Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR369C (XRS2)5.435ON85485441740.0
Smik_4.6355.435ON86377321540.0
Skud_4.6385.435ON84381519580.0
Suva_2.5415.435ON86988119270.0
KAFR0E038305.435ON8457486972e-78
NCAS0F033905.435ON8617566666e-74
TDEL0E019005.435ON7627216441e-71
TBLA0A028205.435ON9257555692e-60
Kpol_1016.55.435ON8127205244e-55
KNAG0C049005.435ON7697314908e-51
ZYRO0F10054g5.435ON6603894522e-46
KLTH0F16038g5.435ON7927114535e-46
NDAI0B056805.435ON8562013782e-36
CAGL0A02838g5.435ON8283923682e-35
SAKL0G02552g5.435ON8344293202e-29
Kwal_55.214225.435ON7824122907e-26
AER402C5.435ON8697952891e-25
TPHA0J025905.435ON7751142353e-19
KLLA0E02201g5.435ON8352262068e-16
Ecym_47615.435ON7981821593e-10
TDEL0B016008.476ON20988770.93
TBLA0A105904.362ON60351771.6
TDEL0A005703.38ON78263743.7
Ecym_74764.387ON24285723.8
SAKL0D08800gna 1ON579196743.8
NDAI0E038407.57ON138997744.5
NDAI0E002708.844ON1198137735.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR369C
         (854 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...  1612   0.0  
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   834   0.0  
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   758   0.0  
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   746   0.0  
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   273   2e-78
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   261   6e-74
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   252   1e-71
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   223   2e-60
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   206   4e-55
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   193   8e-51
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   178   2e-46
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   179   5e-46
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   150   2e-36
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   146   2e-35
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   127   2e-29
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   116   7e-26
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   115   1e-25
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    95   3e-19
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    84   8e-16
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...    66   3e-10
TDEL0B01600 Chr2 complement(283799..284428) [630 bp, 209 aa] {ON...    34   0.93 
TBLA0A10590 Chr1 complement(2620380..2622191) [1812 bp, 603 aa] ...    34   1.6  
TDEL0A00570 Chr1 (96698..99046) [2349 bp, 782 aa] {ON} Anc_3.38 ...    33   3.7  
Ecym_7476 Chr7 (970588..971316) [729 bp, 242 aa] {ON} similar to...    32   3.8  
SAKL0D08800g Chr4 complement(732221..733960) [1740 bp, 579 aa] {...    33   3.8  
NDAI0E03840 Chr5 (841914..846083) [4170 bp, 1389 aa] {ON} Anc_7....    33   4.5  
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844      33   5.0  

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score = 1612 bits (4174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 797/854 (93%), Positives = 797/854 (93%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
           SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
           WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180

Query: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240
           RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK
Sbjct: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240

Query: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300
           SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML
Sbjct: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300

Query: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360
           TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR
Sbjct: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360

Query: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420
           RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ
Sbjct: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420

Query: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480
           NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS
Sbjct: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480

Query: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC 540
           QTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC
Sbjct: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC 540

Query: 541 KSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV 600
           KSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV
Sbjct: 541 KSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIV 600

Query: 601 EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNN 660
           EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNN
Sbjct: 601 EPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNN 660

Query: 661 TQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNI 720
           TQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNI
Sbjct: 661 TQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNI 720

Query: 721 NSNTIQKRSQALNRFTXXXXXXXXXXXXXXXXRCSGTAASVQPLKNKIFITXXXXXXXXX 780
           NSNTIQKRSQALNRFT                RCSGTAASVQPLKNKIFIT         
Sbjct: 721 NSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRCSGTAASVQPLKNKIFITDEDDLGDID 780

Query: 781 XXXXRLNHRENNRNLFVVKEMNLRPNLSEECSKQXXXXXXXXXXXXXXXXXXNNXXXXXX 840
               RLNHRENNRNLFVVKEMNLRPNLSEECSKQ                  NN      
Sbjct: 781 DKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQSRHSRSATSRSRGSFGASNNGDGDDD 840

Query: 841 XXXXPKFTFKRRKG 854
               PKFTFKRRKG
Sbjct: 841 DDDGPKFTFKRRKG 854

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/773 (58%), Positives = 561/773 (72%), Gaps = 8/773 (1%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWVVRYQN LEDG+IS ISCCLQA K+YSIGRSSKNPLIIK+DKSISRQHIT KW+ N+ 
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
           SD  H+SLCL+N+GKLTS+N KFMKVGETF I A  V  ST IELG TPIRIE EW N+V
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
           WNIP HL QFRT LS++GISTE SIN++P N+MISDYP S+DN IREL AL   IP+KKS
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180

Query: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240
           + L++LCNTLL  S T+L FDE WND++ +PEY+VFD +P++L SKFM+L++I +LTTI 
Sbjct: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240

Query: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300
           +EP L S+LR FNI LF F +I+SLYK+VDSL+ ST+YLILT+ +KKENG+ILCT K +L
Sbjct: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300

Query: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360
           TS+I  TL++VIN K  S    +N    +  E +S+  K     E EASPV+ KKR+LNR
Sbjct: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVILKKRRLNR 360

Query: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420
           RRVLPLDSL+FFAGGL+ K  SE++ +TD K   CG +SK+VISSP I  A+EKH+   Q
Sbjct: 361 RRVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420

Query: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480
           +  K   DI K++GH+S GAIIVSSP    V TS+  LD S      PQ S   +    S
Sbjct: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDIS------PQQSSTNMTRRDS 474

Query: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHH--QNIEQPSKNIRKLSNYSREISSPLQE 538
           Q  S++  ++ETAA +SM++ + TK + +  H   ++ Q S+   +L NYS+++S PL+ 
Sbjct: 475 QKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKA 534

Query: 539 NCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA 598
           + +SPVKE+S +EKS  PH+FV+AIQ+TK REVKRVKSTIVEL+D+ELSEEAINQL+ LA
Sbjct: 535 DLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLA 594

Query: 599 IVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGK 658
           IVE +N+LLRK  D   N  S +TEK  N ++  EW +RKNFKTFVK  PK KA KE  K
Sbjct: 595 IVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSK 654

Query: 659 NNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSD 718
           N+TQ SDFIR AAFLITRNYVPLKKYSKK+  TKW  EE++DM ALTEME+ GSN ++SD
Sbjct: 655 NDTQKSDFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISD 714

Query: 719 NINSNTIQKRSQALNRFTXXXXXXXXXXXXXXXXRCSGTAASVQPLKNKIFIT 771
             NS TI KR Q    F                 R S  A + QP   K+FIT
Sbjct: 715 TTNSTTIHKRPQTQRIFISEDSSDNGEEDSFSFSRGSDAAPNAQPGTIKLFIT 767

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/815 (52%), Positives = 546/815 (66%), Gaps = 21/815 (2%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWV+RYQNT+EDG IS ISCCLQA K+YSIGRSSKN LIIKNDKSISRQHITFKWEIN  
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
            +LK S L L+N+GKLTS+NKKF+KVGE F I A +V   T IELGT+P  IE  W++E+
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
           WNIP HLT+FRT LS++GISTE SI+D P NLMISD+P S+DN +RELYALV+ IP+KK 
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180

Query: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240
           R L+++C TLLP S  NLKFDEMW D++++PE+NVF+FD ++L SKFM+LN I VLTT  
Sbjct: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240

Query: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300
           +E RLS+ LR  N+ L  FDN+ SLY++VD L+ S +YLILT+T+K ENG+I CTI  ++
Sbjct: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300

Query: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360
           TS+I+  L A+ N K      + N KF+++SE  ST  KT   PE+E  P + KKR+LNR
Sbjct: 301 TSVIEDALPAITNTKSVPCE-IQNKKFERVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359

Query: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420
           RRV PLDSL FFAGGLS+K+ SE++   DA++L+ G   KTVISSPNI   DE  +  ++
Sbjct: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419

Query: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480
           N  K  E+  K++G  S GAI++SSP L   + SEDS DK       P+ S   V   G 
Sbjct: 420 NIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKP------PRLSPLTVTRPGL 473

Query: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHH--QNIEQPSKNIRKLSNYSREISSPLQE 538
           Q   SN     T   + M+D  + +N+       ++I Q  +   +    S+E +S  Q 
Sbjct: 474 Q---SNPLISRTTPAHYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQV 530

Query: 539 NCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA 598
           + KSPVKEL  K KS TP +FVEAIQETKNREV+R KSTIV+L+D+ELSEE INQLKNLA
Sbjct: 531 DRKSPVKELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLA 590

Query: 599 IVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGK 658
           IVEP+ +LLRK      N      +K E+ +M  EWH+RKNFKTF+KV PK K   E  K
Sbjct: 591 IVEPNEDLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNK 650

Query: 659 NNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSD 718
            +TQ+SDFIR+AAFLITRNYVPL+KYSK +  T+   +ENEDM  L EME   SNT +S 
Sbjct: 651 GDTQNSDFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSG 710

Query: 719 NINSNTIQKRSQALNRFTXXXXXXXXXXXXXXXXRCSGTAASVQPLKNKIFITXXXXXXX 778
           N +S  IQ+  +  N F                 R S  A   QP KNK+F+T       
Sbjct: 711 NTSSAVIQQGPRTQNTFINEDISDEGNQQSFSFSRHSDIA---QPAKNKLFVTEDDDKNN 767

Query: 779 XXXXXXRLNHRENNRNLFVVKEMNLRPNLSEECSK 813
                  +N  EN   L  +K++ LRP+  +E SK
Sbjct: 768 M------VNDSENGCELITLKKIGLRPSNFDEPSK 796

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  746 bits (1927), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/881 (49%), Positives = 571/881 (64%), Gaps = 39/881 (4%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWV+RYQN LEDGSI+ ISCCLQA K+YSIGRSSKN L+IKNDKSISRQH+TFKWEIN+S
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
            + K + L LVN+GKLTS+NKKFMKVGET TI+ + V   T IELGTTPIRI+FEWI+E+
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
           WNIP +L QF+T+LS++GI+T+ SI+D  A+++ISD+P + D+ +RELYALV TIP+KKS
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240
           + L++LCN+LL +S  NLKFDE WN+M++ P + VFD+DP++L SKFMRL+N+  LTTI 
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240

Query: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300
           +E  L ++LR  N+ LF FD ++ LYK+VD L+ S +YLILT T+K+ENG+ LCT++ ++
Sbjct: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300

Query: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360
           TSIID TL +VIN K       +N   +++ EG + I KT   PE EA+P V KKR+LNR
Sbjct: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAVLKKRRLNR 360

Query: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420
           RRV PLDSL+FFAGGLS    S+++   DAK       SKT +SSP I E D K +  +Q
Sbjct: 361 RRVQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420

Query: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLG--TVNTSEDSLDKSLQSHKLPQPSLPEVAGI 478
           N  + + D  K++G+   GA++V SP +G    +  E+ +++SL      QPS P V   
Sbjct: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESL------QPS-PTVTRP 473

Query: 479 GSQTISSNSADYETAAVNSMDDAEVTKNFRV--------NHHQNIEQPS----------- 519
            SQ IS+      T     M+  ++ +++++        N  QN  Q             
Sbjct: 474 DSQNISAYPV--TTTPEKHMEGRKIVESYKISDDSTQNENQTQNENQTQNENQTQNEMKI 531

Query: 520 -----KNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRV 574
                K+ RK S  S++  S  Q    SP++ELS+KE+S TPH+FVEAIQ+TKNREVKRV
Sbjct: 532 KLQTLKDNRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRV 591

Query: 575 KSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEW 634
           KSTIVEL+D+ELSEEAINQL NLAIVEPSN LLR       N+T  +  + E   +  EW
Sbjct: 592 KSTIVELEDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEW 651

Query: 635 HKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWG 694
            KRKNFKTF KV P SK  KE  K N Q+SDFIR+AAFLITRNYVPLKKYSKKD  + W 
Sbjct: 652 PKRKNFKTFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWD 711

Query: 695 TEENEDMFALTEMERFGSNTFMSDNINSNTIQKRSQALNRFTXXXXXXXXXXXXXXXXRC 754
            E N+D+ ALTEME   S+T + DN +++ IQ+RS A +                   R 
Sbjct: 712 KENNDDVLALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRR 771

Query: 755 SGTAASVQPLKNKIFITXXXXXXXXXXXXXRLNHRENNRNLFVVKEMNLRPNLSEECSKQ 814
           S TA++ QP+KNK+F+               +N  E+   L  + + NL+P+ +EE SK+
Sbjct: 772 SDTASTYQPVKNKLFVAEDDDNDDENDI---VNDSEDGFELVTITKSNLQPDAAEESSKR 828

Query: 815 XXXXXXXXXX-XXXXXXXXNNXXXXXXXXXXPKFTFKRRKG 854
                               N          PKF FKR+KG
Sbjct: 829 NRSGGNAASRPLGSYRNDNVNDSDDDDDDEGPKFKFKRKKG 869

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  273 bits (697), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 239/748 (31%), Positives = 360/748 (48%), Gaps = 121/748 (16%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RY+N LEDG++  +SCCLQ +K YSIGRSSKNPL IKNDKSISRQHIT +W+ NN 
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
                + L +VN+GKLT++++ +MK  E+   +  +   + +++LGT P+ +   W    
Sbjct: 61  G--TGTVLSVVNQGKLTAIDENYMKSDESKAFD-DETYSTVVVKLGTKPVVVRISWTPIF 117

Query: 121 WNIPPHLTQFRTMLSEYGISTEI---SINDIPANLMISDYPKSEDNSIRELYALV-STIP 176
           W++     QF   ++  GI T++   ++ DI  +L+I+D    + N  R ++AL+     
Sbjct: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDI--SLVIND---EKSNWSRIMFALLKQNCT 172

Query: 177 MKKSRFLMELCNTLLPTSKTNLKFDEMWNDMI-SNPEYNV---FDFDPNILLSKFMRLNN 232
           + K   L E+CN LL   +TN  FDE+W  +  S   Y V   F  + N +L  F  +  
Sbjct: 173 LVKPVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQF 230

Query: 233 IRVLTTIKSE-PRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKEN-- 289
             V +    +   L + +     N  +FD  D L  Y+ ++  +   L+     K+E+  
Sbjct: 231 YTVGSISHDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHN---LLKCIALKQEDPA 287

Query: 290 -----GKILCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISE------------ 332
                G  +  IK ++ +I+DG    +    G S+ +      D IS             
Sbjct: 288 PDEIQGIKIYAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVH 347

Query: 333 -------------GMSTILKTSR------APEVEASPVVSKKRKLNRRRVLPLDSLDFFA 373
                         +S   + SR       P     P  +K+R+L RR V PLDSL FFA
Sbjct: 348 PDNTSTLNTNTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFA 407

Query: 374 GG-----LSTKTLS----ENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQNALK 424
           GG      + KT+S     N S T +       ESK  +++    E        +Q AL+
Sbjct: 408 GGSTNPSTTLKTVSPVVPSNASNTTSDEKPNKVESKLGVNNARRDEQTNDQVDVVQTALQ 467

Query: 425 PTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLP-QPSLPEV-AGIGSQT 482
                   S   +    I +   L T N  E   + S++   +P +P  P+V   +  Q 
Sbjct: 468 SL------SSQPTTNRSIQNKGILRTENNDEMLTNASIKRRNMPLKPLSPDVDTNLLIQP 521

Query: 483 ISSNSADYETAAV--NSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENC 540
           I SNS   +   V   SM+D + + N                  LS  +R I S   E+ 
Sbjct: 522 IDSNSNVSQETNVPKESMEDNDNSSN-----------------TLSEVNRNILSRKSES- 563

Query: 541 KSPVK-ELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAI 599
             P K ++S+ ++S +P AF+EA+Q TK REVKR+++ IV++   ELSEEAIN+L NL I
Sbjct: 564 -GPHKFDVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTI 622

Query: 600 VEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKN 659
           VE + NL+R+          R  +K  N  +   W  R+NFK F KV P+   H++    
Sbjct: 623 VESNPNLIRE----------RRADK--NDSVNDMWKGRRNFKKFNKVWPQ---HRD---- 663

Query: 660 NTQSSDFIRNAAFLITRNYVPLKKYSKK 687
                D +RN AFLI RNYV LK Y  K
Sbjct: 664 ---GYDSLRNNAFLIIRNYVELKPYDGK 688

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  261 bits (666), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 227/756 (30%), Positives = 357/756 (47%), Gaps = 122/756 (16%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWV+RYQ  LEDGS   IS C+Q    Y+IGRS+KN L IKNDKSISRQH++ KWE  N 
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND 60

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
                  + ++N+GKLT + ++++ VG++ T    + L    I+LGT P+ +  E+ +  
Sbjct: 61  -------IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLS---IKLGTKPVMVHLEFYSSN 110

Query: 121 WNIPPHLTQFRTMLSEYGI--STEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178
           W IP  LTQF   L ++G+  +T+I ++      +I D  +   + +  L+  +  IP+K
Sbjct: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVD--EINGSGLIPLWGFMKDIPVK 168

Query: 179 KSRFLMELCNTLLPTSKTNLKFDEMW-------NDMISNPEYNVFD----FDPNILLSKF 227
           K +F    C  L   S  +  FD  W       N +  +   ++ D    F+  ++L  F
Sbjct: 169 KPQFFSTACEIL---SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILF 225

Query: 228 MRLNNIRVLTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEAST----------- 276
               N   + T+K+   L   +      +  F ++++   Y+++L+ +T           
Sbjct: 226 DNETNKDAVKTLKTALNLGGAI------VNDFSDLNASKDYINNLKPTTNQHICLVKFGS 279

Query: 277 -----------EYL----ILTTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGASSRT 321
                      EY     I+T     +  K++ TI      +++  +S +  +   S R 
Sbjct: 280 FKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITTIPER-EQVMNQDVSLIPEITYPSDRK 338

Query: 322 LD----NGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLS 377
            +    +   D I      +L      E      + KKR+LNR+RV PLDSL FFAGG S
Sbjct: 339 TNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGAS 398

Query: 378 TKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADE--KHAPFLQNALKPTEDIGKKSGH 435
            K                       I SP + E  +  K      +  +    + + SG+
Sbjct: 399 PK-----------------------IGSPAVQETAQATKDESAESDKFRTNNGLTQPSGN 435

Query: 436 SSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTI--SSNSADYETA 493
           S P  +I S P +      E   +K++Q    P  ++P +    +Q +  +  + + E  
Sbjct: 436 SQP--LIHSEP-IVLKEVLEADHNKNIQEG--PTTAVPVIQSKSTQPLEHTEQNKNSEIG 490

Query: 494 AVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKS 553
           +V +    EV     V      + PS     +SN+            K  +K  S++E  
Sbjct: 491 SVAATPTPEVLTGNGVERPNTPQVPSTQAL-VSNHKE----------KKNLKSNSLEE-- 537

Query: 554 GTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDS 613
             P +FV+AIQETKNREV R+KST+VE+  +EL+E AINQL +L IVEP+ +L+RK    
Sbjct: 538 --PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRK---K 592

Query: 614 EGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFL 673
                 RT    ++     EW +RKNFK FVK+ PK      E    + ++D IRN AFL
Sbjct: 593 ASRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTE----SDTTDLIRNNAFL 648

Query: 674 ITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMER 709
           ITRNYVP+KK++ +         ++EDM+   + ER
Sbjct: 649 ITRNYVPMKKFTGQYNNV---PNDDEDMYEHHDYER 681

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  252 bits (644), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 215/721 (29%), Positives = 354/721 (49%), Gaps = 117/721 (16%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW+++Y   LEDG+I  +S CL   +T+SIGRSSKNPL IKNDKSISR HI+  W+    
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWD---- 56

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINAS-DVLKSTIIELGTTPIRIEFEWINE 119
           S++K   + L+N+G+LT+   K++KVGE+        + +  IIELGT PI++E  W + 
Sbjct: 57  SEVK--LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114

Query: 120 VWNIPPHLTQFRTMLSEYGISTEI-SINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178
           V+++P  L+QF   L   GI  +  ++++    ++++D  K    + + L+ L++   ++
Sbjct: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKF---AYKCLFGLINGAVIR 171

Query: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVF--DFDPNILLSKFMRLNNIRVL 236
            S+FL+E+ N L   SK    F+E W+ +I N  Y ++  +  P+ ++ K  +     + 
Sbjct: 172 NSQFLVEVTNIL---SKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKF--YLIA 226

Query: 237 TTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTT--TDKKENGKI-L 293
           + + +   +   L   N  L   +N + L   +    ++ + ++L    T K    KI L
Sbjct: 227 SDVITMAYVQEALERGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKIKL 286

Query: 294 CTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKT-----------SR 342
            T+  ++ ++   T+  ++         ++ G  D I     T+ KT             
Sbjct: 287 HTLVDLVNAVSHNTVKTLL----GGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEH 342

Query: 343 APEVEASPVVS---KKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAES 399
            PE   +P      K+R+ N  RV PLDSL FFAGG  +    E    T          +
Sbjct: 343 TPEHTVTPAEKPPVKRRRYN--RVKPLDSLMFFAGGDYSTEEPEQEISTQPVNPAASDTA 400

Query: 400 KTVISSP-NIAEAD--------EKHAP--FLQNALKP-TEDIGKKSGHSSPGAIIVSSPN 447
           KT I++  N+ E D        +K  P   L+N+ KP T D        SPG     + N
Sbjct: 401 KTSITTQINVPENDASQESSAFDKFQPNIVLKNSAKPLTID--------SPG----DAHN 448

Query: 448 LGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAEVTKNF 507
              +NT+                    V  I  Q             +N  +  + ++  
Sbjct: 449 THEINTANQ-----------------HVKDIAQQI-----------EMNHPESEQQSEQA 480

Query: 508 RVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETK 567
            +N  +   +P+   + L ++   +++P  +N  S  + L            V+ I++ K
Sbjct: 481 NLNMVETTPRPTARKKTLQDFKSTVNNP--DNSASSTEGL------------VDLIKDAK 526

Query: 568 NREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKS-FDSEGNKTSRTTEKWE 626
           +REVKR+KST+V++  +EL+E+AINQL +LAIV+P+++L+R+   DS   +TSR  +   
Sbjct: 527 SREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSA--ETSRNDQ--- 581

Query: 627 NSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSK 686
                P W  RKNFK FVKV+ K K  +        SSDFIRN+ +L+TR YVP K Y+K
Sbjct: 582 ----HPPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTK 637

Query: 687 K 687
           +
Sbjct: 638 E 638

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  223 bits (569), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 220/755 (29%), Positives = 358/755 (47%), Gaps = 102/755 (13%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++ Y     D +++ +SCCL+  +TYSIGRS K+PL +KNDKSISRQH+TF W     
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHW----- 55

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
           +   ++ L L+N+GKLT +N + +   ET   NA D+     +ELG TP+ +   W N V
Sbjct: 56  TGNLNNQLSLLNQGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDY-PKSEDNSIRE---LYALVSTIP 176
           +NIP    QF + L +YG +         A   + D  P+  +N+       Y+LV+   
Sbjct: 115 YNIPIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174

Query: 177 MKKSRFLMELCNTLLPTSKT-NLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRV 235
           + KS FL  L N L P   T N+ F  + +         + DF    L S  + L  I++
Sbjct: 175 ILKSSFLTSLLNLLNPNVTTFNIDFQNLLD------ASKIEDFRNINLESLKVELTGIKL 228

Query: 236 LTTIKSEPRLSSLLRTFN-INLFAFDNIDSLYKYVDSLEASTE--YLILTTTDKKENGKI 292
           +    +   L   +     INL      D    +++++++ +E   ++LTT++ +    I
Sbjct: 229 IVLNDNTTDLIYFIAAMEVINLPTITTEDDTI-FINTVKSHSEERLILLTTSNSRHIETI 287

Query: 293 -LCTIKTMLTSIIDGTLSAVIN-MKGASSRTL-------------------------DNG 325
            + T K     I +  ++ +I  +K  S  T+                         DN 
Sbjct: 288 KVHTFKDFYQGIKNQNINHLIQVIKKDSPHTIERNSRETISLNNENQTYSQLSPYIEDNN 347

Query: 326 KF------DQISEGMSTILKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTK 379
           K       D + +  S ++K S        P V K+R+LNR+RV PLDSL FF GG +T 
Sbjct: 348 KVNSNTISDSLLKQTSELIKPSVNDHAPEKPPV-KRRRLNRKRVQPLDSLHFFVGG-NTN 405

Query: 380 TLSENRSLTDAKRLNCGAESKTVIS---SPNIAEADE-------KHAPFLQNALKPTEDI 429
               N S T++   N  A  + V S   S +  + DE          PFL+  L     I
Sbjct: 406 PTQNNLSQTESDLKNV-ANPRNVFSQRKSNDKIDKDEIIVSQPYTKEPFLKEDLSIPTSI 464

Query: 430 GKK-----------SGHSSPGAIIVSSPNLGTVNTSEDSLDK-----SLQSHKLPQPSLP 473
            K+             +S    + +  P    + ++  S+ K     SL ++K+   S  
Sbjct: 465 TKQMSLSNNETLQYPSNSQHSPVSLQEPICSNIGSNIPSIGKEDTNPSLVTNKIMAASTS 524

Query: 474 ----EVAGIGSQTISSNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSNYS 529
               ++    S+   ++S D + +     D AE+T        Q  E+ + +   L+N  
Sbjct: 525 KKDVKILAARSKKPLNDSIDMDMS-----DQAELTDIHSAATDQQYEKKTLSNYILNNKP 579

Query: 530 REISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEE 589
            + ++ L+ + +     +S  ++S TP+ F+ A+Q+ KNRE  R+ S  V++ DEEL+EE
Sbjct: 580 DDQANSLKRSKEQEKGTVSPVKRSPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEE 639

Query: 590 AINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPK 649
           AIN+  NLA+VE + +++     SEG K + +        ++P+W  RKNFK FVK  PK
Sbjct: 640 AINKFSNLAVVETNVDIVI----SEGKKNNESITD-----IDPKWKGRKNFKNFVKQLPK 690

Query: 650 SKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKY 684
            +       +N  +S FIRN+AFL+ R YVP++++
Sbjct: 691 YRMKTMPSGDNGVAS-FIRNSAFLLAREYVPMQEF 724

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  206 bits (524), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 201/720 (27%), Positives = 336/720 (46%), Gaps = 106/720 (14%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWV+RYQ +L+DGS+  ISCC++  +TY +GRSSKN L ++NDKSISRQ I+ +W     
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQW----- 55

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
            D     + + N GK+T + ++++  GET +  + + L    +++GTTPI +   W  + 
Sbjct: 56  -DRDKDCIMVKNLGKVTMVEERYLSDGETLSFQSKNDL--VTMKIGTTPIVVNLSWEVKR 112

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
            N          +L  YG       N    +++I +   +  +   + Y+++    +  S
Sbjct: 113 CNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINS 172

Query: 181 RFLME-LCNTLLPTSKTNLKFDEMWNDM------ISNPEYNV------------FDFDPN 221
           + L + L N ++ T     KFD  W  +      I N   NV            F  DP 
Sbjct: 173 KTLRDILTNNIIMTK----KFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPE 228

Query: 222 ILLSKFMRLNNIRVLTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLIL 281
               ++      + L  I   PR              F NI+ L  Y+++     E+L+L
Sbjct: 229 SYNCEYFE----KFLEEIGCIPR-------------KFLNINDLETYLETQFKGGEFLLL 271

Query: 282 TTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGK--FDQISEGMSTILK 339
           ++   +   ++   I   L S +D  L   ++   + +R+ +  K   + + + +     
Sbjct: 272 SSAKLENQSRLERFISIPLESFLDKLLFLDLDFGQSINRSKEESKNVIEPVLKEVGVEQT 331

Query: 340 TSRAP---EVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCG 396
           T   P    VE      KKR+LNR RV PLDSL+FFAGG+++           A +L   
Sbjct: 332 TEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTS---------IGASQLPLP 382

Query: 397 AESKTVISSPNIAEADEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTS-E 455
            E      + NI    +K    +++  K   +I  +   S  G ++ ++       +  +
Sbjct: 383 VE-----EANNITRKKDKEV--IKSQGKGEINIETEMDESGNGELLSTASEFKKPKSDVQ 435

Query: 456 DSLDKSLQ------SHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAEVTKNFRV 509
             L+K +Q        K+ +P L E   I  Q + SN     +   + + + ++ K    
Sbjct: 436 HKLEKRMQVAIDRSPEKIKKPKLEE--NISIQQLLSNKVKSTSDTSSVLIETQIAKE--- 490

Query: 510 NHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNR 569
           ++ + IE      + L++Y         E  + P  +L            V AIQ+ K R
Sbjct: 491 SNTKAIEYGKVRQKTLTDYKH----TSDERIERPSVDL------------VHAIQDIKER 534

Query: 570 EVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLR-KSFDSEGNKTSRTTEKWENS 628
           E  RVK++IVE+K+ EL+EEAIN+  +L +V+ +  L + KS D   NK + +    +N+
Sbjct: 535 ETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKDKSLDI--NKPANSN---QNN 589

Query: 629 LMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKYSKKD 688
           +   +W  +KNFK FVK+ PK K  +  G++    S FIRN+A LITRN+VP+K+YSK D
Sbjct: 590 M---DWSGKKNFKKFVKMVPKYKRSQGNGQHADSCSTFIRNSAMLITRNFVPMKQYSKLD 646

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  193 bits (490), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 197/731 (26%), Positives = 328/731 (44%), Gaps = 126/731 (17%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSK-NPLIIKNDKSISRQHITFKWEINN 59
           MW++RY    ED    ++SCCLQ  + YSIGRSSK N L+IKNDKSISRQHI+F+W    
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQW---- 56

Query: 60  SSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINE 119
              + H  + +VN GKLT +N  F+K  ET  I+ S   K T I++G+ P+ +   W + 
Sbjct: 57  ---VSHDYVDIVNDGKLTYINDAFLKPKETTRISIS-ASKETNIKVGSAPVIVNLVWEDV 112

Query: 120 VWNIPP--------HLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYAL 171
             ++ P         L       S +G++ E ++  +   +    +P        +L AL
Sbjct: 113 FIDMTPISDTGQSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWP-------HQLIAL 165

Query: 172 VSTIPMKKSRFLMELCNTLLPTSKTNLK-FDEMWNDMISNPEYNVFDFDPNILLSKFMRL 230
           +          L++L    L  S  N+  FDE+WN  + + +Y  +   PN  + +    
Sbjct: 166 IRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEY---PNFKVDR---- 218

Query: 231 NNIRVLTTIKSE------PRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTT 284
           N+ R  T I  +        + S +      L +F N +S  KY  + E     L+L + 
Sbjct: 219 NSFRDFTIIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSE 278

Query: 285 DKKENGKI--------LCTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMST 336
             + +  +        +C+  +   ++ +  +S +++      R L   ++  I++    
Sbjct: 279 RFQVSHPVYEILNKIDICSTGSFFKAVTENNVSTLVH------RELFLRRYTDITQ---- 328

Query: 337 ILKTSRAPE--VEASPVVSKKRKLNRRRVLPLDSLDFFAG-------------GLSTKTL 381
             K  R P+  VE + V  KKR+LNRR+V PL+ L+FFAG             GL+    
Sbjct: 329 --KEMRRPKEPVEDTAVPLKKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSDDGLAATKA 386

Query: 382 SENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ-NALKPTEDIGKKSGHSSPGA 440
            +   ++D    +    S +  ++ +      K +P L+ NAL      G +S H     
Sbjct: 387 VDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGDESSH----- 441

Query: 441 IIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTIS-SNSADYETAAVNSMD 499
             V  P+       +D L  +L+ + + +   P +      +I+ S     E  A    +
Sbjct: 442 --VVEPD--RTYEKDDCLPDNLEVNGMMKEPEPVIEKTRQSSINESLRTPKEPVAEMEDE 497

Query: 500 DAEVTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSI-KEKSGTPH- 557
             EV +     H +               SRE S  +     +P ++  + + +   P  
Sbjct: 498 LEEVDEVDEPTHLK--------------ASREASKIVGPESLAPSRDTEVLRPRPAKPRN 543

Query: 558 --AFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEG 615
             + VE IQ  K+ E +R++ T+  +   EL++EAI    N+AIVEP+ N++RK      
Sbjct: 544 SSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRK------ 597

Query: 616 NKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLIT 675
            K +  TE    S        R NFK F+KV PK++          + +D +RN A+LIT
Sbjct: 598 -KPAMVTESSIRS-------DRPNFKKFMKVWPKAR----------KGNDSLRNNAYLIT 639

Query: 676 RNYVPLKKYSK 686
           R+YVP+K Y++
Sbjct: 640 RDYVPMKAYNR 650

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  178 bits (452), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 203/389 (52%), Gaps = 56/389 (14%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RYQ  LEDG++  +SCCL+  +TY+IGRSSKN L IKNDKSISRQH++  W     
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
            D K   L L+N+GK+T++++K++K+GE+ +   S  + + ++ELGT P++++ +W++ +
Sbjct: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGESISFGKS--MGTVLVELGTKPLKMQLQWMDSI 112

Query: 121 WNIPPHLTQFRTMLSEYGI---STEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177
           W +P       + L E GI   S+E+S     ANL++ D    + N  R LY LV  IP+
Sbjct: 113 WMVPQGSRSDHSALEELGIEVLSSELSR----ANLIVID---EQQNYSRWLYGLVKRIPL 165

Query: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNP--EYNVFDFDPNILLSKFMRLNNIRV 235
               FL  +   +   S    +FD +W  ++++    Y  ++    +       L N+  
Sbjct: 166 MNLEFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQV-------LQNLEF 215

Query: 236 LTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTT--TDKKENGKIL 293
           LT  K E   S  +        A  +++ L + V      +  +IL +  T  +E   + 
Sbjct: 216 LTVGKDE-DTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLG 274

Query: 294 CTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPV-- 351
            T    +  +++  L   +N       +L NG           I + ++ PE E  P+  
Sbjct: 275 KTF--TVQDVVEAILKDEVN-------SLKNG----------VIGEVAKRPEAEV-PMEK 314

Query: 352 -VSKKRKLNRRRVLPLDSLDFFAGGLSTK 379
            V+KKR+LNR RV PLD L FFAGG S K
Sbjct: 315 PVTKKRRLNRPRVKPLDILSFFAGGDSMK 343

 Score =  107 bits (268), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 64/157 (40%), Positives = 93/157 (59%), Gaps = 17/157 (10%)

Query: 550 KEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRK 609
           K +S + +  ++ IQ+TKN EVKR+ STI+++ DEEL+E+AINQL NL +V+ ++NL+R+
Sbjct: 451 KGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVDRNDNLMRR 510

Query: 610 SFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRN 669
                    S T +        P W+ RKNFK FVKV PK        +    SSD IRN
Sbjct: 511 ------RDRSPTVDS-----HNPNWNNRKNFKNFVKVWPKYGGQDSTSREG--SSDTIRN 557

Query: 670 AAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTE 706
            AFL+TR YVP + Y+  D++     +  ED++   E
Sbjct: 558 RAFLLTRQYVPTRTYTSGDSS----KQAQEDLYDFPE 590

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  179 bits (453), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 200/711 (28%), Positives = 315/711 (44%), Gaps = 97/711 (13%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RYQ   E GS   +SCCL+    Y +GRS K+PL IK DKSISR+H+  +   N  
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQN-- 58

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
                S L ++N GKLT +    +K+ +     A    +S  +E+G  P++    +   +
Sbjct: 59  -----SKLEVLNAGKLTKIGGDNVKMDQMLEFGAD---QSVALEMGAGPVKGTVTYEPAI 110

Query: 121 WNIPPHLT---QFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177
           W IP  L      +  LS Y I    S+    +  +I ++ KS  N    L+ALV  IP+
Sbjct: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167

Query: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDM-ISNPEYNVFDFDPNILLSKFMRLNNIRVL 236
               F+ +  +     + T + FD  W  + + N  +     +     + F  LN   V+
Sbjct: 168 MCEGFIGDFVSQF---ADTQIDFDAKWEQITLKNAPF----LELQTKDAAFKGLN--FVV 218

Query: 237 TTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILT-------TTDKKEN 289
           T  K+     S++   + NL+   ++ +L  +++    S   +IL            ++N
Sbjct: 219 TNQKTFAIYKSIIDAGSGNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQN 278

Query: 290 GKILCTIKTML----------TSIIDGTLSAVI--NMKGASSRTLDNGKFDQISEGMSTI 337
             +      +L          T  ++  + AV+  ++     R       ++ S G S  
Sbjct: 279 NSMHIQEAKLLKNKARSLGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIA 338

Query: 338 LKTSRAPEVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCG- 396
                A  V  +P +  KRK   R++ PL+SL FF GG S     E  S T AK  N   
Sbjct: 339 GSQVLADIVADAPNLRNKRKRANRQIQPLNSLAFFGGGSSLSQKLEQVS-TPAKEQNLEL 397

Query: 397 AESKTVISSPNIAEADEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSED 456
            E   V ++P +        P    + KP E+  K + H        S+ N  T   SE 
Sbjct: 398 QEGLGVHTNPEV-------HPL---SKKPREE--KNTLH--------SAGNNSTTTFSET 437

Query: 457 SL---DKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAEVTKNFRVNHHQ 513
            +   D  + S  L   +   V  I  +  S+++ +     VNS  DA  T  F   H  
Sbjct: 438 PIHQEDVQIGSEPLNHSAAHSV--ISKEDESTHTDERNKTLVNSAKDAR-TVTFPSIHKN 494

Query: 514 NIEQPSKNIRKLSNYSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKR 573
            +    K+ R LSN ++     ++ N      E+   ++   P + ++A QE K  EV R
Sbjct: 495 EL----KSSRTLSNEAK-----VEGNISHADTEVQAIKR---PRSLIQAFQEAKQHEVHR 542

Query: 574 VKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPE 633
           +K  + ++  EEL+EEAIN+L NLA VE   +L+R+  +   N   R        L  P+
Sbjct: 543 LKKNMADVGSEELTEEAINKLDNLASVEKV-DLMRRPSEVPENSNQRI-------LTNPQ 594

Query: 634 WHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRNAAFLITRNYVPLKKY 684
           W +RKNFK FVK+ P S + +    N T   D +RN A+LITR+YV L  Y
Sbjct: 595 WARRKNFKKFVKLWP-SHSSRSSPDNIT---DAVRNKAYLITRDYVSLCPY 641

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 117/201 (58%), Gaps = 13/201 (6%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RYQ  LEDG I  +S CL+    YSIGRSSKNPL IKNDKSISRQHIT KWE    
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWE---- 56

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
                  L LVN+GKLTS+ ++++ + E+   N  D  K   + LGT P+ ++  W    
Sbjct: 57  ---PSGQLHLVNQGKLTSVKERYLAIDESLIFNVVDT-KELDVHLGTNPVIVQIRWQPMN 112

Query: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180
             IP    QFR +L++YGI  E++ + +  +  I+    + ++    L AL   IP+ KS
Sbjct: 113 LYIPNMYEQFRGLLTKYGI--EVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKS 170

Query: 181 RFLMELCNTLLPTSKTNLKFD 201
           ++L E+ N L P    N+ FD
Sbjct: 171 QYLTEVSNMLRP---DNITFD 188

 Score =  131 bits (329), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 185/347 (53%), Gaps = 50/347 (14%)

Query: 352 VSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEA 411
           + KKR+L R+RV PL+SLDFF GG +T T  E  S T  + +    E K    +P + E 
Sbjct: 369 IVKKRRLARKRVKPLESLDFFVGGSTTGTPFETSSTTLQQEI---IEPKVPDVAPILNEQ 425

Query: 412 DEKHAPFLQNALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPS 471
            ++ +   ++  +P +DI    G          S    T   +  ++DK +Q     +P+
Sbjct: 426 IQQ-SQVNKSINEPAKDIYSIGG----------SDRKETAALTYATIDKHMQ-----EPT 469

Query: 472 LPEVAGIGSQTIS----SNSADYETAAVNSMDDAEVTKNFRVNHHQNIEQPSKNIRKLSN 527
             ++  I SQ I      NS + E  + +S     +T+  +VN  ++         K+SN
Sbjct: 470 Q-QIDDIPSQHIDISPHGNSNEQEKRSNSSEKSPMITQ--QVNDEKD--------EKISN 518

Query: 528 YSREISSPLQENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELS 587
                     +  K   +E S +    TP + VE IQ+ KNREV R++S+I  +  EEL+
Sbjct: 519 ---------AKALKIGKREDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELT 569

Query: 588 EEAINQLKNLAIVEPSNNLLRKSFDSEG-NKTSRTTEKWE--NSLMEPEWHKRKNFKTFV 644
           E+AIN+  NLAIVE + +L+R++ +++  NK++ +  + +  +++M      R+NFK FV
Sbjct: 570 EDAINEFSNLAIVESNASLIRRTENNDNTNKSTNSVVRHDSPDNIMNV-LEGRRNFKRFV 628

Query: 645 KVRPKSKAHKEEGKN---NTQSSDFIRNAAFLITRNYVPLKKYSKKD 688
           KV PK   +K +  N   +  +SDFIRN AFLITRNYVPLK+YSK D
Sbjct: 629 KVYPKYIQNKNDSNNERGDNGASDFIRNNAFLITRNYVPLKQYSKYD 675

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 123/392 (31%), Positives = 194/392 (49%), Gaps = 39/392 (9%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MWV+RY    E G +  +SCC++    Y+IGRSSKN L+IKNDKSISRQH++ KW  +  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSK- 59

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIE--LGTTPIRIEFEWIN 118
                + + L N GKLT  ++K++   E  T +A +    T IE  LG  P++I    I+
Sbjct: 60  -----NCIELTNTGKLTKSSEKYLGSNELITYSADE----TQIEMLLGVAPVKIILSRID 110

Query: 119 EVWNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178
           E+++IP  L+QFR  L   GI  +IS+++  AN+  +      D   REL+A  + I + 
Sbjct: 111 ELFDIPNSLSQFRETLETLGI--QISVDN--ANVNSTSLITVGDFGYRELFAACNDINIY 166

Query: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTT 238
            S  L E+CN L+        FD  W  M S+   N+   D   LLS+F  +        
Sbjct: 167 SSGLLTEICNKLVNDHDN---FDAEWRSMQSSYHRNL---DLEGLLSQFGGIRGKFFFLL 220

Query: 239 IKSEPRLSSLLRTFNINLFA--FDNI---DSLYKYVDSLEASTEYLILTTTDKKENGKIL 293
            K +  + S L+ F + L     D+I   D L + + S +A    ++++     E  K L
Sbjct: 221 YKIDWFIISYLKPFLLKLSVEIHDSIHKNDDLLRLISSKQADEIPIVISN----EKIKYL 276

Query: 294 C--TIKTMLTSIIDGTLSAVINMKGASSRTLDNGK-FDQISEGMSTILKTSRAPEVEASP 350
              T++     I     S  +       ++++    +D   E  + I+   R+    + P
Sbjct: 277 PEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERKPIYDLEDETTNAIIPQKRSLANTSQP 336

Query: 351 V-----VSKKRKLNRRRVLPLDSLDFFAGGLS 377
                  +KK+++ R +V PL+SL FFAGG+S
Sbjct: 337 TDTSLESTKKKRVRRHKVEPLNSLSFFAGGIS 368

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 76/129 (58%), Gaps = 15/129 (11%)

Query: 559 FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNKT 618
            V+ +Q TK  EVKR+ STIV+++D EL+EEAIN+L +L +VEP  +L+R   D   N T
Sbjct: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANNT 612

Query: 619 SRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHK---EEGKNNTQSSDFIRNAAFLIT 675
             T ++W+N         RKNFK FVK+ PK K+ +   E    + + S  I    FL T
Sbjct: 613 --TQQQWKN---------RKNFKKFVKICPKYKSEQSSIESMSRHIRGSGEILTREFLQT 661

Query: 676 RNYVPLKKY 684
           +N VP+  Y
Sbjct: 662 KN-VPVDYY 669

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  127 bits (320), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 197/429 (45%), Gaps = 76/429 (17%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RY+   EDG+   ISCCL+    Y IGRS+K+PL IKNDKSISR+HI  K  +N  
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLK--VN-- 56

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
              K + L L+N GKLT+LN + + V ++   +    L+   +ELG  PI    EW ++V
Sbjct: 57  ---KENELNLLNTGKLTTLNAEVLMVDQSLNFHPKGQLR---LELGIKPIIATIEWQDQV 110

Query: 121 WNIPPHL---TQF-RTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIP 176
           W +   L   + F R   + YGIS   +++    NL I    +++D     L++LV  I 
Sbjct: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMS-TRTNLQI--IKQNQDTYSNCLFSLVKGID 167

Query: 177 MKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVL 236
           + +  FL +  + L  T      +D +W +++   ++ VF   PN      +   NI ++
Sbjct: 168 IVRESFLSDFQSHLYMTP---TDYDGIWKNLLQ--KHMVF---PNFTTCVSI-FQNISII 218

Query: 237 TTIKSEPRL-SSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLIL-------------T 282
              KS   L    +      L   +N++   +++     S + +IL             +
Sbjct: 219 VASKSIYNLFKYTIEVAGGELLYCENMEKFEQFIQEAAHSKDVIILKHITEANLTNDKNS 278

Query: 283 TTDKKENGKILCTIKTMLTSI------IDGTLSAVI-------------NMKGASSRTLD 323
             D  E+ + L  +K    S+      ++  + AV+              +   S + L+
Sbjct: 279 NIDMSEDARKLEELKAAAESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLE 338

Query: 324 NGKF------------DQISEG--MSTILKTSRAP---EVEASPVVSKKRKLNRRRVLPL 366
             K             D++SE       L+ S A    E+    +  K+++ NR +V PL
Sbjct: 339 EPKLPLKIDEFITPVPDKVSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPL 398

Query: 367 DSLDFFAGG 375
           DSLDFFAGG
Sbjct: 399 DSLDFFAGG 407

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 61/131 (46%), Positives = 85/131 (64%), Gaps = 22/131 (16%)

Query: 558 AFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNK 617
           A VEAIQ+TK+REV R+K+T++++   EL+E AIN L NLAIVE   +L+RK+    G+ 
Sbjct: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVE-KKDLIRKN-SERGHC 631

Query: 618 TSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKE----EGKNNTQSSDFIRNAAFL 673
            S  T  WE          RKNFK F+KV+P+ ++ +E    +GKN       ++N+AFL
Sbjct: 632 ISSDTCLWEG---------RKNFKKFIKVQPR-RSQRETFDSDGKN------IVKNSAFL 675

Query: 674 ITRNYVPLKKY 684
           ITR YVPLKK+
Sbjct: 676 ITREYVPLKKF 686

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  116 bits (290), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 104/412 (25%), Positives = 185/412 (44%), Gaps = 61/412 (14%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW++RYQ    +G    +SCCL+    YSIGRS+KNPL IK+DKSISR H+    E++ S
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVEL--EVDQS 58

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
            +     + L   GKLT ++ K +K G+     A +     + E+G +PI+         
Sbjct: 59  CN-----VVLRVVGKLTKVSGKSVKAGQHLQFTADE---EVLFEMGASPIKATVVKQQSF 110

Query: 121 WNIPPHLTQFRTM---LSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177
           W IP  L+  +++   L+++ I    S++   +  +I D  KS  N    L++L+  IP+
Sbjct: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167

Query: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDM-ISNPEYNVFDFDPNILLSKFMRLNNIRVL 236
            +  F+ +    +   +  +  FD  W+ M + N ++  +  +     +    + N R  
Sbjct: 168 LREHFIGDFVTQI---NDVHADFDSRWDRMVVENAQFPNYKCECRPFTTIHFLVTNRRAF 224

Query: 237 TTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTI 296
              K       ++   +  L+  D+I +L  ++     S   ++L   +   NGK   + 
Sbjct: 225 AIFK------HIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILLVHLN---NGKSSISS 275

Query: 297 KTMLTSI--------------IDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSR 342
               + +              +   +  V ++ GA    LD+  F+++ E +      S+
Sbjct: 276 TEQSSDLDVQEAKLLKNKAQNLGFRIHDVNDIVGA---VLDHN-FEKLLERVPVRNLPSK 331

Query: 343 AP--------------EVEASPVVSKKRKLNRRRVLPLDSLDFFAGGLSTKT 380
           AP              +   +P  S KRK   R+V+PLDSL FF GG + ++
Sbjct: 332 APTGFPLEEATNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGGGSAAES 383

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 77/130 (59%), Gaps = 16/130 (12%)

Query: 556 PHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEG 615
           P +F +A++ETK+ EV R++  IV +  EEL+EEAIN+L  LA+VE + +L+R   +   
Sbjct: 520 PVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVE-TKDLMRADREYAV 578

Query: 616 NKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSS-DFIRNAAFLI 674
              S  +E+W           RKNFK FVK+ P   +     +N+  S+ + +RN A LI
Sbjct: 579 CGQSGGSEQWAG---------RKNFKKFVKLWPSRSS-----RNSPDSATNALRNRAHLI 624

Query: 675 TRNYVPLKKY 684
           TR YVPL+ Y
Sbjct: 625 TREYVPLRPY 634

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  115 bits (289), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 189/795 (23%), Positives = 320/795 (40%), Gaps = 203/795 (25%)

Query: 1   MWVVR--YQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEIN 58
           MWV +  YQ + + G++  ISC L   + + +GR+SK+ L+I+ +K +SR H+  + E+ 
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHL--RLEVI 57

Query: 59  NSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWIN 118
           +     H ++ L+  G    +  +    G       S      I+E+G+  ++   EW  
Sbjct: 58  DD----HVNILLL--GSQLKVGGEDASKGSVLPFGPSQ--SPVILEVGSHSVQCILEWAQ 109

Query: 119 EVWNIPPHLTQFRTMLSEY----GISTEISINDIPANLMISDYPKSEDNSIRELYALVST 174
             + +P  L Q    L E     GI    S +    + +I  +   +D   + L+ALV  
Sbjct: 110 WEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPHEDDQDYE-KYLFALVKG 168

Query: 175 IPMKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNI------------ 222
           IP+                   +L+F + +  ++  P   V DFDP +            
Sbjct: 169 IPI------------------LHLEFLKQFTALLRQP---VTDFDPQLRSIQEQHYAFRG 207

Query: 223 LLSKFMRLNNIRVLTTIKSEPR---------------------LSSLLRTFNIN---LFA 258
              K   LN +  +   K +                       LS+ L+T  IN      
Sbjct: 208 FTKKAADLNGLHFIVNRKHDFEMLKYTLEIGGGTVHFCHDINDLSACLKTIPINGALALK 267

Query: 259 FDN-IDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTMLTSIIDGTLSAVINMKGA 317
           +D+ I +  K VD     T Y  +  +    +G  L T+  +  +I+   L+ +++ +  
Sbjct: 268 YDHGISAEVKKVDD----TRYCEVLHS----HGIQLFTVHELTKAILYDKLAQLLSKRPP 319

Query: 318 SSRTLDNGKFDQISEGMSTILKTSRAPEVEASPV---------VSKKRKLNRR--RVLPL 366
           +   L       +    STI +T    +   SP+         + +K K  +R  +  PL
Sbjct: 320 TMMKL-------VEPVPSTISQTQEMKQESLSPISLGNTTIKDLPRKDKTRKRLKKPQPL 372

Query: 367 DSLDFFAGGLSTK--TLSENRSLTDAKRLNCGAESK------------------------ 400
           DSL FFAGGLS +  ++     L   + ++ GA++                         
Sbjct: 373 DSLSFFAGGLSRQNSSIGGTADLVKQESMSLGADTHYGSPNDVQSLPATQSPKKRRRPKV 432

Query: 401 -----------------TVISSPNIAEADEKHAPFLQNALKPTED-IGKKSGHSSPGAII 442
                              ISS  ++  +++  P  ++  K T D IG  +G S  G+I 
Sbjct: 433 EPLGNLMTSQLQKAFDDPTISSAKVSPTEQEIIPVRESQAKKTPDPIGAFNGTSQKGSI- 491

Query: 443 VSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGSQTISSNSADYETAAVNSMDDAE 502
                       E +  K   S   P   LP  AG+G+        D       S+D+  
Sbjct: 492 ------------ESNSRKRQPSPGYPYEPLP--AGVGN-------GDILNKQWKSLDEQP 530

Query: 503 VTKNFRVN----HHQNIEQPSKNIR------KLSNYSRE-ISSPLQENCKSPVKELSIKE 551
            +K  R+     + + +   S+  R      KL++   E I S  + + + PV     ++
Sbjct: 531 PSKKPRMQETDLYSEVMSGSSEEYREELTRSKLNSLDEESIKSRKRTSSEKPVNSCKRRQ 590

Query: 552 KSGTPHA-FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRK- 609
               P    V+AI++ K REV R+++TIVEL  EEL+E+AI QLK+LAIV+P + L ++ 
Sbjct: 591 APAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAIVQPVDMLRQQH 650

Query: 610 SFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQSSDFIRN 669
           + D+ G+               P    RKN+K F KV PK          N ++S   RN
Sbjct: 651 TVDTVGS--------------SPLTFARKNYKNFKKVWPKYM--------NRKNSPETRN 688

Query: 670 AAFLITRNYVPLKKY 684
           A  +  R Y+PL+ Y
Sbjct: 689 ATAISNRKYLPLELY 703

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/114 (42%), Positives = 70/114 (61%), Gaps = 4/114 (3%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           M ++RY+N L DG ++ +SCCL     Y+IGRSSKN   IKNDKSISRQH++  W+   S
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKY--S 58

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEF 114
           SD K+  + + N GK+T +  K++   ET      D  K   + +GT+PI +E 
Sbjct: 59  SDDKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLID--KKLEVNIGTSPITLEI 110

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 25/35 (71%)

Query: 350 PVVSKKRKLNRRRVLPLDSLDFFAGGLSTKTLSEN 384
           P   K+R++NR +V PLD+L FFAGG+S  T S N
Sbjct: 331 PPAPKRRRMNRSKVKPLDTLSFFAGGMSHDTHSIN 365

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 107/226 (47%), Gaps = 21/226 (9%)

Query: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60
           MW+V +    E      +   LQ    YSIGRS+K    I+ DKSISR H+  K++    
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD---- 56

Query: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120
                S L + NKGKLT  N++ + + ET  ++     ++T+I +G  PI +   +  E 
Sbjct: 57  ----GSDLIITNKGKLTKFNEEIIPLDETIVVHN----QNTVINIGGMPIDVNVRYFYEE 108

Query: 121 WNIPP--HLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMK 178
           W IP    L + ++++S++G+    S +      + SD           L+AL+  +P+ 
Sbjct: 109 WKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGC----LFALLKGVPVV 164

Query: 179 KSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPE-YNVFDFDPNIL 223
              FL ++   L       L F  M+  +++  + +  + + PN+L
Sbjct: 165 SIEFLNQMGKLL--QQGNYLDFQSMYQGLLNRHKLFPSYRYVPNVL 208

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%)

Query: 559 FVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA 598
            + AI ETK +EVKR++  I+E+   EL+E A+   K+ A
Sbjct: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAA 633

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/182 (35%), Positives = 93/182 (51%), Gaps = 32/182 (17%)

Query: 558 AFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRKSFDSEGNK 617
           + V AI+E K REV R+K+TIVE+  +EL+EEAI +L  LA+VE S ++LRK+       
Sbjct: 525 SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVE-SVDMLRKT------- 576

Query: 618 TSRTTEKWENSLMEPEWHKRKNFKTFVKVRPK--SKAHKEEGKNNTQSSDFIRNAAFLIT 675
            SR  +   N       H R+NFK FVKV P   +KA  ++     + S+          
Sbjct: 577 QSRHMKTETNK----RHHVRRNFKRFVKVWPAYLNKAICQDPMGAQRYSN---------- 622

Query: 676 RNYVPLKKY---SKKDTTTKWGTEENEDMFALTEMERFGSNTFMSDNINSNTIQKRSQAL 732
           R  VPLK Y   +K + T     +EN       E     + TF SD ++ N IQ  S+++
Sbjct: 623 RQCVPLKVYEPMNKNELTDDQLVDENSS----EEKNDIMNETFTSDPLDHN-IQMASKSI 677

Query: 733 NR 734
            R
Sbjct: 678 PR 679

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 103/227 (45%), Gaps = 24/227 (10%)

Query: 1   MWVVR--YQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEIN 58
           MW+ +  YQN  +  +++ IS  ++  K Y +GR+SK+ L+I +++ +SR H+  K   N
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  NSSDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWIN 118
                    + +   G    +  K ++ G +   +         +E+G+  I  +  W  
Sbjct: 60  --------IIEITLLGAQLKIGHKTIEKGISCEFHPKQ--SPLRLEVGSHSIECKLLWTQ 109

Query: 119 EVWNIPPHL----TQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVST 174
             + +P  L         M  + GI    S++   ++ ++      +D   + L+ALV  
Sbjct: 110 WEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-KYLFALVKG 168

Query: 175 IPMKKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVF-DFDP 220
           +P+ +  FL  + + L   +   LKF+    ++    E+++F +F+P
Sbjct: 169 LPLVEVGFLKGISSLL---NSDTLKFESKVKEL--EREFSIFPEFNP 210

>TDEL0B01600 Chr2 complement(283799..284428) [630 bp, 209 aa] {ON}
           Anc_8.476 YDR246W
          Length = 209

 Score = 34.3 bits (77), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 16/88 (18%)

Query: 127 LTQFRTMLSEYGISTEISINDIPANLMISDYP----KSEDNSIRELYALVSTIPMKKSRF 182
           + Q  T L    IST+I     PAN+  SDYP    +  DN +R++Y + S   MK   +
Sbjct: 132 IYQTMTGLKFIAISTQI-----PANVNNSDYPIISIQVADNLLRKIYCVYSDYVMKDPFY 186

Query: 183 LMELCNTLLPTSKTNLKFDEMWNDMISN 210
            ME     +P  K+ L FD+    M+SN
Sbjct: 187 SME-----MPI-KSEL-FDQRVRQMVSN 207

>TBLA0A10590 Chr1 complement(2620380..2622191) [1812 bp, 603 aa]
           {ON} Anc_4.362 YHR196W
          Length = 603

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 68  LCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWIN 118
           + L N G L S+N +  +  E +TI ++++ K+ IIE    P  I + W+N
Sbjct: 291 IGLTNDGNLVSINIEQSENNEDYTIISNNISKNNIIEFAQIPDGIIYSWLN 341

>TDEL0A00570 Chr1 (96698..99046) [2349 bp, 782 aa] {ON} Anc_3.38
           YOL130W
          Length = 782

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 3/63 (4%)

Query: 600 VEPSNNLLRKSFDSEGNKTSRTTEKWENSL---MEPEWHKRKNFKTFVKVRPKSKAHKEE 656
           V P     R SFDS+ +K SR +++ E  +   M+P+ H R N   F ++   ++   EE
Sbjct: 153 VPPKQQQRRASFDSDDSKASRESQETEEDVCFPMQPQLHTRVNGIDFDELEEFAQQSTEE 212

Query: 657 GKN 659
            +N
Sbjct: 213 NQN 215

>Ecym_7476 Chr7 (970588..971316) [729 bp, 242 aa] {ON} similar to
           Ashbya gossypii ADL386W
          Length = 242

 Score = 32.3 bits (72), Expect = 3.8,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 6/85 (7%)

Query: 235 VLTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILC 294
           +L T+ S+    ++  TF+ N    DN+D  YK+      + +++I+ TT+ +++GK + 
Sbjct: 162 ILATLLSDIMKEAVKFTFSSNAQMMDNLDVAYKFP---TFANQFVIVRTTEIEQHGKTVK 218

Query: 295 TIKTMLTSIIDGTLSAVINMKGASS 319
              T+L    + TL   +N KGA S
Sbjct: 219 LKSTILDQSGERTL---VNGKGAFS 240

>SAKL0D08800g Chr4 complement(732221..733960) [1740 bp, 579 aa] {ON}
           conserved hypothetical protein
          Length = 579

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 82/196 (41%), Gaps = 33/196 (16%)

Query: 434 GHSSPG-AIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGI----GSQTISSNSA 488
           G + PG  I V S    +V    DS+  +L  + +P+P LP+V        +Q    +  
Sbjct: 395 GITFPGECIYVPSGWWHSVINLTDSV--ALTENFVPEPVLPKVLNFFKNKKNQISGFHLK 452

Query: 489 DYETAAVNSMDDAE-----------VTKNFRVNHHQNIEQPSKNIRKLSNYSREISSPLQ 537
           D+  A+V    +A+           + KNF V   ++ + P  N         E  +P+ 
Sbjct: 453 DF-VASVRCFLEAKNSETSDPNRYTILKNFLV---KSTDYPFDNEDCGLGDRAEFETPMY 508

Query: 538 ENCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNL 597
           E     + +   K K   P    EAIQE K  EV+ +K  ++EL+D     E  N+L   
Sbjct: 509 EFFVELIAQ--SKYKGCLP----EAIQEMKTMEVEVLKKKMLELRDNVRESEIWNKL--- 559

Query: 598 AIVEPSNNLLRKSFDS 613
              E S N+    FDS
Sbjct: 560 --TEDSKNIFSFGFDS 573

>NDAI0E03840 Chr5 (841914..846083) [4170 bp, 1389 aa] {ON} Anc_7.57
           YOR336W
          Length = 1389

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 14/97 (14%)

Query: 520 KNIRKLSNYSREISSPLQENCKSPVKELS--IKEKSG-------TPHAFVEAIQETKNRE 570
           K++  L N  R+I++ +Q N  +PVK++   +  KSG       TP  F +A+  T N  
Sbjct: 625 KDVSYLKNELRQIANKIQNNAANPVKDVRSLLHMKSGNARHSKYTPDYFSDAVYTTMNNT 684

Query: 571 VK-RVKSTIVELKDEELSEEAINQLKNLAIVEPSNNL 606
           V   ++  IVE     ++ E  N L  + + +  N L
Sbjct: 685 VLFEIQERIVEY----VASEEYNLLHTITLFDDFNTL 717

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score = 32.7 bits (73), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 15/137 (10%)

Query: 158 PKSEDNSIRELYALV-STIPMKKSRFLMELCNTLL--PTSKTNLKFDEMWNDMISNPEYN 214
           P S+  S   LY+   +  P +KS       N++L  P+S++N   D   N   +NP+  
Sbjct: 115 PSSQQQSQMFLYSQSPAGTPNRKS---FSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTR 171

Query: 215 VFDFDPNILLSKFMRLNNIRVLTTIKSEPRLSSLLRT---FNINLFAFDNIDSLYKYVDS 271
           + + DPN L  K   + + ++L T     R  SLL +    +I+L +F     +Y +V  
Sbjct: 172 IPEVDPNELFQKPFVI-SYKLLPTGDDAYRTRSLLFSNVASSIDLHSF-----IYDFVQY 225

Query: 272 LEASTEYLILTTTDKKE 288
               + YLI  T D+K+
Sbjct: 226 SSIESIYLISNTDDEKD 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,377,036
Number of extensions: 3951459
Number of successful extensions: 13509
Number of sequences better than 10.0: 315
Number of HSP's gapped: 14244
Number of HSP's successfully gapped: 336
Length of query: 854
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 736
Effective length of database: 39,950,811
Effective search space: 29403796896
Effective search space used: 29403796896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)