Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR370C5.437ON44244222720.0
Smik_4.6365.437ON44644117320.0
Skud_4.6395.437ON44244016950.0
Suva_2.5425.437ON44244015950.0
NDAI0B056905.437ON4233938851e-115
KAFR0E038205.437ON3963798211e-106
NCAS0F034005.437ON4153988161e-105
TDEL0B021805.437ON4183837411e-93
Kpol_1016.45.437ON4133867183e-90
ZYRO0F10098g5.437ON3733846405e-79
SAKL0G02596g5.437ON4003696025e-73
CAGL0A02860g5.437ON4023405991e-72
TPHA0J026005.437ON4413865987e-72
KLTH0F15994g5.437ON3903755493e-65
KNAG0C048905.437ON4053925494e-65
Kwal_55.214155.437ON3893735381e-63
TBLA0A028005.437ON4533904993e-57
AER404C5.437ON3863454482e-50
KLLA0E02245g5.437ON4033223204e-32
Kwal_55.21591na 1ON4691521062e-04
NDAI0I032603.570ON377184900.014
KLLA0E12893g3.570ON384234880.025
Kpol_380.83.570ON379188830.11
KAFR0J001603.570ON380144830.12
KNAG0F039607.541ON153888790.42
Kwal_47.192763.570ON38669770.61
NCAS0E002403.570ON380166760.78
SAKL0F00726g3.570ON383188750.93
TPHA0G036503.570ON377161751.1
YGL246C (RAI1)3.570ON38745741.4
Suva_16.1196.186ON413100731.7
Smik_4.4808.457ON54480731.9
Smik_7.153.570ON38745722.1
Kwal_27.12021na 2ON1633117732.4
YPL188W (POS5)6.186ON414100722.8
Smik_6.3936.186ON414100712.9
Suva_7.153.570ON38945712.9
Skud_4.4958.457ON54464705.0
TDEL0D063803.570ON37845686.6
AFR307C3.489ON65083687.4
NDAI0F022906.186ON422104688.6
Suva_4.1874.248ON61654688.9
ZYRO0E09592g3.570ON3801006710.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR370C
         (442 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   879   0.0  
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   671   0.0  
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   657   0.0  
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   619   0.0  
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   345   e-115
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   320   e-106
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   318   e-105
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   290   1e-93
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   281   3e-90
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   251   5e-79
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   236   5e-73
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   235   1e-72
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   234   7e-72
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   216   3e-65
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   216   4e-65
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   211   1e-63
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   196   3e-57
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   177   2e-50
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   127   4e-32
Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {...    45   2e-04
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     39   0.014
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    39   0.025
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    37   0.11 
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    37   0.12 
KNAG0F03960 Chr6 (745722..750338) [4617 bp, 1538 aa] {ON} Anc_7....    35   0.42 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    34   0.61 
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    34   0.78 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    33   0.93 
TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.5...    33   1.1  
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    33   1.4  
Suva_16.119 Chr16 (201273..202514) [1242 bp, 413 aa] {ON} YPL188...    33   1.7  
Smik_4.480 Chr4 (877382..879016) [1635 bp, 544 aa] {ON} YDR235W ...    33   1.9  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    32   2.1  
Kwal_27.12021 s27 complement(1049035..1053936) [4902 bp, 1633 aa...    33   2.4  
YPL188W Chr16 (191406..192650) [1245 bp, 414 aa] {ON}  POS5Mitoc...    32   2.8  
Smik_6.393 Chr6 complement(631846..633090) [1245 bp, 414 aa] {ON...    32   2.9  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    32   2.9  
Skud_4.495 Chr4 (887665..889299) [1635 bp, 544 aa] {ON} YDR235W ...    32   5.0  
TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON} Anc_3...    31   6.6  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...    31   7.4  
NDAI0F02290 Chr6 complement(553379..554647) [1269 bp, 422 aa] {O...    31   8.6  
Suva_4.187 Chr4 complement(327838..329688) [1851 bp, 616 aa] {ON...    31   8.9  
ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} simila...    30   10.0 

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/442 (96%), Positives = 425/442 (96%)

Query: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEXXXXXXXXXXXXXXXXXNYRKRR 60
           MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKE                 NYRKRR
Sbjct: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPSQQRDNYRKRR 60

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120
           PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120

Query: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180
           LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI
Sbjct: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN
Sbjct: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420
           LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID
Sbjct: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420

Query: 421 TNNAIVITKLKTTPRNVELFGM 442
           TNNAIVITKLKTTPRNVELFGM
Sbjct: 421 TNNAIVITKLKTTPRNVELFGM 442

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/441 (72%), Positives = 364/441 (82%)

Query: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEXXXXXXXXXXXXXXXXXNYRKRR 60
           M TE DAV+ L K+L+GINL + P++ R HQ K                     N+    
Sbjct: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120
           PK   + YTSF H+GMH F  KPPRDIFHESKEVALFTNG+AYT +RKD++PNLK  IAE
Sbjct: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120

Query: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180
           L E SLL+A++RK+PYLGHDLFANI +FVPMTISELDS+ PC SYIENW L+N G+DFKI
Sbjct: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           G+KFTVVTTRHHIVD+TMHLF+RRN++ SL+ TYMGAGL+SF RN K DS+MSKEGIYS+
Sbjct: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFENWVTE  K ADL GSK P+FS+VESKLSEEIGLLIRCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S  NTELKCFAPLSMHNSNHRRKLLKTW+QTGL PNSDIMIGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420
            LC KFNH GLP+NK+ELNYNA++AVEWC++CI++IC+L+ ANISDYS   PESFEI ID
Sbjct: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420

Query: 421 TNNAIVITKLKTTPRNVELFG 441
           +NN I ITKLK  P++VELFG
Sbjct: 421 SNNTIAITKLKNIPKHVELFG 441

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/440 (70%), Positives = 362/440 (82%)

Query: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEXXXXXXXXXXXXXXXXXNYRKRR 60
           MSTE D +  L K+LE  NL  VP+L +GHQ +  +                  +Y  R 
Sbjct: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPSPQKDDYWNRC 60

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120
            +  C+PYTSF+HT +H+   KPP DIF +SKEVALFTN +AYT  RKDLIP+L++ I E
Sbjct: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120

Query: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180
           LYESSLLEA++RKVPYLGHDLFANID+FVPMTISELDS+SPC SY+ENW L N GK+FKI
Sbjct: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           GKKFT+V+ RHHIVDLTMH F+RRN++ SLIVTYMGAGL+SF RN K D QMSKEGIYS+
Sbjct: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFE+WVTE+ K  DL G K PIFS+VESKLSE+IGLL+RCE+DAFNPV
Sbjct: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300

Query: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S TNTELKCF PLSMHNSNHR+KLLKTW+QTGLLPNSDI+IGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360

Query: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420
            L KKFNHPGLP +KKELN+NA++AVEWC++CI++IC+LVEANIS Y+ST+PESFE+ ID
Sbjct: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420

Query: 421 TNNAIVITKLKTTPRNVELF 440
            N  I ITKL T P+NVELF
Sbjct: 421 ANGTIAITKLNTVPKNVELF 440

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/440 (67%), Positives = 347/440 (78%)

Query: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEXXXXXXXXXXXXXXXXXNYRKRR 60
           MS EQD V+ LAKDLEGINL  VPN    H+ K  K                  +Y +  
Sbjct: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSSQQKNDYLEEI 60

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120
            +   +PY+SFLHT + NF TKPP DIF+ESKEVALFT+ + Y   RKD+IPNLKE I+ 
Sbjct: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120

Query: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180
           LYES LLEA+K K  YLG DLFANIDE VPMTISELD+++PC SYIE+W L+N GK FKI
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180

Query: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           GKKFTVVTTRHHIVDLTMH F+RRN+Q S+I TYMG G +S  RN K D + SKEGIYS 
Sbjct: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           DPN+KKIC+SGFEFEN +TEN+K +  + SKCP+FS+VE KLSE+IGLL+RCEMDAFNPV
Sbjct: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300

Query: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S+TNTELKCF PLSM NS+HR+KLLKTW+QTGLLPNSDIM+GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360

Query: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420
            L +KFNHPGLP NKKE+NYNA++AVEWC +CI++IC LVEANIS Y+  KPE FEI ID
Sbjct: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420

Query: 421 TNNAIVITKLKTTPRNVELF 440
            N  I+ITKL T PRNVE+F
Sbjct: 421 ANGTIIITKLSTIPRNVEIF 440

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  345 bits (885), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/393 (46%), Positives = 259/393 (65%), Gaps = 19/393 (4%)

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120
           P +  IP+  F H  +  +  K P   F  SK+VAL+ N + Y+    +LIP L+ +IA+
Sbjct: 34  PPITTIPFKQFKHCSISTY-PKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAK 92

Query: 121 LYESS--LLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDF 178
           L   S  L EA+  K+PYLG DL+   + F+PM   ELDS+ PCF YIE+W L N   D+
Sbjct: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQN-KHDY 151

Query: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLI-VTYMGA--GLLSFCRNVKKDSQMSKE 235
           ++G KFT+V+ RHHIV++TM +FN+R     ++ VTY G   G+L F R+V K       
Sbjct: 152 QLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDD---G 208

Query: 236 GIYSNDPNMKKICYSGFEFENWVT--------ENSKVADLTGSKCPIFSLVESKLSEEIG 287
           GIYS D  ++KI YSGF  E+ +T        +NS V  + G K  +F+++E+KL+++I 
Sbjct: 209 GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKA-VFAIIENKLNDDIS 267

Query: 288 LLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347
           LL+RCEMD++NPV++  TE+KCFA L M+N NHRRKLLK WVQTG++PNSDI+IG+RD  
Sbjct: 268 LLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPM 327

Query: 348 SGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDY 407
            G+L DI+W+SR  L ++ N+  LP  K +LNYNA+IAV+W  +CI++ICKLV+ +I   
Sbjct: 328 FGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKT 387

Query: 408 SSTKPESFEIGIDTNNAIVITKLKTTPRNVELF 440
                +SF+I I+ + AI I KLK+ P NV ++
Sbjct: 388 RLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  320 bits (821), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/379 (42%), Positives = 247/379 (65%), Gaps = 18/379 (4%)

Query: 64  ICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAY--TILRKDLIPNLKESIAEL 121
           I  P+  F H  +  F   P  + F  S+EVA + +GR Y      +D++P L + I+++
Sbjct: 28  IVSPFKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKI 86

Query: 122 YES-SLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180
            +  S ++A+K KV Y+G DL+   + F  M+  ELDS  PCF+YI+ W   +  K +  
Sbjct: 87  AQGVSAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTE 145

Query: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
            KK+T+V+ RHHIV+L M +F+  +++T +  TY+G GLL+F ++   D     EGI++ 
Sbjct: 146 NKKYTIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTS-DPMTMNEGIFTK 203

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           + N+KKICYSGF  E+ +T++ K         P+FS+ E++L + I LL+RCEMDA+N +
Sbjct: 204 NKNLKKICYSGFALEDLLTKSQKE--------PLFSITENQLDDNITLLLRCEMDAYNQL 255

Query: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           ++  TELKC+APL M +  HR+KLLKTW+QTG+LP+SD+M G+R  ++G+LLDI+WYSRD
Sbjct: 256 TQNYTELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRD 315

Query: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420
            L ++FN+  LP NKK LN+NA IAVEW H+CI+ IC+L+  N+       P++F+I +D
Sbjct: 316 GLYRRFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNL---QGDAPQAFQIKVD 372

Query: 421 TNNAIVITKLKTTPRNVEL 439
           T   I I  L   P+N ++
Sbjct: 373 TFRNISIRNLSKIPQNAQI 391

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  318 bits (816), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 165/398 (41%), Positives = 248/398 (62%), Gaps = 22/398 (5%)

Query: 58  KRRPKLICIPYTSFLHTGMHNF--LTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLK 115
           +++  +  +P+  F H+ +  F   T+P    +  S +VAL+ N + Y   + D+IP+LK
Sbjct: 18  QKQAPITRVPFGEFSHSSISLFPTCTQP---FYESSNQVALYHNHKLYPASQYDIIPHLK 74

Query: 116 ESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPG 175
             IA+L + S  EA+  K  YLG DL+   + FVPM+  +LDS+ PC S+I++W      
Sbjct: 75  NDIAQLPKKSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST 134

Query: 176 KDFKIGKKFTVVTTRHHIVDLTMHLFN---------RRNRQTSLIVTYMG--AGLLSFCR 224
           K +K G+KF +V+TRHHIV++TM LF          ++ +   L V Y G   G L F +
Sbjct: 135 K-YKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTK 193

Query: 225 NVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVAD-----LTGSKCPIFSLVE 279
           +         EGIYS +  +K+ICYSGF  E+ +TE +   +     LTG +  +F++VE
Sbjct: 194 DWSNTGNSMNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVE 253

Query: 280 SKLSEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDI 339
           +KL ++I +L+RCE+DAFN   +  TELKCF+PL M N +HRRKLLK WVQTG+LP+SDI
Sbjct: 254 NKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDI 313

Query: 340 MIGLRDSHSGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKL 399
           +IG+RDS  G+L D++WYSRD L  K N+  LP +K + N+NAQ+A +W  +CI +ICKL
Sbjct: 314 LIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKL 373

Query: 400 VEANISDYSSTKPESFEIGIDTNNAIVITKLKTTPRNV 437
           V+ N+   + + P+ F+I ID+   I I  L   P+++
Sbjct: 374 VDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  290 bits (741), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/383 (41%), Positives = 233/383 (60%), Gaps = 20/383 (5%)

Query: 62  KLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYT--ILRKDLIPNLKESIA 119
           + +CIP++ F H+ + ++      D F   +EVA + NG  +     +K L P L+   A
Sbjct: 46  RTVCIPFSKFEHSDL-DYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAA 104

Query: 120 ELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFK 179
            + E+      K K+PY+G DL+   + + P+  SELDS   CF YI+ W      K F 
Sbjct: 105 LIAEN---RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFN 161

Query: 180 IGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYS 239
            GK  T+++ RHH+VDL M LF+  + + S+I T +G G L F  +  K+    + G+ S
Sbjct: 162 SGK-VTIISPRHHVVDLVMALFH--DDEVSIICTNIGKGKLIFSGDRSKEE---RNGLNS 215

Query: 240 NDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNP 299
            +   +KICYSGF  E+ +T +    +  G   P +S+VE K++E + LL+RCEMDA+NP
Sbjct: 216 KNSMTRKICYSGFALEDKLTTSHD--ERMG---PFYSIVEGKINERLSLLLRCEMDAYNP 270

Query: 300 VSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSR 359
           +    TELKCF  L++ ++ HRRKLLKTWVQ GL+P+SD++IG RD+  GQL D+ WYSR
Sbjct: 271 IFNRYTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSR 330

Query: 360 DLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEAN---ISDYSSTKPESFE 416
             L KKFN+P +  N K LN+NA IAVEWC +CIE+IC LV  N     D    K ESF+
Sbjct: 331 GSLYKKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKNSLSSPDDPYPKYESFK 390

Query: 417 IGIDTNNAIVITKLKTTPRNVEL 439
           + +D ++ I++ KL   PR+V++
Sbjct: 391 VIVDKSHNIIVKKLTKVPRHVQI 413

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  281 bits (718), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 160/386 (41%), Positives = 238/386 (61%), Gaps = 15/386 (3%)

Query: 58  KRRPK---LICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNL 114
           K RPK   +  IP+  F+H+   +F  K  +D+F ESK VA F   + +  +    +P L
Sbjct: 30  KSRPKKNVINIIPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLL 88

Query: 115 KESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNP 174
           K+ IA +   S+L +KK K+PYLG DL+A+ D++ P+    LDS  PCF +I +W  ++ 
Sbjct: 89  KKDIANISGKSVLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHR 148

Query: 175 GKDFKIGKKFTVVTTRHHIVDLTMHLF-NRRNRQTSLIVTYMGAGLLSFCRN-VKKDSQM 232
           G+ +     +T+++ RHHI ++ M LF + +N    L+ TY+  G++   ++     S  
Sbjct: 149 GEHYGAHADYTILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNS 208

Query: 233 SKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRC 292
           +  G+ S++P  +KICYSGF FE+ V E     D+  +  PIFS+VESKL+E I LL+R 
Sbjct: 209 NTTGLNSSNPMTRKICYSGFAFEDLVLE-----DIAENARPIFSVVESKLTESINLLLRN 263

Query: 293 EMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLL 352
           E+D +N V+   TELKCFAPL    S   +++LKTWVQTGL+P SDI+IG+RD+ SG L 
Sbjct: 264 ELDGYNNVTNMFTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLE 321

Query: 353 DIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKP 412
           D+ WY+R  LC+ FN+P LP      N+NA IAVEW  + +E+I  LV ++I+D  S  P
Sbjct: 322 DLVWYNRKDLCRTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIAD--SNHP 379

Query: 413 ESFEIGIDTNNAIVITKLKTTPRNVE 438
            SF++ ID +  I I KL   P+ V+
Sbjct: 380 CSFKLKIDNHKTISIQKLSRIPQTVQ 405

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  251 bits (640), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 226/384 (58%), Gaps = 23/384 (5%)

Query: 58  KRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKES 117
           + R +L  +P+  F H+    F ++P R++F + KE + +  G+ +  +   +   LK  
Sbjct: 8   RNRAQLPSVPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQLHDSISDSI--GLKSP 64

Query: 118 IAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKD 177
             +L        K+    +LG DL+   ++F+P++   LDS   C+ +I  W  DN    
Sbjct: 65  GNKLSHDRSCSNKR---DFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDN-HTS 120

Query: 178 FKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAG--LLSFCRNVKKDSQMSKE 235
           +     F V++ RH++V+LTM LF +   + S++ T++G G  +LS   N KK  Q +  
Sbjct: 121 YSQRSPFVVISPRHYLVELTMQLFQQS--KYSILCTHLGDGKIVLSQVENDKKSHQHTSR 178

Query: 236 GIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMD 295
               N    KKI +SG+  E+ +T   +V D      P F+++E++L   I L++RCE+D
Sbjct: 179 ----NTTMTKKILHSGYALEDLLTRGPRVEDD-----PFFAIIEAELDANISLVLRCELD 229

Query: 296 AFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQ 355
           ++N ++ET TELKC+APL+MHN+ HR KLLKTW+Q  + P  D++IG+R++H G L D+Q
Sbjct: 230 SYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQ 289

Query: 356 WYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESF 415
           +++   L +K N   LP + K  NYNA +AV+WC +CI +ICKLV  N+ D SS  P+ F
Sbjct: 290 YFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENV-DRSS--PQCF 346

Query: 416 EIGIDTNNAIVITKLKTTPRNVEL 439
           ++ ID ++ I + KLK  P +VEL
Sbjct: 347 KLTIDESHKIQLEKLKHVPAHVEL 370

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  236 bits (602), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 136/369 (36%), Positives = 219/369 (59%), Gaps = 17/369 (4%)

Query: 70  SFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILRKDLIPNLKESIAELYESSL 126
            F+H+ + +F + P +  F ES+E+  FT   +   Y    K  +  LK+ I E   +  
Sbjct: 29  GFVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPA 87

Query: 127 LEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTV 186
             A K K  YLG+DL    ++++P++  EL+++    ++I NW   N GK +    KFT+
Sbjct: 88  KNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTI 146

Query: 187 VTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKK 246
           V+ RHH++DL M  F+    + +LIVT++  GLL    +  K    S  GI S D  ++K
Sbjct: 147 VSNRHHLIDLIMCPFSLE--EANLIVTHLD-GLLIISSDKSKPKVDS--GIRSKDTRVRK 201

Query: 247 ICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTE 306
           +CY+GFE EN VT+     D  G     +S+VE+KL+E + LL++ EMD++NP ++   E
Sbjct: 202 LCYTGFELENLVTKGK--VDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVE 259

Query: 307 LKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKF 366
           LKC     + NSNHRRKLL+ W+QTGL+P +D+++G RD +  QL  ++ Y+RD + KKF
Sbjct: 260 LKCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKF 319

Query: 367 NHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKP-ESFEIGIDTNNAI 425
           +   L  N+K  N+N+ +AV+W H+ I  I +LV+ N++D    +P +SF++ +  +  +
Sbjct: 320 STRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTD----EPLQSFKLTLTRDLQL 375

Query: 426 VITKLKTTP 434
            +TKL  TP
Sbjct: 376 SLTKLANTP 384

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  235 bits (599), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 204/340 (60%), Gaps = 7/340 (2%)

Query: 88  FHESKEVALFTNGRAYTILRKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANIDE 147
           +  +K + +F + + Y + R DL P LK+ IA + +S+  E  +   P+LG  L+ N D+
Sbjct: 63  YDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDK 122

Query: 148 FVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQ 207
           + PMT  ELD+   C +Y++ +  ++ G+ +   + F +VT RHH++DL +  F+R+   
Sbjct: 123 YSPMTAKELDTTEACSTYLDQY-ENSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181

Query: 208 TSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVADL 267
            +L+  Y    LL   ++   D+   K G+ +++P +KKIC+SGF  E+ +TE++   + 
Sbjct: 182 VNLLCAYTPGNLLEISQD-PADNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEE- 239

Query: 268 TGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKT 327
              + P F +VE++++    LL+RCE+DA+NP++   TELKC+A  +  N NHRRKLLK+
Sbjct: 240 ---RNPTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKS 295

Query: 328 WVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVE 387
           W+QTG++P +DI+IG+RD+ SG L D++ Y+R+LL  K     LP    ELNY+  I+V 
Sbjct: 296 WIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVV 355

Query: 388 WCHYCIEAICKLVEANISDYSSTKPESFEIGIDTNNAIVI 427
           W    I  +   + + +  +   +P+ F I +D N  I I
Sbjct: 356 WYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRI 395

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  234 bits (598), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 138/386 (35%), Positives = 220/386 (56%), Gaps = 24/386 (6%)

Query: 66  IPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTIL--RKDLI-----PNLKESI 118
           IP+  F ++  H   ++P  +IF E+K VAL+ + R   I     +LI     P L + I
Sbjct: 63  IPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDI 120

Query: 119 AELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDF 178
           + L E SLL++KK K+PY+G++L+  I++F PM  + LDS  PCF Y+    +    K +
Sbjct: 121 SNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKLY 180

Query: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQ---TSLIVTYMGAGLLSFCRNVKKDSQMSKE 235
                +T +T RHH+ +L M ++  R  +    S + T +   L+    ++ K++  S +
Sbjct: 181 --NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQ 238

Query: 236 GIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKC--PIFSLVESKLSEEIGLLIRCE 293
                +   KK+  SGF FE  V EN +       +C  P F + E++L+ +   +IR E
Sbjct: 239 NHKLQNSFSKKVINSGFTFEELVIENFQ-------ECHKPYFYISENRLTPKSTFIIRSE 291

Query: 294 MDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLD 353
           MD++N  +ET TELKCF  L +  + HR+KLLKTW QTGL PN DI+IG+RD+ SG L D
Sbjct: 292 MDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILED 351

Query: 354 IQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPE 413
           + WYSR+ + +K   P LP  K   ++   I ++W ++CI AI      + SD +++ P 
Sbjct: 352 LLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD-TASNPM 410

Query: 414 SFEIGIDTNNAIVITKLKTTPRNVEL 439
           ++++ ID + +I+I KL   P+NVE+
Sbjct: 411 TYKVIIDKHKSIIIKKLSIVPKNVEI 436

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  216 bits (549), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 209/375 (55%), Gaps = 18/375 (4%)

Query: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILRKDLIPNLKES 117
           P   C+    F    + +F  +P    F E KE+   T   +   + + RK   P+LK+ 
Sbjct: 14  PDEACVSCRGFERASISHFPAEP-LHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKD 72

Query: 118 IAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKD 177
           +      ++ +   +   Y+GHDL  + D+F P+T ++L+ +S  F ++  W  D+ GK 
Sbjct: 73  LGLF---TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDH-GKP 128

Query: 178 FKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGI 237
           +  G  FT+V +RH+++DL M  F+  +      V Y+   L  F     K  Q   +GI
Sbjct: 129 YSSGSDFTIVCSRHNLIDLIMAPFS--DEDVHFNVKYINGYLHIF---PDKQFQKKDDGI 183

Query: 238 YSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAF 297
           YS++ N+++ICY+GFE E+ VTE    A     K   +SLV+ K+S+ I LL + EMD F
Sbjct: 184 YSSESNIRRICYTGFELEDLVTETQPGA----PKSAFYSLVQGKISKNIKLLFKAEMDCF 239

Query: 298 NPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWY 357
           NP   + TE+KC   L + ++ HRRKLL+ WVQT L+P++D++IGLRD +  QL   + Y
Sbjct: 240 NPAKRSYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECY 299

Query: 358 SRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEI 417
           +R  L +KFN+  L   KK+ NYNA I+V+W  + ++ +C+ +   + + + T+  SF++
Sbjct: 300 TRQELYQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQTITPYV-EKTPTEAVSFKL 358

Query: 418 GIDTNNAIVITKLKT 432
            +     + + K++T
Sbjct: 359 TLTKQLELRLRKIET 373

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  216 bits (549), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 203/392 (51%), Gaps = 37/392 (9%)

Query: 66  IPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAY----TILRKDLIPNLKESIAEL 121
           + +  F H     +++KP   IF +SKEVA +T G+ Y          ++P LKE IA L
Sbjct: 28  VRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAAL 86

Query: 122 YES-SLLEAKKRKVPYLGHDLFANIDEFV-PMTISELDSVSPCFSYIENWILDNPG-KDF 178
            +S +  ++   K  YLG  L+A  +++V  M+   LDS  PC  YI  W   + G K F
Sbjct: 87  AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKF 146

Query: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIY 238
               +  +V  RHH+V+LTM LF   +    L+ T +    +   +      +   EGI 
Sbjct: 147 GESYRHIIVGPRHHLVELTMALF-ANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEGIT 205

Query: 239 SNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEI---GLLIR---- 291
            +D   + +CYSGF                   C I+SL    +  +    G  IR    
Sbjct: 206 LSDRRTRMLCYSGFVI-----------------CKIWSLNRGIIPSQFFYYGTPIRRGHL 248

Query: 292 ----CEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347
               CEMDA+N +    TELKC+ PL+M +S H+ KLL+TWVQT + P++D++IG R+++
Sbjct: 249 ATFTCEMDAYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAY 308

Query: 348 SGQLLDIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDY 407
            G L DI   SR+ L +KFN+   P      NYNAQ+AVEW  Y ++AI +L+E N++  
Sbjct: 309 DGTLQDITQLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQK 368

Query: 408 SSTKPESFEIGIDTNNAIVITKLKTTPRNVEL 439
           S  +P++F + +   + I I KLK  P+  E+
Sbjct: 369 SVLEPQAFVVTVYRGHDIGIRKLKGVPKYAEI 400

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  211 bits (538), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 214/373 (57%), Gaps = 28/373 (7%)

Query: 70  SFLHTGMHNFLTKPPRDI---FHESKEVALFT---NGRAYTILRKDLIPNLKESIAELYE 123
           +F H  ++ F    P+++   F E +EVA  T   +   + +  K  +P L + + E  E
Sbjct: 23  NFQHAQINQF----PKNVLPFFDEVQEVATITHLLDTDEFLLDDKLGMPELVQDLCEFTE 78

Query: 124 SSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKK 183
           S  L  K +   Y+GHDL  + DE+VP+T  +L+ ++   +++E W   + G+ F     
Sbjct: 79  SGKLANKGK---YIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLH-GRSFCDNAD 134

Query: 184 FTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSK--EGIYSND 241
           FT+V +RH+++DL M  F+  +    L + +    L     N+  D+Q  K  +GI+S D
Sbjct: 135 FTIVCSRHNLIDLIMMPFS--DEDVHLKIQFSNGYL-----NLSPDAQYQKTDQGIHSGD 187

Query: 242 PNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVS 301
             +KKICY+GFE EN +T  SK  D+  S    +SLVE KL + I LL++ EMD FN  +
Sbjct: 188 TKIKKICYTGFELENLITATSK-PDVRSS---FYSLVEGKLGDGIKLLLKAEMDCFNSST 243

Query: 302 ETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDL 361
            + TE+KC + L + ++ HRRKLL+ WVQT L+P++++++G+RD +  QL   + Y+R  
Sbjct: 244 RSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQ 303

Query: 362 LCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGIDT 421
           L +KFN+  L   +K  NYNA I+V+W  + I+ +C++++  I +  S +  +F + +  
Sbjct: 304 LYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQMIKPFI-EKGSKEEVNFRLTLRK 362

Query: 422 NNAIVITKLKTTP 434
           N  I + K+  TP
Sbjct: 363 NLTIKLRKMPETP 375

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  196 bits (499), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 130/390 (33%), Positives = 206/390 (52%), Gaps = 31/390 (7%)

Query: 78  NFLTKPPR----DIFHESKEVALFTNGRAY-----TILRKDLIPNLKESIAELYESSLLE 128
           N   KP +    D++  SKEVA +  G        TI     +P LK+ I ++   SLL+
Sbjct: 46  NSFVKPSKTHFSDLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLD 105

Query: 129 AKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILD--NPGKDFKIGKKFTV 186
           +KK K  Y+G DLF + +++  M    L     CF YI+ +     N  K + + K+F +
Sbjct: 106 SKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVI 165

Query: 187 VTTRHHIVDLTMHLFNR-RNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEG--IYSNDPN 243
           +T+RHHI DL +  F +  + + S+++TY+G   +   ++   +    +E    Y++   
Sbjct: 166 ITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQFYNS--- 222

Query: 244 MKKICYSGFEFENWVTENSKVADLTGS------KCP-----IFSLVESKLSEEIGLLIRC 292
           M+KI  SGF FE+ V ++   + LT S      K P      FS+VE+ +S ++ +L+R 
Sbjct: 223 MRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRS 282

Query: 293 EMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLL 352
           EMD +NP++ + TELKCF  L+M +  HR+KLLKTWVQ G LPNSD+++G RD+ +G L 
Sbjct: 283 EMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLN 342

Query: 353 DIQWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANIS---DYSS 409
           DI W+SRD L  K +    P  +   N     A  W ++ + AI  L    +       S
Sbjct: 343 DITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSLTRDYLKKTPKAPS 402

Query: 410 TKPESFEIGIDTNNAIVITKLKTTPRNVEL 439
           + P  F + ++ N  I +  LK  P +V +
Sbjct: 403 SVPVPFRLIVEKNRTITLLPLKKVPASVPI 432

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  177 bits (448), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 113/345 (32%), Positives = 177/345 (51%), Gaps = 33/345 (9%)

Query: 87  IFHESKEVA-LFTNGRAYTILRKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANI 145
           IF ES+EV   F  G  Y +  K  +P L + I E        +K + + Y+G DL    
Sbjct: 46  IFSESREVGTAFRQGLVYDLDDKKNLPLLNDEICEYISH---RSKSKLIGYVGSDLSVES 102

Query: 146 DEFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRN 205
           + F P+T  EL  +     +I  W  DN   ++    KFT+V+ RHHI+D+ M  F   N
Sbjct: 103 ETFHPVTSEELHCLHGLLKFIAKWEADNE-VNYASRSKFTIVSPRHHILDILMIPFG--N 159

Query: 206 RQTSLIVT-YMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKV 264
            +  L+ T + G  +++   + +        GI S     +KICY+GFE E  +T  S  
Sbjct: 160 ERCRLVFTAHRGLFVITLAPSQRP------TGINSPSSATRKICYTGFELERLLTATSGT 213

Query: 265 ADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKL 324
                 +   +S +E+KL  +I +L++CEMDA+NP  +  TE+K     ++ N  H  KL
Sbjct: 214 -----ERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSVDFNVRNVRHLSKL 268

Query: 325 LKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKF-------NHPGLPTNKKE 377
           LK W QT LLP++DI++G RD  +  L  +  YS D + +K        +HP        
Sbjct: 269 LKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDRTRSHPSY------ 322

Query: 378 LNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGIDTN 422
            N+N ++A +W HY I  IC+ + +++ D +S+ P+SF + ID N
Sbjct: 323 FNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKN 366

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  127 bits (320), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 96/322 (29%), Positives = 165/322 (51%), Gaps = 23/322 (7%)

Query: 112 PNLKESIAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSV---SPCFSYIEN 168
           P L+  +    + S  E K  K  ++G DL    D++VP+  + L+S+      +   E 
Sbjct: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149

Query: 169 WILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKK 228
            +  NP       +K T V+ RHHI+D+ M  F   +   SL++T      +    +  K
Sbjct: 150 TL--NP-------EKTTFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSK 198

Query: 229 DSQMSKEGIYSNDPNM-KKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIG 287
           D      GI+    +  KKICY+GF  E+ + E+     +   +   +S+V   L++EI 
Sbjct: 199 DK---PNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL-YYSIVHGSLNDEID 254

Query: 288 LLIRCEMDAFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347
           LLI+ EMD+ N +++T TE+K      + N+ HRRKLL+ W+QT LLP SD++IG R+S+
Sbjct: 255 LLIQAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSY 314

Query: 348 SGQLLDIQWYS-RDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISD 406
           S +L  ++ Y  +D+  K  N   +    K   +N  +A +W  +  + + + +     +
Sbjct: 315 SNELEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQE 374

Query: 407 YSSTKPESFEIGIDTNNAIVIT 428
            +ST   +F++ IDTN  + I+
Sbjct: 375 STST---TFKVQIDTNLTLSIS 393

>Kwal_55.21591 s55 complement(904533..905942) [1410 bp, 469 aa] {ON}
           [contig 128] FULL
          Length = 469

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 67/152 (44%), Gaps = 21/152 (13%)

Query: 180 IGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLI--VTYMGAGLLSFCRNVKKDSQMSKEGI 237
           + K   V+T R  +VDL +  F  ++     +  V Y+ +G L    +  +D   S    
Sbjct: 104 LPKNIDVLTNRGDLVDLAVSFFPGKDNNFEKMNHVVYLKSGRLFLWHDRARDDTFS---- 159

Query: 238 YSNDPNMKKICYSGFEFENWVTEN--------SKVADLTGSKCPIFSLVESKLSEEIGLL 289
              +   +K  YSG +FE+  T            +  L  +  P  SLV+  LSE++ +L
Sbjct: 160 ---NSRSRKNWYSGHKFEHMCTHTWPDDVKTWGPLPPLDEAAPPTLSLVQLPLSEDMNVL 216

Query: 290 IRCEMDAFNPVSETNT---ELKCFAPLSMHNS 318
           +  E D   P  +  +   ELKCF P  M+NS
Sbjct: 217 MMAEYDVRLPKRQGLSGFAELKCFQP-RMNNS 247

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/184 (26%), Positives = 77/184 (41%), Gaps = 36/184 (19%)

Query: 248 CYSGFEFENWVTENSK---VADLTGSKCPIFSLVESKLSEEIG----------LLIRCEM 294
           CY+G++FE+  T +     V+  T  K P    + S   E I           L++  E+
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRP--KKISSNGDEYIAVVKTGVGSSKLVLGAEI 210

Query: 295 DAFNPVSETN-------TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRD 345
           D      E N        ELKC   +      HR  RKL KTW+Q  L+    I+ G RD
Sbjct: 211 DCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFRD 270

Query: 346 SHSGQLLDIQWYSRD---LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEA 402
            +   L  ++ +S +   +L K+ N         ++N +   A++W     E + KL+  
Sbjct: 271 ENY-TLKSVEEFSTEEVPILLKEHN--------PKMNTSCIDAIKWYGLLTEWLLKLIPR 321

Query: 403 NISD 406
           +  D
Sbjct: 322 DSGD 325

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 100/234 (42%), Gaps = 37/234 (15%)

Query: 140 DLFANIDEFVPMTISELDSVS--PCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLT 197
           DL + I +F      E DS +     S +E +      K      K  ++T R  I  L 
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRKSKK-----TKVDIITFRGIIRKLI 112

Query: 198 MHLFN--RRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMK-KICYSGFEF 254
              F+  + N     IV++ G     F + VK D+  S+  I  N  +++ +  YSG++F
Sbjct: 113 SSAFDSSQFNPVNFRIVSFDGQ---LFIKEVKTDA--SETSINKNRESLQARAYYSGYKF 167

Query: 255 ENWVTEN---SKVADLTGSKCP---------IFSLVESKLSEEIGLLIRCEMDA---FNP 299
           E   T +     V   T  K P           S+V + + +   +LI  E+D    F  
Sbjct: 168 EALATLSLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGIGK-CKILIGAEVDCIFDFKE 226

Query: 300 VSETN----TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSH 347
            S+ N     ELKC   ++  +  H+  RKL KTW+Q  L+  + I+ G RD +
Sbjct: 227 DSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDN 280

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 81/188 (43%), Gaps = 33/188 (17%)

Query: 183 KFTVVTTRHHIVDLTMHLFN--RRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           K  ++T R  I  L    F+  + N+    IV + G     F + V +  +  K+G    
Sbjct: 98  KVDIITFRGVIRKLISSAFDSPKFNQVNLRIVLFDGQ---IFMKEVPRKEEEPKDG---- 150

Query: 241 DPNMKKICYSGFEFENWVTENSKV---ADLTGSKCP---------IFSLVESKLSEEIGL 288
              +    YSG++FEN VT +  +   +  T  K P           S+V + +     L
Sbjct: 151 --KIAPPVYSGYKFENLVTVSKPIPYTSRTTIEKRPKKIVSNGDEYISVVRTGVGN-CKL 207

Query: 289 LIRCEMDA-FNPVSETNTELKCFAPLSMHN-----SNHRR---KLLKTWVQTGLLPNSDI 339
           ++  E+DA F+   E    LK +  L   N     S+ R+   K+ KTW+Q  L+    I
Sbjct: 208 MLGAEVDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRI 267

Query: 340 MIGLRDSH 347
           + G RD++
Sbjct: 268 IYGFRDNN 275

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 60/144 (41%), Gaps = 23/144 (15%)

Query: 249 YSGFEFENWVTENSKVA-------DLTGSKC-----PIFSLVESKLSEEIGLLIRCEMDA 296
           Y+G++FE     N  +A       D     C        S+V++ + +   +L+  E+D 
Sbjct: 159 YTGYKFEALTLLNEPIAFTERDSLDSRADACVSNGDEYVSVVKTGIGKH-RVLMGGEVDG 217

Query: 297 FNPVSETNT-------ELKCFAPLSMHNS--NHRRKLLKTWVQTGLLPNSDIMIGLRDSH 347
                E          ELKC   LS +    N  +KL KTW+Q  L+    I  G RD  
Sbjct: 218 IYDFKEDGADNLKHYLELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRD-R 276

Query: 348 SGQLLDIQWYSRDLLCKKFNHPGL 371
           S  L  I+ Y  + + K F + G+
Sbjct: 277 SYNLTSIEEYLTEDVPKLFTNRGV 300

>KNAG0F03960 Chr6 (745722..750338) [4617 bp, 1538 aa] {ON} Anc_7.541
           YPR184W
          Length = 1538

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 174 PGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRN--RQTSLIVTYMGAGLLSFCRNVKKDSQ 231
           PG DF  G    V  T+ + VD +++ F R    + T+ +       +L  C N +KDS 
Sbjct: 859 PG-DFPPGS-IAVFETQQNGVDESLNHFIRSGAIKATANLSLESLNYILYRCENEEKDSS 916

Query: 232 MSKEGIYSNDPNMKKICYSGFEFENWVT 259
           + KEG Y   PN   + YSG   + WV+
Sbjct: 917 LGKEGTYGV-PNFGNLIYSG--LQGWVS 941

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 288 LLIRCEMD-AFNPVSETNTELKCFAPLS--------MHNSNHRRKLLKTWVQTGLLPNSD 338
           L++  E+D  F+   +T+  LK +A L             +  RKL KTW+Q  L+  + 
Sbjct: 210 LVLGAEVDCVFDFAEDTSNNLKHYAELKCTKGVSTFAEARSFERKLFKTWLQCFLVGINR 269

Query: 339 IMIGLRDSH 347
           I+ G RD H
Sbjct: 270 IIYGFRDEH 278

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 33.9 bits (76), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 64/166 (38%), Gaps = 30/166 (18%)

Query: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300
           D   KKIC +G E+   V      A L                  +G  I C  D F   
Sbjct: 186 DKRSKKICNNGDEYVTVVKTGVGSAKLV-----------------LGAEIDCVFD-FKED 227

Query: 301 SETN----TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDI 354
            + N     ELKC   +      H+  RK+ +TW+Q  L+    I+ G RD +   L  I
Sbjct: 228 GKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTI 286

Query: 355 QWYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLV 400
           + YS D +        L  N  ++N     A++W     E + K++
Sbjct: 287 EEYSTDEI-----PILLKNNNTKMNSMCLDAIKWYGLFTEWLLKII 327

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 33.5 bits (75), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 79/188 (42%), Gaps = 31/188 (16%)

Query: 183 KFTVVTTRHHIVDLTMHLFN--RRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240
           K  ++T R  I  L    F+  R NR    IV++ G     F + V +     K    + 
Sbjct: 99  KADIITFRGIIRKLISSAFDNPRYNRVNLRIVSFDGQ---LFIKEVGEPFVPPK----TT 151

Query: 241 DPNMKKICYSGFEFENWVT---ENSKVADLTGSKCP---------IFSLVESKLSEE--- 285
           D    +  YSG++FE+ VT      +V+  T  K P           S+V + + +    
Sbjct: 152 DSIEHRSYYSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKSKLI 211

Query: 286 IGLLIRCEMDAFNPVSETN----TELKCFAPLS--MHNSNHRRKLLKTWVQTGLLPNSDI 339
           +G  + C  D F   S  N    TELKC   ++         RK+ KTW+Q  L+  + +
Sbjct: 212 LGAEVDCVFD-FKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRV 270

Query: 340 MIGLRDSH 347
           + G RD +
Sbjct: 271 IYGFRDDN 278

>TPHA0G03650 Chr7 (776977..778110) [1134 bp, 377 aa] {ON} Anc_3.570
           YGL246C
          Length = 377

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 22/161 (13%)

Query: 288 LLIRCEMDAFNPVSETN-------TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSD 338
           +L+  E+DA     E          ELKC A ++  N   +   KL KTW+Q  L+  + 
Sbjct: 206 ILLGAEVDAIFDFKEKGKDNLQHYIELKCTAAINNINDTKKFENKLFKTWIQCFLIGITR 265

Query: 339 IMIGLRDSHSGQLLDIQWYSRDL-LCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAIC 397
           I  G RD         ++ + D+ L  K ++P L +       N   A++W     E + 
Sbjct: 266 ITYGFRDEQYLLKTIEEFATSDIPLIFKNHNPTLAS-------NCVNAIKWYGVFTEWLM 318

Query: 398 KLVEANISDYSSTKPESFEIGIDTNNAIVITKLKTTPRNVE 438
           K++     D S TK       +  NN + +T+++++    E
Sbjct: 319 KMIPT--EDTSVTKAYRL---VCENNHLRLTEIESSEDEYE 354

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSH 347
            ELKC   ++  +  H+  RKL +TW+Q  L+    I+ G +D H
Sbjct: 240 AELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>Suva_16.119 Chr16 (201273..202514) [1242 bp, 413 aa] {ON} YPL188W
           (REAL)
          Length = 413

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 154 SELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVT 213
           S  D VSP  S +++ I  NP ++  I KK    +TR  +V+   HL +    + ++IV 
Sbjct: 46  SSADFVSPPNSKLQSLIWHNPLQNVYITKKPWTPSTREAMVEFITHL-HESYPEVNVIVQ 104

Query: 214 YMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFE 253
                      +V ++     +    NDPN   I Y+G E
Sbjct: 105 ----------PDVAEEISQDFKAPLENDPNRPHILYTGSE 134

>Smik_4.480 Chr4 (877382..879016) [1635 bp, 544 aa] {ON} YDR235W
           (REAL)
          Length = 544

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 39/80 (48%), Gaps = 14/80 (17%)

Query: 147 EFVPMTISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNR 206
           E +  T S + +V P   Y+EN+ +D    ++K+G     V+T H I    +  FN+R  
Sbjct: 54  ELIRYTYSSMLNVFP---YLENYHIDFALLEYKLGN----VSTSHKIFQRGLQAFNQR-- 104

Query: 207 QTSLIVTYMGAGLLSFCRNV 226
             SL+   +    L FC NV
Sbjct: 105 --SLL---LWTSYLKFCNNV 119

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSH 347
            ELKC   +   +  H+  RKL +TW+Q  L+    I+ G +D H
Sbjct: 240 AELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>Kwal_27.12021 s27 complement(1049035..1053936) [4902 bp, 1633 aa]
           {ON} [contig 24] FULL
          Length = 1633

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 11/117 (9%)

Query: 179 KIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIY 238
           +I K F  +T    ++++T  L +      ++   Y+ A L S   +V K  +++K  I 
Sbjct: 16  QIAKYFCELTEAFPVLEITEELLD------AIEEGYVPAYLASIWLSVTKSPEVAKLAIE 69

Query: 239 SNDPNMKKICYSGFEFENWV---TENSKVADLTGSKCPIFSLVESKLSEEIGLLIRC 292
                + +   +G  +  W+   T+ SKV +  G    I SL E+   E++G   R 
Sbjct: 70  QQHSVLTR--RAGLRYLGWLFKHTDGSKVLESIGGNSKIVSLFEALSVEDVGTFSRA 124

>YPL188W Chr16 (191406..192650) [1245 bp, 414 aa] {ON}
           POS5Mitochondrial NADH kinase, phosphorylates NADH; also
           phosphorylates NAD(+) with lower specificity; required
           for the response to oxidative stress
          Length = 414

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 154 SELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVT 213
           S  D VSP  S +++ I  NP ++  I KK    +TR  +V+   HL +    + ++IV 
Sbjct: 46  SSADFVSPPNSKLQSLIWQNPLQNVYITKKPWTPSTREAMVEFITHL-HESYPEVNVIVQ 104

Query: 214 YMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFE 253
                      +V ++     +    NDPN   I Y+G E
Sbjct: 105 ----------PDVAEEISQDFKSPLENDPNRPHILYTGPE 134

>Smik_6.393 Chr6 complement(631846..633090) [1245 bp, 414 aa] {ON}
           YPL188W (REAL)
          Length = 414

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 11/100 (11%)

Query: 154 SELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVT 213
           S  D VSP  S +++ I  NP ++  I KK    +TR  +V+   HL +    + ++IV 
Sbjct: 46  SSADFVSPPNSKLQSLIWQNPLQNVYITKKPWTPSTREAMVEFITHL-HESYPEVNVIVQ 104

Query: 214 YMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFE 253
                      +V ++     +    NDPN   I Y+G E
Sbjct: 105 ----------PDVAEEISQDFKSPLENDPNRPHILYTGPE 134

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSH 347
            ELKC   +   +  H+  RKL +TW+Q  L+    I+ G +D H
Sbjct: 240 AELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>Skud_4.495 Chr4 (887665..889299) [1635 bp, 544 aa] {ON} YDR235W
           (REAL)
          Length = 544

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 163 FSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSF 222
           F Y+EN+ +D    ++K+G     V+T H I    +  FN+R    SL+   +    L F
Sbjct: 67  FPYLENYYIDFALLEYKLGN----VSTSHKIFQHGLKAFNQR----SLL---LWISYLKF 115

Query: 223 CRNV 226
           C NV
Sbjct: 116 CNNV 119

>TDEL0D06380 Chr4 (1146443..1147579) [1137 bp, 378 aa] {ON}
           Anc_3.570 YGL246C
          Length = 378

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSH 347
            ELKC A +S      +  +K+ KTW+Q  L+    I+ G RD +
Sbjct: 232 AELKCSAMVSTQADARKFEKKIFKTWLQCFLVGIPRIIYGFRDDN 276

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score = 30.8 bits (68), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 209 SLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFENWVTENSKVADLT 268
           SL ++Y   GL+ +      DS          D   KK CY  F+  N   EN  + +L 
Sbjct: 167 SLDISYTNVGLVEYF----TDSAGKDYMFVLCDIQNKKTCYKLFQL-NHSAENLPITELN 221

Query: 269 GSKCPIFSLVESKLSEEIGLLIR 291
                 F+L ESK+  + G L R
Sbjct: 222 SVILEDFALAESKMVYQFGKLYR 244

>NDAI0F02290 Chr6 complement(553379..554647) [1269 bp, 422 aa] {ON}
           Anc_6.186
          Length = 422

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 152 TISELDSVSPCFSYIENWILDNPGKDFKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLI 211
           T S  + V+P  S +++ I   P ++  I KK    TTR  +VD   H+ +    + ++I
Sbjct: 48  TSSTAEFVTPPNSKLQSLIWHKPLQNVLITKKPWTPTTREAMVDFITHIHDSY-PEVNII 106

Query: 212 VTYMGAGLLSFCRNVKKDSQMSKEGIYSNDPNMKKICYSGFEFE 255
           V           R+V  +     +   ++DPN   + Y+G E E
Sbjct: 107 VQ----------RDVADEIAQDFKTTLNHDPNRPHVLYTGTEEE 140

>Suva_4.187 Chr4 complement(327838..329688) [1851 bp, 616 aa] {ON}
           YDL063C (REAL)
          Length = 616

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 96  LFTNGRAYTILRKDLIPNLKESIAELYESSLLEAKKRKVPYLGHDLFANIDEFV 149
           +F +G+  +IL+  ++PNL++    + ++   E K+R      HD F  +D F+
Sbjct: 561 IFVSGKFLSILKDQVVPNLRQQFKMVDKNKNPELKER-----CHDCFTTLDSFI 609

>ZYRO0E09592g Chr5 (764748..765890) [1143 bp, 380 aa] {ON} similar
           to uniprot|P53063 Saccharomyces cerevisiae YGL246C RAI1
           Nuclear protein that binds to and stabilizes the
           exoribonuclease Rat1p required for pre-rRNA processing
          Length = 380

 Score = 30.4 bits (67), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 12/100 (12%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDL- 361
            ELKC A +S      +  RK+ +TW+Q  L+    I+ G RD+++  L  ++ Y+    
Sbjct: 232 AELKCSADVSTPADARKFERKVFRTWLQCFLVGIPRIIYGFRDNNN-VLKTVEEYTTTEV 290

Query: 362 -LCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLV 400
            +  K N+P        +N +   A++W     E + K++
Sbjct: 291 PVLLKSNNPA-------MNSSCLDAIKWYGTLTEWLLKMI 323

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,874,785
Number of extensions: 2093549
Number of successful extensions: 5177
Number of sequences better than 10.0: 49
Number of HSP's gapped: 5281
Number of HSP's successfully gapped: 49
Length of query: 442
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 329
Effective length of database: 40,524,141
Effective search space: 13332442389
Effective search space used: 13332442389
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)