249
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 250 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKETELGVSVN 309
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+ Q S YPF+ + ++   ++ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 310 LNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMD 342
           LN+ V+ E+  +   +L+LE IAGVFEVF +MD
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  337 bits (865), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 158/304 (51%), Positives = 218/304 (71%), Gaps = 1/304 (0%)

Query: 43  NGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIII 102
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCI+I
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 103 ELALRGKIRILDDSARKRFDLSERLIEVI-DSSKTGEVLLDETLQLMKNDEPLSISNWID 161
           ELALR KI+++DD  R  +D+S R+IEV+   +KTG  LLDE L +M  + P SI NWID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 162 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 221
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 222 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 281
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 282 SRAEEIMAQFSQYPFDLEKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRM 341
            +AE++    S +P +L++    GV V++ K+++ E+  + G  L LEV+AGV +V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 342 DMLL 345
           D LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  231 bits (590), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 186/284 (65%), Gaps = 9/284 (3%)

Query: 65  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLS 124
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+ DL+
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121

Query: 125 --ERLIEVIDSSKTGEVLLDETLQLMKNDEP-LSISNWIDLLSGETWNLLKINYQLKQVR 181
             E  IEVID S TG+ LLD+TL LMK ++   S+S+WI LLSGE+ N LK +YQL  VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 182 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 241
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 242 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDLEKE 301
           P+T S++++RT+ L C +YGA++L+      E E       RA  +++ FS++PF+L + 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETVIGK-GRARVLLSLFSKFPFELNQ- 299

Query: 302 TELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345
               V  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 108 GKIRILDDSARKRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSG-E 166
           GK  + D  A K  DL++   + +D SK    +LDE LQL+ N++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 167 TWNLLKINYQLKQV 180
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

>ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar to
           uniprot|Q6Q5C1 Saccharomyces cerevisiae YLR065C
           Hypothetical ORF
          Length = 173

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 13/76 (17%)

Query: 63  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 122
            IP + L      +  RD   Y+ F            I++ L L G I +LD S R ++D
Sbjct: 24  TIPVVLLASTRQWISKRDIVNYIRF------------ILLHLPLLGCIYVLDSSGRPKYD 71

Query: 123 LSERLI-EVIDSSKTG 137
              +LI E +D S++G
Sbjct: 72  SKNKLIREGLDLSQSG 87

>Ecym_2486 Chr2 (954148..956040) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii AAR052C
          Length = 630

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 1   MSTLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDG--DDDNGTNKKIAYDPEESKL 58
           +S LQ    +      +S  H+S   +    ++N   +G  DDD+G++  +++D +ES  
Sbjct: 201 LSDLQGSNSSEGKFHPSSPQHASITGSSATAVSNNQFNGRRDDDDGSSTSVSFDIDESFT 260

Query: 59  RD 60
           RD
Sbjct: 261 RD 262

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
           YDR420W
          Length = 1696

 Score = 32.3 bits (72), Expect = 2.0,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 14  SGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNINIPTLTLMEEV 73
           S DT  + SS +NT+  +  NIA D D + GT+ KI  + E S   +  N+ T+   E  
Sbjct: 308 STDTPPLASSISNTQSSQ-NNIADDTDRNEGTSSKITTNSETSPALNTQNVVTIIPTESK 366

Query: 74  LLMGLRD 80
             + + D
Sbjct: 367 STLTIND 373

>KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {ON}
           similar to uniprot|P40208 Saccharomyces cerevisiae
           YMR135C GID8 Protein of unknown function involved in
           proteasome-dependent catabolite inactivation of
           fructose-1 6-bisphosphatase contains LisH and CTLH
           domains like Vid30p
          Length = 385

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 248 KIIRTLALICGSYGANVLENVLT 270
           +I+  + LIC ++GA VLENV T
Sbjct: 111 RILEAIELICSTFGAQVLENVKT 133

>TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3.339
           YBR097W
          Length = 1420

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 193 VLRTEMKNFFLFDMA-THPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTS 246
           VL   ++ FF FD+  TH +  +SCK+ + R V ++L S ++  S + ++ +  S
Sbjct: 725 VLYPIVRPFFEFDVEFTHDLMLSSCKQPVSRTVYNLLCSWSLRASKSLFWQQVPS 779

>YAL024C Chr1 complement(101565..105872) [4308 bp, 1435 aa] {ON}
            LTE1Protein similar to GDP/GTP exchange factors but
            without detectable GEF activity; required for asymmetric
            localization of Bfa1p at daughter-directed spindle pole
            bodies and for mitotic exit at low temperatures
          Length = 1435

 Score = 30.8 bits (68), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 3    TLQRRRVNRADSGDTSSIHSSANNTKGDKIANIAVDGDDDN----------GTNKKIAYD 52
            T   R   RA+S   S+   S N    ++IAN+  D  +D+          GT +KI   
Sbjct: 1017 TSSARNTRRANSE--SAFTGSLNKKNLNEIANMLDDSINDDPITVALMKLEGTYEKIPEK 1074

Query: 53   PEESKLRDNINIPTLTLMEEVLLMGLRDREGY 84
            PE +K  D I I T  L +EV ++ L +   +
Sbjct: 1075 PENTKSSDAIGIKTSKLADEVEMLNLNNLPSF 1106

>KLTH0C09966g Chr3 (823260..825542) [2283 bp, 760 aa] {ON} conserved
           hypothetical protein
          Length = 760

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 67/147 (45%), Gaps = 24/147 (16%)

Query: 100 IIIELALRGKIRILDDSARKRFDLSERLIE-VIDSSKTGEVLLDETLQLMKNDEP--LSI 156
           I  E  LRG++ I  +SA+K    SE L + +I S    E L  ETL L + +E     I
Sbjct: 471 ISTEETLRGELDIAAESAKKELSKSEELRDSLIKSKNEQEALQAETLVLKEQNETSRSRI 530

Query: 157 SNWIDLLSGETWNLLKINYQLKQVRE---RLAKGLVDKGVLRTEMKNFFLFDMATHPIAD 213
           +  + L+S       ++  + ++ RE   +L +   +K VL T  K      MA   +  
Sbjct: 531 NELVQLVS-------QLEAEARKAREENSQLQQSFQEKDVLATHAK------MANVKLQK 577

Query: 214 ASCKEAIK----RRVLSVLVSRNMELS 236
              +E  K    RR L  L+ R MEL+
Sbjct: 578 DCQRERCKLLDGRRELD-LLRRQMELA 603

>YJL016W Chr10 (405588..407273) [1686 bp, 561 aa] {ON} Putative
           protein of unknown function; GFP-fusion protein
           localizes to the cytoplasm; conserved in closely related
           Saccharomyces species
          Length = 561

 Score = 30.0 bits (66), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 13  DSGDTSSIHSSANNTKGDKIANIAVDGDDDNGTNKKIAYDPEESKLRDNINIPTLT 68
           D  D+ SI+SSANN  GD  ++ A++ +  N T K   +   +   R++ ++ +LT
Sbjct: 303 DVVDSGSIYSSANNGSGDS-SSTALNNESPNTTPKSRTFFSPKGHRRNSSHVSSLT 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,332,100
Number of extensions: 1618605
Number of successful extensions: 7064
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7286
Number of HSP's successfully gapped: 59
Length of query: 345
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 235
Effective length of database: 40,868,139
Effective search space: 9604012665
Effective search space used: 9604012665
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)