Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR368W (YPR1)5.434ON31231216550.0
Suva_2.5405.434ON31231215740.0
Skud_4.6375.434ON31231215650.0
Smik_4.6345.434ON31231215570.0
SAKL0G02530g5.434ON31231211571e-160
TBLA0A02825singletonON31131211441e-158
CAGL0I01100g5.434ON31030911361e-157
NDAI0C016005.434ON31331211331e-156
CAGL0A02816g5.434ON31030911311e-156
Skud_15.2835.434ON31231211211e-154
Suva_8.1735.434ON31231211191e-154
YOR120W (GCY1)5.434ON31231211151e-153
Smik_15.2985.434ON31231211151e-153
KNAG0C049105.434ON31331210901e-150
KAFR0E03850singletonON31131310881e-149
NCAS0H020605.434ON32230610721e-147
TDEL0E019105.434ON31131210591e-145
TBLA0A065105.434ON31231210391e-142
Kwal_47.18084na 1ON30930910371e-142
KLTH0E15532gsingletonON30930210341e-141
NCAS0F033805.434ON31331310321e-141
ZYRO0F10032g5.434ON31030910291e-140
KLTH0E00220gsingletonON30630110261e-140
KLTH0A00528gsingletonON30630110261e-140
KLLA0B14707gsingletonON31030610251e-140
Kpol_1062.295.434ON31130910231e-139
TPHA0G00210singletonON31131210191e-139
NDAI0B056705.434ON31831210081e-137
KLTH0F16060g5.434ON30930810021e-136
TBLA0A02835singletonON3113129771e-132
TPHA0E017605.434ON3103099671e-131
KLTH0A03476gna 1ON3083039601e-130
TDEL0D00230singletonON3123059571e-129
KAFR0E038405.434ON3103129261e-125
Kwal_55.214265.434ON3083089221e-124
KLLA0D10109gsingletonON3093029071e-122
AER401W5.434ON3133108711e-116
NDAI0A070003.108ON3203005653e-70
NCAS0I024203.108ON3202965359e-66
Kwal_56.226113.108ON3213185168e-63
KLTH0C10010g3.108ON3213125151e-62
KAFR0G013503.108ON3243135002e-60
ZYRO0B06138g3.108ON3283144891e-58
SAKL0C10626gsingletonON3223114872e-58
KNAG0K020703.108ON3233154829e-58
YBR149W (ARA1)3.108ON3443124778e-57
Smik_2.2883.108ON3443004691e-55
Smik_2.289singletonON3443164664e-55
KLLA0F02728g3.108ON3302934646e-55
Suva_4.3983.108ON3443174631e-54
TDEL0D051603.108ON3253144602e-54
SAKL0C09922g3.108ON3223174602e-54
Skud_2.2763.108ON3442984603e-54
ACL107C5.409ON3543074535e-53
Ecym_55085.409ON3263304481e-52
TPHA0E018605.409ON3263294341e-50
KLTH0F16610g5.409ON3293314315e-50
NCAS0A066605.409ON3263274244e-49
KLLA0E21627g5.409ON3293114245e-49
KNAG0B03780singletonON3263314235e-49
CAGL0I01122g5.409ON3263294184e-48
ZYRO0A06336g5.409ON3273334167e-48
KLTH0F01892gna 2ON3022914131e-47
NDAI0D016005.409ON3273314141e-47
KLLA0F03256g7.468ON2852794075e-47
TDEL0E021505.409ON3293134106e-47
Kwal_47.18893na 3ON2892954041e-46
Ecym_7160na 4ON2712794022e-46
Kwal_55.215365.409ON3293114053e-46
SAKL0G01914g5.409ON3293104044e-46
TBLA0A00630singletonON3283284036e-46
KAFR0C05320singletonON3273104028e-46
KLTH0G02420gna 3ON2892963981e-45
Skud_8.1655.409ON3273113974e-45
YHR104W (GRE3)5.409ON3273113958e-45
Kwal_33.13276na 2ON3022903921e-44
SAKL0F14278g7.468ON2862773902e-44
Smik_8.1825.409ON3273103904e-44
KNAG0D013707.468ON2822763866e-44
TBLA0F01720singletonON3263333888e-44
CAGL0C04543g7.468ON2872753859e-44
Suva_15.3005.409ON3273323881e-43
Kpol_1013.827.468ON2852753841e-43
ZYRO0G17600g7.468ON2832823796e-43
SAKL0F02574gna 3ON2892933744e-42
YJR096W7.468ON2822813718e-42
KAFR0G009207.468ON2862943701e-41
Kwal_47.182197.468ON2932923702e-41
KLLA0F05775g7.285ON3092713678e-41
KLTH0G05786g7.468ON2862753641e-40
Smik_10.3847.468ON2822893632e-40
Kwal_47.19278na 5ON3143123652e-40
CAGL0J09394g7.285ON3113173642e-40
NCAS0H005607.468ON2842763596e-40
Skud_10.3187.468ON2822903587e-40
TDEL0C033207.468ON2832883561e-39
ZYRO0E09614gna 5ON3083103563e-39
Suva_12.1847.468ON2822893543e-39
ABL209Cna 4ON3102893563e-39
KLTH0G00638gna 5ON3133073512e-38
NCAS0A137407.285ON3093113468e-38
Skud_4.1317.285ON3123163424e-37
Kpol_1020.137.285ON3133263408e-37
Smik_4.1137.285ON3123143381e-36
NDAI0A023007.285ON3133263362e-36
SAKL0F00704gna 5ON3153113302e-35
YDL124W7.285ON3123153242e-34
KNAG0C041107.285ON3113153214e-34
ZYRO0C09196g7.285ON3123113162e-33
KAFR0B012007.285ON3152743111e-32
TBLA0F019807.285ON3023123101e-32
TDEL0D02790singletonON3293133121e-32
SAKL0F09746g7.285ON3123143083e-32
Kpol_381.8singletonON3092773022e-31
Ecym_32647.285ON3113112577e-25
Kwal_33.13274singletonON108841737e-15
Suva_12.272singletonON2652091201e-06
Suva_4.1227.285ON2061921119e-06
TDEL0A08000singletonON319216970.001
Ecym_22962.604ON340253960.001
Kwal_33.13275singletonOFF6734830.006
Suva_9.17singletonON308207890.012
Kpol_400.9singletonON341306880.017
KLTH0E01474gsingletonON313182850.035
NDAI0C01480singletonON343290830.062
NCAS0C02450singletonON343268800.14
NCAS0C019908.565ON343289800.15
NCAS0A129502.604ON32381770.35
TBLA0G01120singletonON343140770.39
KNAG0M023402.604ON309207750.53
Suva_5.2077.378ON767194760.64
NDAI0J00730singletonON343289740.84
KLTH0E16852gsingletonON37593731.1
YNL331C (AAD14)na 6ON37693731.2
Smik_14.1na 6ON37693721.3
Kpol_449.4singletonON341219721.4
YDL243C (AAD4)singletonON32993721.4
Kpol_1050.555.105ON452160712.1
NDAI0B009305.76ON94084712.1
Suva_14.10na 6ON37693712.2
KLLA0E24421gna 7ON36848702.4
YFL056C (AAD6)singletonON21293683.0
YCR107W (AAD3)singletonON363101693.3
Ecym_20263.25ON45199693.6
KAFR0C029908.143ON20674674.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR368W
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   642   0.0  
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   610   0.0  
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   607   0.0  
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   604   0.0  
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   450   e-160
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     445   e-158
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   442   e-157
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   441   e-156
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   440   e-156
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   436   e-154
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   435   e-154
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   434   e-153
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   434   e-153
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   424   e-150
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     423   e-149
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     417   e-147
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   412   e-145
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   404   e-142
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   404   e-142
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   402   e-141
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     402   e-141
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   400   e-140
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   399   e-140
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   399   e-140
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   399   e-140
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   398   e-139
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 397   e-139
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   392   e-137
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   390   e-136
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     380   e-132
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   377   e-131
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   374   e-130
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   373   e-129
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   361   e-125
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   359   e-124
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   353   e-122
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   340   e-116
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   222   3e-70
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   210   9e-66
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   203   8e-63
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   202   1e-62
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   197   2e-60
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   192   1e-58
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   192   2e-58
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   190   9e-58
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   188   8e-57
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   185   1e-55
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   184   4e-55
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   183   6e-55
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   182   1e-54
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   181   2e-54
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   181   2e-54
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   181   3e-54
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   179   5e-53
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   177   1e-52
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   171   1e-50
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   170   5e-50
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             167   4e-49
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   167   5e-49
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               167   5e-49
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   165   4e-48
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   164   7e-48
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   163   1e-47
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               164   1e-47
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   161   5e-47
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   162   6e-47
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   160   1e-46
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   159   2e-46
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   160   3e-46
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   160   4e-46
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     159   6e-46
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   159   8e-46
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   157   1e-45
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   157   4e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   156   8e-45
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   155   1e-44
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   154   2e-44
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   154   4e-44
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   153   6e-44
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     154   8e-44
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   152   9e-44
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   154   1e-43
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   152   1e-43
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   150   6e-43
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   148   4e-42
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   147   8e-42
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   147   1e-41
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   147   2e-41
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   145   8e-41
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   144   1e-40
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   144   2e-40
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   145   2e-40
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   144   2e-40
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   142   6e-40
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   142   7e-40
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   141   1e-39
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   141   3e-39
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   140   3e-39
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   141   3e-39
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   139   2e-38
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   137   8e-38
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   136   4e-37
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   135   8e-37
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   134   1e-36
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     134   2e-36
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   131   2e-35
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   129   2e-34
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   128   4e-34
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   126   2e-33
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   124   1e-32
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   124   1e-32
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     124   1e-32
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   123   3e-32
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   120   2e-31
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   103   7e-25
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    71   7e-15
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    51   1e-06
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    47   9e-06
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              42   0.001
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    42   0.001
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    37   0.006
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     39   0.012
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    39   0.017
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    37   0.035
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               37   0.062
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    35   0.14 
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     35   0.15 
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    34   0.35 
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    34   0.39 
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    33   0.53 
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    34   0.64 
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    33   0.84 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    33   1.1  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    33   1.2  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    32   1.3  
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    32   1.4  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    32   1.4  
Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa] ...    32   2.1  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   2.1  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    32   2.2  
KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} simi...    32   2.4  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    31   3.0  
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    31   3.3  
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    31   3.6  
KAFR0C02990 Chr3 complement(595952..596572) [621 bp, 206 aa] {ON...    30   4.0  

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VDMKWGSFPIFQ 312
           VDMKWGSFPIFQ
Sbjct: 301 VDMKWGSFPIFQ 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/312 (93%), Positives = 308/312 (98%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSATLKLNTGASIPVLGFGTWRSVDN+GYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AIKDSGVPREEIFITTKLWGTEQRDPEAAL+KSLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            +TDG+ LCIPTLEDGT+D+DTKEWNF+KTW+LMQ+LPKTGKTKAVGVSNFSINNIKELL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SP+NK+VPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           KHGVEPAQLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFKTISNLSKVHG KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V+M+W SFPIF+
Sbjct: 301 VNMQWNSFPIFE 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/312 (92%), Positives = 304/312 (97%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL+NSSATLKLNTGASIP LGFGTWRSVDNNGYHSVIAALK GYRHIDAAAIYLNEE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSG+ REEIFITTKLWGTEQRDPEAALN+SLKRLGLDYVDLYLMHWPVPLKTD
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            VTDGNVLCIPTLEDGTVD+DTKEWNFIKTW+LMQELPKTGKT+AVGVSNFSINNIKELL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SP+NK+VPATNQ+EIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           KHGVEP+QLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFK I +LSKVHG KRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V+MKW SFPIF+
Sbjct: 301 VNMKWASFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/312 (92%), Positives = 304/312 (97%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSA+LKLNTGASIPVLGFGTWRSV+NNGYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSGVPRE+IFITTKLWGTEQRDPEAALN+SLKRLGLDYVDLYLMHWPVPLKT+
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            +TDGNVLCIPTL+DGTVD+DT+EWNFIKTW+LMQELPKTGKTKAVGVSNFSINNIK LL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           ESP+NK+VPA NQIEIHPLLPQ+ELIAFCKEKGIVVEAYSPFGS NAPLL+EQAIIDMAK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           KHGV PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK ISNLSKVHG KRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           VDMKW SFPIF+
Sbjct: 301 VDMKWSSFPIFK 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  450 bits (1157), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 210/312 (67%), Positives = 254/312 (81%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LKNSSAT+KLNTGA IP LG GTWRS D   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
            VG+AI+DSGVPR E+F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KTD
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + D + L +PT +DG  D+D K+WNF+KTWEL+QELP TGK KAVGVSNFS+NN+KELL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NK+VPA NQ+E+HPLLPQDELI F K KGIV+EAYSP GS  +PLLKE  II++AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+GVEPAQ++I+W IQRGYV+L KSVNP+R+ SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VDMKWGSFPIFQ 312
           V   W SFPIF+
Sbjct: 301 VHPDWPSFPIFE 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  445 bits (1144), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 248/312 (79%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M A LKN +AT+KLNTGA+IP +G GTWRS +N+GY SVIAA K GYRHID AAIY NE+
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AI + GV R E+F+TTKLWGT+QRDPE ALN+SLKRLGLDYVDLYL+HWPV  KTD
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + DGN+L IP  +DG  DID  EWNFIKTWELMQ L KTGKTKA+G+SNFSINNIKELL
Sbjct: 121 TIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P   V PA NQ+E+HPLLPQDELIAFCKEKGIV+EAYSP G  NAP+LK++ II++AK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           ++ V+  Q++ SW +QRGYVVL KSV   RI+SN K FTL +DD   I+NL KV G  R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VDMKWGSFPIFQ 312
            D+    FP+FQ
Sbjct: 300 CDLGIKGFPMFQ 311

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  442 bits (1136), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 208/309 (67%), Positives = 250/309 (80%), Gaps = 1/309 (0%)

Query: 3   ATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62
           A L  +++TLKLNTGA IPV+G GTW+S +N GY++ + ALKAGYRHID AAIY NEEE+
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           GRAI+DS +PR E+F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKTD +
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
            DGN+L IP  EDG+ D+D ++WNF+KTWELMQELPK  K +A+GVSNFSINN+KELL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
             NKVVPA NQIEIHPLLPQDELI FCKEKGIV+EAYSP GS +AP+LKE+ I ++AKK+
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
           GV   QL+ISW  QRGYVVL KSV PERI  N + F L ++DF T+SN +K HG +RVV 
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 MKWGSFPIF 311
             WG F  F
Sbjct: 301 PNWGPFKPF 309

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  441 bits (1133), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSV-DNNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M +TLKNS+AT KLNTGA+IP +G GTW+S  +N GY +V+ ALKAGYRHID AAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI DSG+PREEIF+TTKLWGT+ RDPE ALN+SL+RLGLDYVDLYLMHWPV  K 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
           D + DGN   +P L +G  D+D   WNF+KTWELMQELPKTGKT+AVGVSNFSINN+K L
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NK+VPA NQ+E HPLLPQDEL  FCKEKGI++EAYSP GS NAP+L E  II++A
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299
           KKH V+PAQ++ISW +Q+G+VVL KSV+ ERI +NF+ F L +D+  +++NLSK  G +R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVDMKWGSFPIF 311
           +V   W  F  F
Sbjct: 301 IVQPNWAPFVPF 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  440 bits (1131), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 209/309 (67%), Positives = 250/309 (80%)

Query: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           +LKNS+ATLKLNTGA IPV+G GTWRS  N+GY SV+AALK GYRHIDAAAIY NE++VG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVT 123
           RAIKDSGVPR+EIFITTKLWGTE R+P  AL+ SLKRLGLDYVDLYLMHWPV LK     
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
           + ++L IP   DG  DID ++W+FIKTWELMQELPKTGKTKA+GVSNFSINN+K L  SP
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
               VPA NQ+EIHPL PQ ELI +CK + I++EAYSPFGSA+AP+LKE  +  +A+K+ 
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDM 303
           +  AQLIISWS+QRGYVVL KSV+ ERI +N K+ TL ++D +TI+NLSKV G KR+V +
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 KWGSFPIFQ 312
            W  FP F+
Sbjct: 302 DWSPFPTFE 310

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  436 bits (1121), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 251/312 (80%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL++S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AI+DSGVPRE+IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  D
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + DGN+L +PT +DG+  +D   WNFIKTWELMQELPKTGK KAVGVSNFSINN+K+LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            S  NK+ PA NQ+EIHPLLPQ+ELI FC+ KGI++E YSP GS +APLLKE  I+++AK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+ V+PA ++ISW  QRGYVVL KSVNP+R+ +N KIFTL ++DF+ I+ +SK  G KRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V   W  F  F+
Sbjct: 301 VHPNWSPFEAFK 312

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  435 bits (1119), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 252/312 (80%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M ATL+ S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +P  AL++SLKRLGLDYVDLYLMHWPV L  +
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + DG++L IPT EDG+  +D   WNFIKTWELMQELPKT KT+AVGVSNFSINN+K+LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP N++ PA NQ+E+HPLLPQ+ELI FCK KGI+VEAYSP GS +APLLKE  ++++AK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+RI +N K+FTL ++DF+ I+N+SK  G KRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V+  W  F  F+
Sbjct: 301 VNPDWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 249/312 (79%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL +S+  L LNTGA IP +G GTW+S +N+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + + ++L +PT +DG+  +D   WNFIKTWELMQELPKTGKTKAVGVSNFSINN+K+LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            S  NK+ PA NQ+EIHPLLPQDELI FCK KGIVVEAYSP GS +APLLKE  I+++AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+ V+P  ++ISW +QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  G KRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V   W  F +F+
Sbjct: 301 VHPNWSPFEVFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 202/312 (64%), Positives = 249/312 (79%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  TL +S+ TL LNTGA IP +G GTW+S DN+ Y SV+AALKAGY+HID AAIY NE+
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+AIKDSGVPREEIF+TTKLW T+  +P  AL++SL+RLGLDYVDLYL+HWP  L T+
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + DG++L +PT  DG+  +D   WNFIKTWELMQELPKTGKTKA+GVSNFSINN+K+LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NK+ PA NQ+EIHPLLPQ+ELI FCK K I++EAYSP GS +APLLKE  I+ +AK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+ V+P  ++ISW  QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  G KRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWGSFPIFQ 312
           V+  W  F  F+
Sbjct: 301 VNPNWSPFEAFK 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  424 bits (1090), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 198/312 (63%), Positives = 252/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M ATL  +++ LKLNTGA+I  +G GTWRS    + Y SVIAAL+AGYRHID AAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            EVGRAI++SGVPR EIF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
           + + +G+ +  PTL +G  DID  +WNF+KTWELMQ+LP+TGKT+A+GVSNFSINN+K+L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NK+VPA NQ+E+HPLLPQ EL+ FC  KGIV+EAYSP GSA+AP+LKE  II++A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299
           KK+GV  AQ++ISW++QRGY+VL KSVN ERI +N   FTL  +DF+ ++N+SKV GTKR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVDMKWGSFPIF 311
           ++D  W  F  F
Sbjct: 301 IIDPDWEPFKPF 312

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  423 bits (1088), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 261/313 (83%), Gaps = 3/313 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNN-GYHSVIAALKAGYRHIDAAAIYLNE 59
           M +TL+N++ TLKLNTGAS+P+LG GTWR+ D+  GY++V +AL+AGYRHID AAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
           E VGRAI++SG+PR+EIF+TTKLWGT+ RDP AAL++SL+RLGLDYVDLYLMHWPVP++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
                 ++L  P   DG++ +++ +W+FIKTWELMQELPKT KT+A+GVSNFSINNI +L
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVES-DWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L+SP NK+VPA NQ+E+HPLLPQ EL+ FC+EKGIVVEAYSPFGS +APLL EQAII++A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299
           KKH V  AQ+I+SW I+RG  VL KSV+ ER+VSNFK F+LPEDDF TI+N+SK  G KR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVDMKWGSFPIFQ 312
           VV+  W  F IF+
Sbjct: 299 VVNFDWSPFKIFE 311

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  417 bits (1072), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 240/306 (78%), Gaps = 1/306 (0%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSV-DNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65
           NS+ T KLNTGA+I  +G GTW+S  +N GY +VIAALKAGYRHID AAIY NE +VG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125
           I DSGVPREEIF+TTKLW T+  DP A LN SLKRLGLDYVDLYLMHWPV L    + DG
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 NVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNN 185
           N L IP L DG  D++   W+++KTWELMQELPKTGKT+AVGVSNFSINN+K++L SP N
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245
           KVVPA NQ+EIHPLLPQ+EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV+
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKW 305
            AQ++ISW +QRGY+VL KSV+ ERI +NFK   L +++ + I+N+SK  G +R+V   W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 GSFPIF 311
             F  F
Sbjct: 316 EPFVPF 321

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  412 bits (1059), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 193/312 (61%), Positives = 240/312 (76%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M ATL N+++T+KLNTG +IP +G GTWRS + +GY +V AALKAGYRHID AAIYLNEE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AI+DSG+PREE+FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT 
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           R+TDGN+L  P  EDG  D+DT EW+F+KTWELMQELPKT K ++VGVSNFSINN+KELL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NK+VPA  Q+EIHPLLPQ  L  FCKE  I VEAYSP G   AP+L +  I  +A 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           +H  +   +++SW +QRG V L KS  PER+VSN + F L +++  +I+NLSK  G KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VDMKWGSFPIFQ 312
                  FP+F+
Sbjct: 300 NAPDMSPFPLFE 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  404 bits (1039), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 240/312 (76%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPA LKNS   + LN G  IP +G GTW+S +N+GY+SVI ALKAGYRHID AAIY NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVGRAIKDSGVPR++IFITTKLW TE ++P+ AL  SLKRLGLDYVDLYLMHWPV L   
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + D + L +P L DGT D+D + W++IKTWEL+QELP TG T++VGVSNFSINN++++L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            SP NK+ PA NQ+E+HPLLPQ EL  +C  K I +EAYSPFGS NAP LK++ I+D+A 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+GV PAQ+I SW +QR  VVL KSV+ ER++SNFK+F L ++D   I  L+KV+G KR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VDMKWGSFPIFQ 312
               W  FP+F+
Sbjct: 301 NKPDWDPFPVFE 312

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  404 bits (1037), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 246/309 (79%), Gaps = 2/309 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPA LKN++   KLNTGA+IP+LGFGTWRS +  GY++V++A+K GYRHID+AA+Y NE 
Sbjct: 1   MPA-LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
            VGRAI+DSGVPREE+F+TTKLW T+QR+P  AL++SL+RLGLDYVDLYL+HWP+P+KTD
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           R+TDGN+  IPT EDG  D+DT EW++IKTW+LMQELP TGKT+AVGVSN S++ +++LL
Sbjct: 120 RITDGNLFSIPTKEDGKPDVDT-EWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLL 178

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
               NKVVPA  Q+E HPLLPQ++L+ FC +  I++EAYSP GS  +PL+ E  I ++AK
Sbjct: 179 ADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAK 238

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K+  +PAQ+IISW I+RGYVVL KSV P RI SN +   L ++DF+ I+ L    G KRV
Sbjct: 239 KYNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRV 298

Query: 301 VDMKWGSFP 309
            D +W +FP
Sbjct: 299 NDPEWFTFP 307

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  402 bits (1034), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 237/302 (78%), Gaps = 1/302 (0%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           NSSA  KL TGA+IP+LGFGTWRS + +GY++V+ ALK GYRHID AA+Y NE  VGRAI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  KDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGN 126
           +DSGVPR+++F+TTKLW T+ RDP  AL++SL+RLGLDYVDLYL+HWP+PL+T R+TDGN
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNK 186
           +  +PT EDG  D+D ++W+++KTWE+MQ+LP T KT+AVGVSNFS+  ++ LL +   K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 VVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEP 246
           V+PA NQ+E HPLLPQD+L  FC E  I++EAYSP GS  +PL++E A+ ++A KH  +P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 AQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWG 306
           AQ++ISW I+RGYV+L KSV P RI SNFKI  L +DDF  I+N+ K  G KR+ D  W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 SF 308
            F
Sbjct: 305 HF 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  402 bits (1032), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 247/313 (78%), Gaps = 1/313 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M  TLK S+ATLKLNTGA+IP +  GTWRS+   +GY SVIAALKAGYRHID AAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI+DSG+PREEIF+T+KLW T+Q +P  AL  +L RLGLDY+DLYLMHWPV   T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
             V   + + IP  E+G  DI+   WNF+KTWELMQELP TG TKAVGVSNFSINN+KEL
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L SP NK+ PA NQIEIHPLLP+ +LI FC+EKGI++EAYSP GS NAP+LKE  II+++
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299
           KK  V PAQLIISW +QRGYVVL KS + ERI++N K+FTL ++DF+ I NL+K  GT R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVDMKWGSFPIFQ 312
           VVD  W  FP+F+
Sbjct: 301 VVDPDWSPFPLFK 313

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           TL+NS++TLKLNTG +IP +G GTWRS +N GY +VI ALKAGYRHID AA+Y NE EVG
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVT 123
           +AI+DSGVPR EIF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+T+ + 
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
           DGN+       DG+ D+D  EWNFIKTWELMQ+L ++GKTKA+GVSNFS+NN+K+LL +P
Sbjct: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             KV PA NQ+E+HPLLPQ++LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDM 303
           VE   ++ISW++Q+G V L KSV P RIV N K+ TL + D   +  L K  G +R    
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 304 KWGSFPIFQ 312
            +  FPIFQ
Sbjct: 302 DFSPFPIFQ 310

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 183/301 (60%), Positives = 234/301 (77%)

Query: 12  LKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGV 71
           L++NTG  IPVLG GTW++ D + Y +V+AAL++GYRHID AAIY NE  VGRAI+DSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIP 131
           PRE+IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKTD + DGNVL IP
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPAT 191
              DG  D+D   W+F+KTW+LMQ+LPK+GKTKA+GVSNFSI NI+E+L+      VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLII 251
           NQIEIHP LPQDELI +CK KGI+VEAYSP GS+ + +L +  +I +A+KH VEPAQ++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPIF 311
           SW + RGY +L KSVN +R+ SN KI  L  +D + IS + +  G+KR V   W  FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 Q 312
           +
Sbjct: 306 E 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 183/301 (60%), Positives = 234/301 (77%)

Query: 12  LKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGV 71
           L++NTG  IPVLG GTW++ D + Y +V+AAL++GYRHID AAIY NE  VGRAI+DSGV
Sbjct: 6   LQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIRDSGV 65

Query: 72  PREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIP 131
           PRE+IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKTD + DGNVL IP
Sbjct: 66  PREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNVLSIP 125

Query: 132 TLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPAT 191
              DG  D+D   W+F+KTW+LMQ+LPK+GKTKA+GVSNFSI NI+E+L+      VPA 
Sbjct: 126 VRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLSVPAA 185

Query: 192 NQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLII 251
           NQIEIHP LPQDELI +CK KGI+VEAYSP GS+ + +L +  +I +A+KH VEPAQ++I
Sbjct: 186 NQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPAQILI 245

Query: 252 SWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPIF 311
           SW + RGY +L KSVN +R+ SN KI  L  +D + IS + +  G+KR V   W  FP++
Sbjct: 246 SWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAPFPMY 305

Query: 312 Q 312
           +
Sbjct: 306 E 306

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 235/306 (76%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           N S +LKLNTGASIPV+G GTW+S + + Y++V++AL+ GYRHID AAIY NEE VG+ I
Sbjct: 5   NESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGI 64

Query: 67  KDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGN 126
           +DSGVPREEIF+TTKLWGT+QRDPEAAL+ SL+RLGLDYVDLYL+HWPVPL    +TDGN
Sbjct: 65  RDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGN 124

Query: 127 VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNK 186
            L  P   DG +DID +EWNFIKTWE MQ LPK+GKTKA+GVSNFSI NI+ LL +  + 
Sbjct: 125 YLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDF 184

Query: 187 VVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEP 246
           +VPA NQIEIHP LPQ ELI +CK KGI++EAYSP GS+++ +L +  I  +A K+  EP
Sbjct: 185 IVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEP 244

Query: 247 AQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWG 306
           A ++ISW   RGYVVL KSVNP+RI +N K+  L  +D + I+ L++  G KR V   + 
Sbjct: 245 ANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFS 304

Query: 307 SFPIFQ 312
            F IF+
Sbjct: 305 PFAIFE 310

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  398 bits (1023), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 231/309 (74%), Gaps = 1/309 (0%)

Query: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           +LKN    +KLNTGA +P +G GTW+S++N+ Y +V+ ALK GYRHID AAIY NE EVG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVT 123
           +AI+DSGVPR EIF+TTKLWGT+QR P+ AL +SL+RLGLDYVDLYL+HWP+PL   +  
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
           + GN L  P L +G  D+D   WNF+KTWELMQELP TGK KAVGVSNFSINNIKELL S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
           P NK+VPA NQIE+HPLLPQ EL+ FCKEKGIVVEAYSP G   A +LKE  + ++AKK+
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
            +  A L++SW +QRG VVL KSV   RI+SN +  TL  +D + I+NLSK  G KR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 MKWGSFPIF 311
             +  F  F
Sbjct: 302 PDFSPFNTF 310

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  397 bits (1019), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/312 (59%), Positives = 231/312 (74%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  T KN   T  +     IP +  GTW++  N  Y +V+ ALKAGYRHID AAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           EVG+AI+DSG+PR++IF+TTKLWGTEQR+P  AL+ SLKRLGLDYVDLYLMHWPV LK D
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            +TD ++L IP L  G  DID + WNFIKTWELMQELP T K KA+GVSNFSINN+ ELL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P  K +PA NQ EIHPLLPQ+ELI +C++K I+VEAY P G +N PL+    I ++A 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K GV   QL+ISW IQRGYVVL KSV  ERIV+NF+  T+P ++F+ ++NL+K  G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VDMKWGSFPIFQ 312
           V++ +  FP +Q
Sbjct: 300 VNIDFSPFPTYQ 311

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  392 bits (1008), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/312 (61%), Positives = 239/312 (76%), Gaps = 7/312 (2%)

Query: 8   SSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           S   LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI
Sbjct: 7   SENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAI 66

Query: 67  KDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGN 126
           +DSGVPR EIF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV      + D +
Sbjct: 67  RDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDED 126

Query: 127 -----VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181
                 + IPT  +G VD++   WNFIKTWELMQ LP++GKTKAVGVSNFSINN+ +LL 
Sbjct: 127 GSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLA 186

Query: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
           +   KVVPA NQIE+HPLL Q+EL+ +CKEK I+VEAYSPFGS NAP+LK++ I  +AKK
Sbjct: 187 ASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKK 246

Query: 242 HGVEPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
             ++  Q+++SW IQR GYVVL KSV+ ERI++N K+ TLP++DF+ I+NL K  G  RV
Sbjct: 247 LDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRV 306

Query: 301 VDMKWGSFPIFQ 312
           VD  W  FP+F+
Sbjct: 307 VDPDWSPFPLFK 318

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  390 bits (1002), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 175/308 (56%), Positives = 238/308 (77%), Gaps = 1/308 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LK  +AT KLNTGA IP+LG GTWRS   NGY++ +AA+KAGYRHID AA+ +NE+
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
            VGRAI+DSGVPREE+F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  +++
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           +V   N + IP  +DG  D+D + W+++KTWELMQELP TGKT A+GV+NFS++ +K+L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SP NK+VPA +Q+E HP LPQ+++++FCK+  I++EAYSP GS  APLL E  + +++K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K  VEPAQL++SW +QRG+ VL KS  P RI +N   F +PE D + I+ L++  GTKR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VDMKWGSF 308
            +  W SF
Sbjct: 300 HNPTWFSF 307

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  380 bits (977), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 179/312 (57%), Positives = 234/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  TLKN + T+ LN G  IPV+G GT+ S  N  Y +V+ A KAGYRH+D AA Y NEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
           +VG+A+KD GVPR E+++TTK+W TE RDPEAAL+KSLKRLGL+Y+DLYLMHWPV LKTD
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            + DG ++CIP L DG  D+D K+W F++ WE MQ+L K+GK K++GVSNFSINNIKELL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
            +P   VVP  NQ+E+ PLLP DELI FC+ K I+ +AY PFG + APL+K+  ++++AK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
            +GV+  Q+I SW +QRGYVVL KSV   RI+SN K FTL + D   ++N+SK  G KR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VDMKWGSFPIFQ 312
            ++ +  FPIF+
Sbjct: 300 NNVNFSPFPIFE 311

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  377 bits (967), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 226/309 (73%), Gaps = 2/309 (0%)

Query: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           TL NS+A + LN G  +P +G GTW+S +N+ Y +V+AALKAGYRHID AAIY NEEEVG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV- 122
           RAIKDSGV R EIF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+   +  
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
            D N L IP  EDGT D+D   W+FIKTWELMQ LPK+ K K++GVSNFSINNIK+LL S
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
           P NK VP  NQ+E+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+L+   I +++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
            + PA ++ SW IQR  VVL KSV   RI+SN +   LP ++F  ++N+S   G KR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 MKWGSFPIF 311
             W  F  F
Sbjct: 301 PNWTPFIPF 309

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  374 bits (960), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 229/303 (75%), Gaps = 2/303 (0%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65
           K S++  KLNTGASIP++G GT+ S D  GY +V+ A+K GYRHID AA+Y NE+ VGRA
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125
           I+DSGVPREE+F+TTK+W T+ R+P  AL +SL RLGLDYVDL+LMHWP  L+T+R+TDG
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 NVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNN 185
           N++ +P  ED   D+DT EWN+IKTW LMQ+LP +GKTKAVGVSNFS+  +++LL  P +
Sbjct: 125 NMITVPKREDEKPDVDT-EWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGS 183

Query: 186 KVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVE 245
           KVVPA NQ+E+HPLLPQ  L  FCK+K I++ AYSP GS  APLL +  I+++A KH  +
Sbjct: 184 KVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKAD 243

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKW 305
           PAQ+II W ++RGYV L KSV P RI SN +I  L + + + I+ + K  G KRVVD +W
Sbjct: 244 PAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEW 302

Query: 306 GSF 308
             F
Sbjct: 303 FDF 305

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  373 bits (957), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 172/305 (56%), Positives = 227/305 (74%), Gaps = 1/305 (0%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD 68
           + + KLNTGA +P +G GTW+S + + Y +V++ALKAGY+HID AAIY NE  VG+AI+D
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVL 128
           SG+PR+E+FITTKLW T+ RDP+AAL+ SL+RLGLDYVDLYL+H+PV  KTDR+ DGN  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 CIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVV 188
           C P L +G  D+D  +W+F+KTW L+Q LP++GK KAVGVSNFSINN+K LLES     V
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK-HGVEPA 247
           PA NQ+EIHP LPQ ELI FCK K IVVEAYSP GS  + +L +  +  +A+K    +PA
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 QLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGS 307
           Q++I+W I RGY VL KSV P+RI +N +I  + ++D   ++NL  + G KR ++  W  
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FPIFQ 312
           FPIF+
Sbjct: 308 FPIFE 312

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  361 bits (926), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 231/312 (74%), Gaps = 4/312 (1%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVD-NNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M A LKNS+ TLKLN G+ IP++G GTW++ D  + Y++V AAL AGYRHID AAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            +VG AI+DSGVPREEIF+TTKLW  +  +PE AL++SL+RLGLDYVDLYLMHWPV L  
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
             + +   L +    DGT  ++T +W FI TWELMQ+LPK  K +++GVSNFS+NN+K+L
Sbjct: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMA 239
           L++P   VVP  NQ+E+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKR 299
           KK+GV+PA +++SW +QR  +VL KSV+ ER+ +N K FTLPE+DF  I  +S+  G +R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVDMKWGSFPIF 311
           + +  +  F  F
Sbjct: 298 INNPNFEPFKTF 309

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  359 bits (922), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 228/308 (74%), Gaps = 2/308 (0%)

Query: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LK  +AT  LNTGA IP+LG GTWR     GY +++AALKAGYRHID+AA+ +NE+
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
            +G+AI+DSGV R+E+F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + D
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           ++   N + IP   +G   +DT +W+++KTWELMQ+LP T KT+A+GV+NFS+  +  LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +SPNNK++PA +Q+E HP LP DE++AFC+EKGI++EAYSP G    PL+ E  I +++K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300
           K  VEPAQL+ISW ++RG  VL KS    RI SN ++F L ++D++ I  +++  G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VDMKWGSF 308
            +  W SF
Sbjct: 299 HNPPWFSF 306

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  353 bits (907), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 223/302 (73%), Gaps = 2/302 (0%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSG 70
           +LKLNTGASIP LGFGTW S   + Y +VI ALK GYRHIDAAA+Y NE  VG+ I+DSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  VPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCI 130
           +PREEIF+TTKLW T+QRDP +AL++SL+RLGLDYVDL+L+HWPVPLK     + N+L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 131 PTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPA 190
           PT       IDT++W+FIKTWELMQ LPKTGKT+AVGVSNFSI N+++LL S  + +VPA
Sbjct: 129 PT-PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 TNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQLI 250
            NQ EIHP LPQ ELI +CK KGIVVEAY P GS+++ +L +  I ++A K+ V+PA ++
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 ISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSFPI 310
           I+W I RGY VL KS  P RI SN     L  +D + I+ LS+  G KR V   +  +P+
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FQ 312
           F+
Sbjct: 308 FE 309

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  340 bits (871), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 168/310 (54%), Positives = 227/310 (73%), Gaps = 1/310 (0%)

Query: 3   ATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62
           ATLK S+ T+ LNTGA IP+ G GTW+S D++   +V AALK GY+HID A+ Y NEE V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           G+A+K+SG+PREE+FITTK+W  +QRDP  AL+ SLK+LG +YVDL LMHWPVP K    
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
           +  +   +P   DG V  D +EW+F+KTW LMQ+L  TGK KA+GVSNFSINN++ELL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
               VVPA NQ+E+H  LPQ EL+ +C++KGIVVEAYSP GS++APLLK+  +  +A+K+
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
           GV PA +++++   RG VVL KSV   RI+SNF+ F + E+D K ++++ K  G +R VD
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 303 MKWGSFPIFQ 312
             +  FP+FQ
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  222 bits (565), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 119/300 (39%), Positives = 184/300 (61%), Gaps = 13/300 (4%)

Query: 12  LKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD- 68
             LN G  IP +G GT    D       +V AA++AGYRHID A  Y  E  +G+A+K+ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 69  ---SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125
              + + REE+FITTK+W T   +P  ++++SLK LG+DYVDL L HWPV  +    + G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 126 NVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNIKELLES 182
           N++ +P  +DG    + K+ +++ T++ ++++   PK  + +A+GVSN+ I  ++ L + 
Sbjct: 131 NIIGLPRDKDGNALFE-KDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE 189

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
              KV PA NQ+E+HP LPQ EL  FC +  I++ AYSP GS  AP LK +++ D+AKK+
Sbjct: 190 --CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKY 247

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
            VEPA ++ S+ I +G VVL +S+NP+RI +N     L +DD   +  +  +    R +D
Sbjct: 248 KVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG-IDEPNRFID 306

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  210 bits (535), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 114/296 (38%), Positives = 177/296 (59%), Gaps = 12/296 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTW--RSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           +N+     LN G  IP +G GT   +        +V AA++AGYR ID A  Y  E  +G
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTEPYIG 64

Query: 64  RAIK----DSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            A+K    D  + RE++FITTK+W     DP  ++N+SLK LG+DYVD+ L HWP+  K 
Sbjct: 65  EALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCYKK 124

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNI 176
               +G ++  P  +DG V I  +  ++I T++LM+++   PK  + +A+GVSN+ I  +
Sbjct: 125 TYDENGTIIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIEYL 183

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAII 236
           + +++    KV P  NQ+E+HP LPQ EL  FC + GI++ AYSP GS  AP  K   + 
Sbjct: 184 ERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPLVQ 241

Query: 237 DMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLS 292
           + AKKH V PA ++ S+ +++G VV+ +S+NPER+ SN     L +++ K++ +  
Sbjct: 242 EYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  203 bits (516), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 114/318 (35%), Positives = 194/318 (61%), Gaps = 15/318 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           KN+     LN G  +P LG GT   ++       +V AA+K+GYRHID A  Y  E+ +G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      + RE+IFITTK+W T     + ++++SL+ LG+DYVDL L HWP+    
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 120 DRVTDG-NVLCI-PTLEDGTVDIDTKEWNFIKTWELMQE--LPKTGKTKAVGVSNFSINN 175
            +  +G + +C  PT EDG+   + K  ++++T++ +++  L K  + +++GVSN+ +  
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYNEK-GDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEY 183

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ LL+    KVVPA NQ+E+HP LPQ EL  FC +  I +EA+SPFG+  +P++K + +
Sbjct: 184 LERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELV 241

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVH 295
             +A+K+   P  ++I++ +++G V + +SVNP+ I SN +   L ++D   ++    V 
Sbjct: 242 QKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG-VE 300

Query: 296 GTKRVVDMKWG-SFPIFQ 312
             KR+VD ++  + P F+
Sbjct: 301 NPKRLVDEEFAVAIPGFR 318

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  202 bits (515), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 116/312 (37%), Positives = 184/312 (58%), Gaps = 14/312 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           KN+     LN G  +P +G GT   V+       +V AA+K+GYRHID A  Y  E+ VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      V RE+IF+TTK+W T     + ++++SL+ LGLD+VDL L HWP+    
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 120 DRVTDG--NVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL--PKTGKTKAVGVSNFSINN 175
               DG   V   P  EDG+   + K  ++++T++ +++L   K  + +A+GVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYNEK-GDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ LL+    +VVPA NQ+E HP LPQ EL  FC +  I +EAYSP G+ NAPL+  + +
Sbjct: 184 LERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVH 295
             +A K+      ++I++ +++G V + +SVNP+ I SN +   L ++D  T++    V 
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG-VE 300

Query: 296 GTKRVVDMKWGS 307
            TKR+VD  + +
Sbjct: 301 NTKRIVDEPFAA 312

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 179/313 (57%), Gaps = 14/313 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTW--RSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++    KLN G +IP LGFGT+  R        +V AA+KAGYRHID A +Y +E  VG
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPV--PL 117
            AIK+      V R ++F+TTK+W     + E +LN+SL+ LGLDYVDL L HWP+  P 
Sbjct: 65  EAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPR 124

Query: 118 KTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
             D     N L     +D    +  ++ +F++T+  ++++   P   + +A+GVSN++I 
Sbjct: 125 VEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSNYAIE 184

Query: 175 NIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            ++ L +    KV P  NQ+EIHP LPQ EL  FC   GI++ AYSP GS  AP LK   
Sbjct: 185 YLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIPL 242

Query: 235 IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKV 294
           +  +A+K+ +    ++IS+ I++G  V+ +S+NP RI S  +     +++ K + N+  +
Sbjct: 243 VHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVG-I 301

Query: 295 HGTKRVVDMKWGS 307
               R VD  +  
Sbjct: 302 EEPARFVDAAFAQ 314

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  192 bits (489), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 182/314 (57%), Gaps = 17/314 (5%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDNNGY--HSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +  +  LN G  +P LG GT       G    +V AA+KAGYRHID A  Y +E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RE+IFIT+K+W     D E +LN+SL+ LG+DY+DL+L HWP+    
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 120 DRVTDG-NVLCI-PTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
              T G N L   P   +G    +  + ++++T+  M+++   P   + +++GVSNF + 
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEV-DGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQ 186

Query: 175 NI-KELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
            + + L E     V PA NQ+E+HP LPQ EL  FC+   I++EAYSP GS NAP +  Q
Sbjct: 187 YLERTLFEC---AVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQ 243

Query: 234 AIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
            + D+A+K+ + P+ ++ S+ I++G  V+++SVN  RI SN +   L E++   +  L  
Sbjct: 244 LVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLG- 302

Query: 294 VHGTKRVVDMKWGS 307
           +   KR V+ KW +
Sbjct: 303 ITKPKRFVNEKWNA 316

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  192 bits (487), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 111/311 (35%), Positives = 181/311 (58%), Gaps = 14/311 (4%)

Query: 12  LKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD- 68
             LNTGA IP LG GT    +       +V  A+K GYR ID A +Y +E  +G A+++ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 69  ---SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125
                V RE++FITTK+W       E +L +SLK+L LDYVDL L HWP+         G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 126 NVLCIPT-LEDGTVDIDTKEWNFIKTWELMQELPK--TGKTKAVGVSNFSINNIKELLES 182
            +   P   + G + +D K  +++ TW+ ++++ K  +G+ + +GVSN+ +  ++ LL+ 
Sbjct: 131 KLKSHPVDPKSGDIVLDEK-GDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE 189

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
              +VVP  NQ+E+HPLLPQ+EL  +C   GI++E++SP GS+  P L+   + +++KK+
Sbjct: 190 --TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKY 247

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVD 302
             EP  +++++ +++G VV+ +S+N  RI+ N     L E+D   +S L +     RV+D
Sbjct: 248 DCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGR-EKPVRVMD 306

Query: 303 MKWG-SFPIFQ 312
             +  S P F 
Sbjct: 307 EYFATSIPGFH 317

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  190 bits (482), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 182/315 (57%), Gaps = 19/315 (6%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDNNG--YHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++    KLN G ++P LG GT    ++      +V AA+KAGYRHID A  Y  E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPL-K 118
            A+K+      V R ++FIT+K+W     D + +LN+SLK LGLDYVDLYL HWP+   K
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 119 TDRVTDG--NVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSI 173
            +   DG   +   P  +DG   I  +  +++ T++ M+++   PK  + +A+GVSN+ +
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNALI-VEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPV 183

Query: 174 NNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
             +  LL+     V PA NQ+E+HP LPQ EL  FC+   I + AYSP GS+ APLLK  
Sbjct: 184 EYLDRLLKVCT--VKPAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLP 241

Query: 234 AIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
            + ++++K+ V    ++IS+ I++G  V+ +S+NP R+       TL E +   + ++ +
Sbjct: 242 LVKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGR 301

Query: 294 VHGTKRVVDMKWGSF 308
              + R +D   GSF
Sbjct: 302 -KDSIRYID---GSF 312

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  188 bits (477), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 112/312 (35%), Positives = 180/312 (57%), Gaps = 13/312 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    +       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  + RE++FITTK+W     + + +LN+SLK LGL+YVDL L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK 138

Query: 120 DRVTDGNVLCIPT-LEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINN 175
            +   G    + T ++D    +   + ++++T++ ++++   P   + +A+GVSNFSI  
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L++    +V P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVH 295
             +A+K+ V    L+IS+ I++G +V+ +S+NP RI S+ +  +L +D+ + +++  + +
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDFGEKY 316

Query: 296 GTKRVVDMKWGS 307
              R +D  + +
Sbjct: 317 PV-RFIDEPFAA 327

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  185 bits (469), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 113/300 (37%), Positives = 170/300 (56%), Gaps = 16/300 (5%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    +       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RE++FITTK+W     + + +LN+SLK LGLDYVDL L HWP+    
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGK 138

Query: 120 DRVTDG--NVLCIPTLEDG-TVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSI 173
            +  +G    + +P  + G TV     +W  ++T++ ++++       + +A+GVSNFSI
Sbjct: 139 VKDPEGISGYMKLPVDDSGKTVYASNGDW--LETYKQLEKIYLDSNDHRVRAIGVSNFSI 196

Query: 174 NNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
             ++ L++    KV P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP LK  
Sbjct: 197 EYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIP 254

Query: 234 AIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
            +  + +K+ V    L+IS+ I++G +V+ +S+NP RI SN +   L +D+ + ++   +
Sbjct: 255 LVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGE 314

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  184 bits (466), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 175/316 (55%), Gaps = 12/316 (3%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    +       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVG 78

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RE++FITTK+W     + + +LN+SLK LGLDYVDL L HWP+  + 
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK 138

Query: 120 DRVTDGNVLCIPT-LEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINN 175
            +   G    + T ++D    +     ++++T++ ++++       + +A+GVSNFSI  
Sbjct: 139 VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L++    KV P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVH 295
             + +K+ V    L+IS+ I++G +V+ +S+NP RI SN +   L +D+ + ++   + +
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEFGEKY 316

Query: 296 GTKRVVDMKWGSFPIF 311
             + + +      P F
Sbjct: 317 PVRFIDEPFAAVLPEF 332

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  183 bits (464), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 108/293 (36%), Positives = 167/293 (56%), Gaps = 18/293 (6%)

Query: 14  LNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD--- 68
            N G  +P  G GT    +       +V AA+KAGYRHID A  Y  EE VG A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGN- 126
              V RE++ IT+K+W T   D + +LN+SL RL +DYVDL+L HWP  L T +V D + 
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDPHG 130

Query: 127 ---VLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINNIKELL 180
              +   P  + G    D K  ++I+T++ ++++       + +A+GVSNF I  +K +L
Sbjct: 131 VDKIAKEPVDDQGNPLYDEK-GDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVL 189

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240
           +    + VPA NQ+E+HP LPQ EL  FC E  I+V AYSP G   APLL+   +  + +
Sbjct: 190 KE--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCE 247

Query: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
           K+   P  ++ S+ +++G +V+ +S+N  RI SN +   L E+D   ++   +
Sbjct: 248 KYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQ 300

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  182 bits (463), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 180/317 (56%), Gaps = 14/317 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  +P LG GT    +       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RE++FITTK+W     + E +L++SLK +GLDYVDL+L HWP+  + 
Sbjct: 79  EAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWPLCFEK 138

Query: 120 DRVTDG--NVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
            +   G   ++  P  + G   + +   ++++T++ ++++   P   + +A+GVSNFSI 
Sbjct: 139 VKDPKGISGLVKTPVHKSGEAMLASN-GDWMETYKQLEKIYLDPNDHRVRAIGVSNFSIE 197

Query: 175 NIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            ++ L++    +V P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP LK   
Sbjct: 198 YLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKIPL 255

Query: 235 IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKV 294
           +  + +K+ V    ++IS+ I++G +V+ +S+NP RI S+ +   L +D+ + +++  + 
Sbjct: 256 VKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDFGEK 315

Query: 295 HGTKRVVDMKWGSFPIF 311
           +  + + +    S P F
Sbjct: 316 YPVRFIDEPFAASLPEF 332

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 179/314 (57%), Gaps = 17/314 (5%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++  +  LN G  +P +G GT    +       +V AA+KAGYR+ID A  Y +E  VG
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RE++FIT+K+W     D E +L +SLK LG+DY+DL+L HWP+    
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNR 124

Query: 120 DRVTDG-NVLCI-PTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
                G N L   P   DG+ D + K  +++ T++ M+ +   PK  + +A+GVSNF + 
Sbjct: 125 REDPHGINGLARNPEKADGSPDFNEKA-DWLDTYKQMERIYSNPKDNRVRAIGVSNFPVE 183

Query: 175 NIKELL-ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQ 233
            +K +L E P   V P  NQ+E+HP LPQ EL  FC +  I + AYSP GS  AP++K  
Sbjct: 184 YLKRVLKECP---VKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHP 240

Query: 234 AIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
            I +M++K+      ++ S+ I++G  V+ +S+N  RI SN +   L +DD   + +L +
Sbjct: 241 LIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDLGR 300

Query: 294 VHGTKRVVDMKWGS 307
               KR ++ KW +
Sbjct: 301 TE-PKRFINEKWNA 313

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 172/317 (54%), Gaps = 14/317 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP +G GT    D       +V AA+KAG+R ID A  Y  EE +G
Sbjct: 5   KATEIYFNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIG 64

Query: 64  RAIKD----SGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPL-- 117
            A+++      V RE++FITTK+W       E +LN+SLKRL LDYVDL L HWP     
Sbjct: 65  EALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVK 124

Query: 118 KTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSIN 174
           K D    G ++  P  EDG+   DT   ++++T++ ++ +       + +A+GVSN+ I 
Sbjct: 125 KQDPEGSGQLVNHPQHEDGSPFYDTAG-DWLETYKQIEAIYLAENDTRVRAIGVSNYPIE 183

Query: 175 NIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
            ++ L +    K VPA NQ+E+HP LPQ EL  +C + GI++ +YSP GS  AP L+   
Sbjct: 184 YLERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPL 241

Query: 235 IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKV 294
           + ++A K+      +++S+ I++G +V+ +S+N ERI        L +++   ++     
Sbjct: 242 VQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVE 301

Query: 295 HGTKRVVDMKWGSFPIF 311
           H  + + +      P F
Sbjct: 302 HEYRYIDEAFCVCVPGF 318

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  181 bits (460), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/298 (35%), Positives = 171/298 (57%), Gaps = 12/298 (4%)

Query: 6   KNSSATLKLNTGASIPVLGFGTWRSVDN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    +       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  + RE++FITTK+W     + + +LN+SLK LGLDYVDL+L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK 138

Query: 120 DRVTDGNVLCIPT-LEDGTVDIDTKEWNFIKTWELMQEL---PKTGKTKAVGVSNFSINN 175
            +   G    + T ++D    +     ++++T++ ++++   P   + +A+GVSNFSI  
Sbjct: 139 VKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEY 198

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ L++    +V P  NQ+E HP LPQ  +  FC    I++ AYSP GS  AP LK   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSK 293
             + +K+ +    ++IS+ I++G +V+ +S+NP RI S+ +   L +D+ + +++  +
Sbjct: 257 KKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDFGE 314

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  179 bits (453), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 168/307 (54%), Gaps = 29/307 (9%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----RAI 66
           T+KLN GA +P++G G W+  +      V  A+K GYR +D A  Y NE EVG    RAI
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 67  KDSGVPREEIFITTKLWGTEQR--DPEAALNKSLKRLGLDYVDLYLMHWPVPLK----TD 120
            +  V REE+F+ +KLW    R  D   AL ++L  LGLDY+DL+ +H+P+  K     +
Sbjct: 92  DEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEE 151

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           R   G  L     ++    +  +    I+T+  +++L   G+ +A+G+SNF    +++LL
Sbjct: 152 RYPAG--LYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLL 209

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------AP 228
                ++ PA  QIE HP L Q+ L+ + K +G+ V  YS  G  +            AP
Sbjct: 210 RG--CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAP 267

Query: 229 LLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           LL+ + +  +A++H   PA++++ W+ QR   V+ KS   ER+ +N ++    TL +D+ 
Sbjct: 268 LLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDEL 327

Query: 286 KTISNLS 292
           + +S+L+
Sbjct: 328 RELSSLN 334

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  177 bits (448), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 111/330 (33%), Positives = 173/330 (52%), Gaps = 35/330 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           + T  LN G  +PV+G G W+   +     V  A+K GYR  D A  Y NE+E+G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AI +  V RE++FI +KLW           AL ++L  LGLDYVDLY +H+P+P+K   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P +  G  D     +  ++   + T+  M++L   G  K++G+SNF    I+
Sbjct: 124 EEKYP---PEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQ 180

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN----------- 226
           +LL     ++ P   Q+E+HP L Q+ L+ + + K I V AYS FG  +           
Sbjct: 181 DLLRGA--RIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKD 238

Query: 227 -APLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNF---KIFTLPE 282
             PLL+ + ++++AKKH V P+Q+I+ W+ QRG  V+ KS   ER+++N    K  TL +
Sbjct: 239 VTPLLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSD 298

Query: 283 DDFKTISNLSKVHGTKRVVD-MKWGSFPIF 311
            +   I +L+K     R +D   W   P F
Sbjct: 299 SEMSDIFSLNK---NLRFLDPWDWARLPGF 325

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  171 bits (434), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/329 (34%), Positives = 170/329 (51%), Gaps = 31/329 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S  + LN G  +P++G G W+  ++     V  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDP---EAALNKSLKRLGLDYVDLYLMHWPVPLK--- 118
           AI +  V REE+F+ +KLW +   DP   + AL ++L  + LDY+DLY +H+P+  K   
Sbjct: 62  AISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 119 -TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
             ++   G        E G +  +      I T+  M++L   G  K++G+SNF+   I+
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVVP--LIDTYRAMEQLATDGLIKSIGISNFNGALIQ 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL S   K+ P   QIE HP L Q  LI +CK   I V AYS FG           + +
Sbjct: 179 DLLRS--CKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALD 236

Query: 227 APLLKEQAII-DMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
           A +L E  +I  +A  H VEP+Q+++ W+ QRG  ++ KS   ER++ N  I    TL E
Sbjct: 237 AKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSE 296

Query: 283 DDFKTISNLSKVHGTKRVVDMKWGSFPIF 311
            +  TIS+L+         D     FPIF
Sbjct: 297 QELSTISDLNIGLRFNDPWDWNNMKFPIF 325

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  170 bits (431), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 184/331 (55%), Gaps = 35/331 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S T+KLN G  +P++G G W+  +      V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREEIFITTKLWGT--EQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLK---- 118
             D G V RE++F+ +KLW +  + ++ + AL ++L+ LGL+Y+DL+ +H+P+  K    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
            +R   G        + G + ++  +   + T+  +++    G  KA+GVSNF    + +
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLE--KVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHD 182

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANA 227
           LL     K+ PA  QIE HP L Q++L+ +CK++GI V AYS FG           + + 
Sbjct: 183 LLAGA--KIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKST 240

Query: 228 PLLKEQAII-DMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
           P L E  ++  +A  HGV  +++++ W+ QR   ++ KS   ER+++N +I    TL ++
Sbjct: 241 PTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDE 300

Query: 284 DFKTISNLSK---VHGTKRVVDMKWGSFPIF 311
           + + IS+L+K    +     +DMK   FP+F
Sbjct: 301 ELQEISSLNKDIRFNDPFNWLDMK---FPVF 328

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  167 bits (424), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 107/327 (32%), Positives = 166/327 (50%), Gaps = 31/327 (9%)

Query: 12  LKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----RAIK 67
           L LN G  +P +G G W+  ++     V  A+KAGYR  D A  Y NE EVG    RA+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 68  DSGVPREEIFITTKLWGTEQRDPEAALN--KSLKRLGLDYVDLYLMHWPVPLKTDRVTDG 125
           D  V R+++F+ +KLW          LN  ++LK LGLDY+DLY +H+P+  K   + + 
Sbjct: 65  DGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER 124

Query: 126 NVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
                P +  G  D     +  +    + T+  ++E  + G  K++G+SNF+   + ++L
Sbjct: 125 YP---PQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL 181

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN------------AP 228
              + K  P   QIE HP L Q++L+ +CK   + V  YS FG  +             P
Sbjct: 182 RGCSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPP 239

Query: 229 LLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           L     I  +A+KH V  A++++ W+ QRG  ++ KS + +R++SN  I    TL E+D 
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 286 KTISNLSKVHGTKRVVDMKWGSFPIFQ 312
           K+IS L++        D     FPIF 
Sbjct: 300 KSISGLNQNLRFNDPWDWNNSKFPIFH 326

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  167 bits (424), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 163/311 (52%), Gaps = 31/311 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           + T+ LN G  +P++G G W+  ++     +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AIK+  V RE++ + +KLW +         AL ++L  L LDYVD++ +H+P+  K    
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     I+ ++   + TW  +++L   GK K++G+SNFS   I+
Sbjct: 125 DEK---YPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQ 181

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL     ++ P   QIE HP L Q+ LI + K  GI V AYS FG           + N
Sbjct: 182 DLLRGA--RIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALN 239

Query: 227 APLLKEQAII-DMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
            P L E   I  +A KH V P Q+++ W+ Q G  ++ KS   ER++ N +I    TL +
Sbjct: 240 TPTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTD 299

Query: 283 DDFKTISNLSK 293
           D+ K IS L++
Sbjct: 300 DELKQISGLNQ 310

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  167 bits (423), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 171/331 (51%), Gaps = 33/331 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S T+ LN G ++P++G G W+   +     V  A+K GYR  D A  Y NE++VG    R
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA---ALNKSLKRLGLDYVDLYLMHWPVPLK--- 118
           AI +  V RE++F+ +KLW T   DP+    AL ++L  + L+Y+DLY +H+P+  K   
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 119 -TDRVTDGNVLCIPTLEDGTVDIDTKE-WNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
             +R   G        ED    I T+E    I T+  M+EL   G TK++G+SN++   +
Sbjct: 121 FEERYPPG---FYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALV 177

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN---------- 226
           ++ L     ++ P   QIE HP L Q++L+ +CK  GI V AYS FG  +          
Sbjct: 178 QDTLR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAK 235

Query: 227 --APLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLP 281
              PL     I  +A++H V  +Q+I+ W+ QRG  V+ KS +  R++ N +I    TL 
Sbjct: 236 HTPPLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLT 295

Query: 282 EDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ 312
             D + IS+L+K        D     FP F 
Sbjct: 296 PKDLEEISSLNKNLRFNDTWDWTISKFPSFH 326

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  165 bits (418), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 108/329 (32%), Positives = 166/329 (50%), Gaps = 31/329 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S+ + LN G  +P++G G W+  ++     V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFITTKLWGTEQR--DPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
             D G V RE++F+ +KLW +       + AL ++L  +GLDY+DL+ +H+P+  K    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     I       I T+  +++  + G  K++G+SNFS + ++
Sbjct: 122 EEKYP---PGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQ 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL     K+ P   Q+E HP L Q+ L+ +CK+ GI V AYS FG           + N
Sbjct: 179 DLLRQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKN 236

Query: 227 AP-LLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
            P L     I  +A  H V  +Q+++ W+ QRG  ++ KS   ER+  N  I    TL  
Sbjct: 237 TPNLFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTH 296

Query: 283 DDFKTISNLSKVHGTKRVVDMKWGSFPIF 311
            + + IS L+K        D   G FPIF
Sbjct: 297 KELEAISKLNKNLRLNDPWDWLDGKFPIF 325

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  164 bits (416), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 170/333 (51%), Gaps = 38/333 (11%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           ++ + LN G  +P++G G W+  +      +  A+  GYR  D A  Y NE+EVG    R
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIKDSGVPREEIFITTKLWGT--EQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AIKD  V REE+F+ +KLW +    ++ + AL ++L  +GLDY+DL+ +H+P+ LK    
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P L  G  D     +  +    + T+  ++E  + G  K++GVSNFS + + 
Sbjct: 122 EEKYP---PGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL     ++ PA  QIE+HP L Q+  + + + KGI V AYS FG             A
Sbjct: 179 DLLRGA--RIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKA 236

Query: 226 NAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
             PL +   +  +A KH V  +Q+++ W+ Q+   V+ KS   ER+  N  +    TL  
Sbjct: 237 TPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTG 296

Query: 283 DDFKTISNLSKVHGTKRVVD-MKWGS---FPIF 311
           D+ K IS L+K     R  D   W     FPIF
Sbjct: 297 DEIKEISGLNK---NLRFNDPFTWSEKTPFPIF 326

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  163 bits (413), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 151/291 (51%), Gaps = 39/291 (13%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEE----V 62
           N     KLN G  +PV+GFG +          V  AL+ GYRHID A +Y N+++    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 63  GRAIKDSGVPREEIFITTKLWGTEQ-RDPEAALNKSLKRLGLD------YVDLYLMHWPV 115
            R ++++G PREE++ TTKLW T+Q RD   A  ++L+ +  D      YVDL L+H P+
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQGRD---ATPRALEEIAADVKEFIGYVDLLLLHSPL 124

Query: 116 PLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINN 175
                R+    VL     E  +  ++                      +A+GVSNF + +
Sbjct: 125 TDAQRRLETWAVLERAVQEPASSALE---------------------IRAIGVSNFGVRH 163

Query: 176 IKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAI 235
           ++ELLE    K  P  +Q+E+HP LP+ EL AF +E GI+ EAYSP        L++  +
Sbjct: 164 LQELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRLQDPEL 219

Query: 236 IDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK 286
           + +  K G+   ++++ WS  +G+ VL KS NP+RI  N  +     D +K
Sbjct: 220 LALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWK 270

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  164 bits (414), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/331 (34%), Positives = 166/331 (50%), Gaps = 32/331 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           SA + LN G  +P++G G W+   +     +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEAALN--KSLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V RE++FI +KLW          LN  ++LK LGLDYVDLY +H+P+  K    
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKE-WNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +R   G        ED    I T+E    I T+  M++L   G  K++G+SN++   + 
Sbjct: 122 DERYPPG---MYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVA 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN----------- 226
           + L     ++ P   QIE HP L Q++L+ +CK   + V AYS FG  +           
Sbjct: 179 DTLRG--CRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKN 236

Query: 227 -APLLKEQAIIDMAKKH-GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLP 281
             PL     I  +A K+  V  +Q+++ W+ QRG  ++ KS   ER++ N  I    TL 
Sbjct: 237 TPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLA 296

Query: 282 EDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ 312
           E+D + IS L++        D     FPIFQ
Sbjct: 297 EEDLREISALNQNLRFNDPWDWNNSKFPIFQ 327

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  161 bits (407), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/279 (35%), Positives = 150/279 (53%), Gaps = 37/279 (13%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           + KL++G +IP +G GT+    N   + V  AL+ GYRH D A +Y NE EVG+ IK   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRL-GLDYVDLYLMHWPVPLKTDR 121
               +   R ++F TTKLW ++    +A  A++  L+ +  L Y+DL L+H P+  K  R
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKKLR 127

Query: 122 VTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181
                                     ++T+E MQE    GK +++GVSN+   +I+ELL 
Sbjct: 128 --------------------------LETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
               K  P  NQIEI P   + EL  FCK+KGI+VEAY+P    +   LK+  ++ +A +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 242 HGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
            G +  Q +I WS+Q+GY+ L K+ +  R+ SN  +F+ 
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  162 bits (410), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 166/313 (53%), Gaps = 33/313 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S  + LN G  +P++G G W+  +      V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREEIFITTKLWGT--EQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
             D G V REE+F+ +KLW +  + ++ +AAL ++L  + LDY+DL+ +H+P+ LK    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P L  G+ D     +  +    I T+  +++L   G  K++G+SNFS + I 
Sbjct: 122 KEK---YPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIM 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL     ++ P   QIE HP L Q+ L+ + K +G+ V AYS FG              
Sbjct: 179 DLLRG--CRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKT 236

Query: 226 NAPLLKEQAIIDMAKKHGVE--PAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTL 280
             PL +   II++AK HG E  P+Q+++ W+ Q    V+ KS   ER+  N  I    TL
Sbjct: 237 TPPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTL 296

Query: 281 PEDDFKTISNLSK 293
            + + K IS L+K
Sbjct: 297 TDQELKEISALNK 309

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  160 bits (404), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 102/295 (34%), Positives = 156/295 (52%), Gaps = 42/295 (14%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-- 66
           S T  L  G  IPVL  G + +      H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---KDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLG-LDYVDLYLMHWPVPLKTD 120
              +   V R EIF TTK+ G      +A  ++ KSL+ +  ++Y+DL L+H P+    +
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
           R                          + TW+ +QE    GK +A+GVSN+SI +++EL 
Sbjct: 126 R--------------------------LGTWKALQEAYAEGKVRAIGVSNYSIKHLEELY 159

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANA---PLLKEQAIID 237
                KV P  NQ E++P L + EL  +C++KG+V+EA+SP         P L+E  +I 
Sbjct: 160 NWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQE--LIK 217

Query: 238 MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
            +  +   PAQ++I WS+Q G++ L KS N +R +SN +   F + + D K +++
Sbjct: 218 TSYPNQT-PAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  159 bits (402), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 140/279 (50%), Gaps = 37/279 (13%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           T  L  G  +P LG G +    N     V  ALK GYRH D A  Y NE EVG  I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLG-LDYVDLYLMHWPVPLKTDR 121
               S   R+++F  TKLW ++    EA  A+ + L+++  L Y+DL L+H P      R
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 VTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181
                                     + T+E MQE    G  K++GVSN+  ++++EL  
Sbjct: 125 --------------------------LATYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
            PN K  P  NQIE+ P LP+++L+ +CK  G+ ++AYSP G  +   + +  I  +A +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQ 216

Query: 242 HGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
               PAQ++I+WS+ +GY  L K+ N +R+ SN   + +
Sbjct: 217 KNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNV 255

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  160 bits (405), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 166/311 (53%), Gaps = 29/311 (9%)

Query: 8   SSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG---- 63
           +S T+KLN G  +P++G G W+  +      V  A+K GYR  D A  Y NE+EVG    
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 64  RAIKDSGVPREEIFITTKLWGT--EQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLK--- 118
           +AI +  V RE++F+ +KLW +  + ++ + AL ++L+ + L+Y+DL+ +H+P+  K   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 119 -TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
             ++   G        + G + ++  +   I T+  ++E  K G  K++G+SNF    I 
Sbjct: 124 FEEKYPPGFYTGAEDAKKGVISLE--QVPIIDTYRALEECVKEGLIKSIGISNFRGILIH 181

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL     K  P   QIE HP L Q++LI +C ++ I V AYS FG             +
Sbjct: 182 DLLAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKS 239

Query: 226 NAPLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
              L + + I  +A  HGV  +Q+++ W+ QR   ++ KS   ER++ N +I    TL E
Sbjct: 240 TPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTE 299

Query: 283 DDFKTISNLSK 293
            + + IS L+K
Sbjct: 300 AELQEISALNK 310

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  160 bits (404), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 162/310 (52%), Gaps = 29/310 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S T+ LN G  +P++G G W+  ++     V  A+K GYR  D A  Y NE+EVG+ IK 
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 68  ---DSGVPREEIFITTKLWGTEQR--DPEAALNKSLKRLGLDYVDLYLMHWPVPLK---- 118
              +  V RE++F+ +KLW +     + + AL K+L  +GLDY+DL+ +H+P+  K    
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
            ++   G        ++G   I  ++   I T+  +++    G  K++G+SNF+ + +++
Sbjct: 125 EEKYPPGFYTGAEDEKNGV--ISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQD 182

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SAN 226
           LL     ++ P   QIE HP L Q+ L+ +CK  GI V AYS FG               
Sbjct: 183 LLRGA--RIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKTT 240

Query: 227 APLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
             L +   +  +A  H V  +Q+++ W+ QRG  V+ KS   ER++ N  I    TL + 
Sbjct: 241 PTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSDK 300

Query: 284 DFKTISNLSK 293
           + K IS L+K
Sbjct: 301 ELKAISALNK 310

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  159 bits (403), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 108/328 (32%), Positives = 172/328 (52%), Gaps = 30/328 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           +A + LN G  +P++G G W+  ++     V  A+K GYR  D AA Y NE+EVG    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           A+ +  V R ++FI +KLW T         AL ++L  LGLDY+DLY +H+P+  K    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 TDGNVLCIPT-LEDGTV-DIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
            +    C  T  ED  +  I  +   ++ T+  M++L   G TK++GVSN   + ++++L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANAPL 229
                ++ PA  QIE HP L Q+ L+ FCK + I V +YS FG           + + P 
Sbjct: 182 MGC--RIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 230 LKEQAII-DMAKKHG--VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
           L +  +I  +A  HG  V  +++++ W+ QR   ++ KS   ER++ N  +    TL E 
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 284 DFKTISNLSK---VHGTKRVVDMKWGSF 308
           +   IS L+K    + T    +M +GSF
Sbjct: 300 ELLEISALNKNIRFNDTWDWNNMHFGSF 327

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  159 bits (402), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 162/310 (52%), Gaps = 30/310 (9%)

Query: 10  ATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK-- 67
           + + LN G  +P++G G W+  ++     V  A+K GYR  D A  Y NE EVG+ IK  
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 68  -DSG-VPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLK----T 119
            D G V R ++F+ +KLW +         AL ++L+ LGLDY+DLY +H+P+  K     
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFE 122

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
           ++   G    +    +G   +   +   + T+  ++E    G  K++G+SNF+   +++L
Sbjct: 123 EKYPPGFYTGVDDAREGI--LSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDL 180

Query: 180 LESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANAP 228
           L     ++ P   QIE HP L Q++L+ +CK KGI V AYS FG           + + P
Sbjct: 181 LNG--CRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTP 238

Query: 229 LLKEQAIID--MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
            L E  II    A      P+++++ W+ QRG  V+ KS   ER++ N  +    TL E+
Sbjct: 239 SLLEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEE 298

Query: 284 DFKTISNLSK 293
           +   IS+L+K
Sbjct: 299 ELNEISSLNK 308

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  157 bits (398), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/296 (34%), Positives = 157/296 (53%), Gaps = 40/296 (13%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
            +S T  L  G  IPVLGFGT+ +        V AA K GYRH+D A +Y NE E   A+
Sbjct: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63

Query: 67  ----KDS-GVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLG-LDYVDLYLMHWPVPLK 118
               K+S  V R+++F TTK+ G      +A  ++ +SL+    L+YVDL+L+H P    
Sbjct: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAET 123

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
             R                          + T++ +QE  K GK KA+GVS++SI +++E
Sbjct: 124 EKR--------------------------LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDM 238
           L      +V P  NQ E++P L + +L+ +CKE+ +V+EA+SP     +    +  +  +
Sbjct: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215

Query: 239 AKKH--GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
            K+   G  PAQL+I WS+Q G+V L KSV+ +R  SN     F +  +D KT+++
Sbjct: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  157 bits (397), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/311 (32%), Positives = 157/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+   N   + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AI +  V R+++F+ +KLW           AL K+L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    GT D     I       I T+  +++    G  K++G+SNF  + ++
Sbjct: 122 EEKYP---PGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQ 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG------------SA 225
           +LL     ++ P   QIE HP L Q+ L+ FCK   I V AYS FG             A
Sbjct: 179 DLLRGC--RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKA 236

Query: 226 NAPLLKEQAIIDMAKKH-GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLP 281
              L +   I  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   F+L 
Sbjct: 237 TQTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLT 296

Query: 282 EDDFKTISNLS 292
           E + K IS L+
Sbjct: 297 EQELKKISALN 307

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  156 bits (395), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 157/311 (50%), Gaps = 32/311 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+       + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AI +  V R++IF+ +KLW           AL K+L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     I       I T+  ++E    G  K++GVSNF  + I+
Sbjct: 122 EEKYP---PGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQ 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SAN 226
           +LL     ++ P   QIE HP L Q+ L+ FCK   I V AYS FG           +  
Sbjct: 179 DLLRG--CRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKT 236

Query: 227 APLLKEQAII-DMAKKH-GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLP 281
            P L E  +I  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   FTL 
Sbjct: 237 TPTLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLT 296

Query: 282 EDDFKTISNLS 292
           E + K IS L+
Sbjct: 297 EQELKDISALN 307

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  155 bits (392), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 148/290 (51%), Gaps = 37/290 (12%)

Query: 7   NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           N     KLN G  IPV+GFG +     +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 67  K----DSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLD------YVDLYLMHWPVP 116
           +    ++G  RE I+ TTKLW ++    E    K+L+ +  D      YVDL L+H P  
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREET--EKALQEVAADVKEYIGYVDLLLLHSPRG 125

Query: 117 LKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
               R+    +L     E G+                     K  + K++GVSNF ++++
Sbjct: 126 GAKRRLETWAILEQAVQEPGS---------------------KALEIKSIGVSNFGVDHL 164

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAII 236
           +ELL+    KV P  +Q+E+HP LP+ EL  + KEK I  EAYSP        L++  ++
Sbjct: 165 EELLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLTQGYR--LQDPELL 220

Query: 237 DMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK 286
            +  K G+  A +++ WS  +G+VVL KS NPERI  N  +     D +K
Sbjct: 221 ALEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVLPSENDSWK 270

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  154 bits (390), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 146/277 (52%), Gaps = 37/277 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI------ 66
           KL++G ++P +G GT+    N     V  ALK GYRH+D A +Y NE EVG  I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 67  KDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
             S   RE++F  TKLW ++    + + A+ +  +++ GL Y+DL L+H P+     R  
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKR-- 128

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
                                   ++T++ MQE    G  +++GVSN+ +++I ELL   
Sbjct: 129 ------------------------LETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWN 164

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P L + EL  +CK +G++VEAY+P    +   +    ++ +AK+ G
Sbjct: 165 ELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAG 222

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
               Q++I WS+Q GYV L K+ + +R+ SN  ++ +
Sbjct: 223 CNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  154 bits (390), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 158/310 (50%), Gaps = 30/310 (9%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+       + +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V R+++F+ +KLW           AL K+L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
            ++   G    +   + G   I       + T+  ++E    G  K++G+SNF  + +++
Sbjct: 122 EEKYPPGFYTGVDDEKKG--HITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANA 227
           LL     ++ P   QIE HP L Q+ L+ FC+   I V AYS FG           +   
Sbjct: 180 LLRG--CRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTT 237

Query: 228 PLLKEQAII-DMAKKH-GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
           P L E  +I  ++  H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   FTL E
Sbjct: 238 PTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 283 DDFKTISNLS 292
            + K IS L+
Sbjct: 298 QELKEISALN 307

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 95/276 (34%), Positives = 145/276 (52%), Gaps = 36/276 (13%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI---- 66
           + KL +G +IP +G GT+    +N    V AAL+ GYRH+D A +Y NE EV +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -KDSGVPREEIFITTKLWGTE--QRDPEAALNKSLKRLG-LDYVDLYLMHWPVPLKTDRV 122
            +   V RE+IF TTKLW ++      + A+ + ++ +G L Y+DL LMH P+  K  R 
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPIGGKQVRR 125

Query: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
                                      TW+ MQE    G  +++GVS++   ++++L E 
Sbjct: 126 --------------------------GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKH 242
              K  PA NQIEI P + + +L  +CK KGIVVEAYSP    +   L +  ++ +A++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEET 217

Query: 243 GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
           G  P Q+++ WS+Q GYV L K+    R+  N  +F
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  154 bits (388), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 109/333 (32%), Positives = 166/333 (49%), Gaps = 39/333 (11%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+   LN G  +P++G G W+  +      V  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKTDRV 122
           AI +  V R ++FI +KLW T         A+ K+L  LGLDY+DLY +H+P+  K   +
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 TDGNVLCIPTLEDGTVD-----IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     I  ++  ++ T+  M+ L + G  K++GVSN     ++
Sbjct: 122 EEKYP---PGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQ 178

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSA-----------N 226
           ++L     K+ P T QIE HP L Q  L+ +CK + I+V AYS FG             +
Sbjct: 179 DVLMGC--KIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKED 236

Query: 227 APLLKEQAIID-MAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
            P L +  +I  +A K+ V  +++++ W+ Q G  V+ KS   ER++ N  I    TL  
Sbjct: 237 TPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSN 296

Query: 283 DDFKTISNLSKVHGTKRVVDMKWG----SFPIF 311
           ++   ISN+++     R  D  WG     FP F
Sbjct: 297 EELVEISNINR---NIRFNDT-WGWNNMGFPTF 325

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  152 bits (385), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 146/275 (53%), Gaps = 37/275 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           +L  G  IP L  GT+   ++     V  ALK GYRH D A +Y NE EVG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
             +   RE++F TTKLW ++    EA  A+ + ++++ GL Y+D+ L+H P+  +  R  
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRR-- 129

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
                                   ++TW+ MQE    G  K++GVSN+  ++I+ELL   
Sbjct: 130 ------------------------LETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P + + EL  +CK   +VVEAY+P   A+   + +  + +++K+ G
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPM--AHGYKMNDPGLREISKETG 223

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
           + P QL+I WS+Q GY+ L K+    R+ SN  ++
Sbjct: 224 MNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  154 bits (388), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 168/332 (50%), Gaps = 36/332 (10%)

Query: 9   SATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+  +    + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V R++IF+T+KLW           AL K+L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
            ++   G        +D    I       I T+  ++     G  K++G+SNF  + +++
Sbjct: 122 EEKYPPG--FYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFG-----------SANA 227
           LL     ++ P   QIE HP L Q+ L+ +CK   I V AYS FG           + + 
Sbjct: 180 LLRG--CRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKST 237

Query: 228 PLLKEQAII-DMAKKH-GVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
           P L E  ++  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I    TL +
Sbjct: 238 PTLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTD 297

Query: 283 DDFKTISNLSKVHGTKRVVD-MKW--GSFPIF 311
            + K IS+L+      R  D   W  G FPIF
Sbjct: 298 QELKEISSLN---ANIRFNDPWTWLDGKFPIF 326

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  152 bits (384), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 140/275 (50%), Gaps = 37/275 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G SIP +G GT+   +N   + V  ALKAGYRH D A +Y NEEEVG+ I      
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 69  --SGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
                 RE +F TTKLW ++    +A  A+   L ++  L+Y+DL L+H P+     R  
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPLGGTKLR-- 127

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
                                   ++TW+ MQE    G  K++GVSN+ +++I ELL   
Sbjct: 128 ------------------------LETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQ 163

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P L + EL  +CK   I VE YSP    +   L +Q +  +A + G
Sbjct: 164 YLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETG 221

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
               Q++I WS+Q GY+ L K+    R+ +N  ++
Sbjct: 222 KNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVY 256

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  150 bits (379), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 146/282 (51%), Gaps = 46/282 (16%)

Query: 17  GASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD------SG 70
           G  IP L  G +    +   + V  ALK GYRH D A +Y NE+EVG  I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 71  VPREEIFITTKLWGTE------QRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTD 124
             RE++F TTKLW ++      +R     +NK +K LG  Y+DL L+H P+     R   
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNK-VKELG--YIDLLLIHSPLSGPRRR--- 125

Query: 125 GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPN 184
                                  ++T++ MQE    G  K++GVSN+   +I+EL +   
Sbjct: 126 -----------------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDK 162

Query: 185 NKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
            K  P  NQIEI P   +++L ++C+ KG++VEA+SP    +   LKE  ++ +AKK G 
Sbjct: 163 LKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKKLGR 220

Query: 245 EPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL---PED 283
           +  Q++I WS+QRG + L K+ NP R+ SN +++     PED
Sbjct: 221 DTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPED 262

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  148 bits (374), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 153/293 (52%), Gaps = 40/293 (13%)

Query: 10  ATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI--- 66
            T  L  G  +P LG G +++      + V  ALK GYR +D+A +Y NE E    I   
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 67  --KDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLG-LDYVDLYLMHWPVPLKTDR 121
             +   V R +IF TTK+   +Q     + ++ +SL R+  LDY+DL+L+H P+  K  R
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 122 VTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLE 181
                                     + TW+  QE  +TGK KA+GVSN+ I +++E+ +
Sbjct: 127 --------------------------LGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQ 160

Query: 182 SPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKK 241
               K+ P  NQ E++P L + EL  +C +KG+V++AYSP   A    L++  ++ + + 
Sbjct: 161 WDGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLTRARR--LQDPELVKLVED 218

Query: 242 HGVE--PAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
              E   AQ++++WS+Q G+V L K+V+ +R+  N K   F L   D K +++
Sbjct: 219 SYPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  147 bits (371), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 142/281 (50%), Gaps = 37/281 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----K 67
           KL+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I     +
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSG-VPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
           D G   REEIF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
           +G+ L                   ++TW  MQE    G  K++GVSN+   +I ELL  P
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWP 160

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P + + EL  +CK KG+VVEA++P    +   +    ++ + K+  
Sbjct: 161 ELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDD 284
             P Q++I WS+Q GY+ L K+   +R+  N   +     D
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  147 bits (370), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/294 (35%), Positives = 148/294 (50%), Gaps = 44/294 (14%)

Query: 11  TLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA----- 65
           T KL++   IP +  GT+    +     V  AL  GYRH D A +Y NEEEV +      
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 66  IKDSGVPREEIFITTKLWGTE--QRDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRV 122
           I+     R+EIF TTKLW ++   ++ + A+ + + ++  L Y+DL LMH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 TDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLES 182
             G     P + +             +TW  MQE    G  K++GVSNF I ++KEL + 
Sbjct: 121 --GG----PQIRE-------------ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 183 PNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSA---NAP-LLKEQAIIDM 238
              K  P  NQIEI P L + EL  FCK +G+VVEAY+P       N P L+K    ++ 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNN 221

Query: 239 AKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
            K  G    Q++I WS+Q GYV L K+    R+ SN  +  F L ED  K + +
Sbjct: 222 TKNTG----QILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  147 bits (370), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 95/292 (32%), Positives = 152/292 (52%), Gaps = 42/292 (14%)

Query: 1   MPATLKNSSAT-----LKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAI 55
           MP+  +  S T      KL++G  +P +G GT+          V  ALK+GYRH+D A +
Sbjct: 1   MPSKARIMSKTTVPKAYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVL 60

Query: 56  YLNEEEVGRAIKD------SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLG-LDYV 106
           Y NE EVG+ I+           R+++F TTKLW ++    + + A+ + ++++  L Y+
Sbjct: 61  YGNEHEVGQGIQKWLEEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYI 120

Query: 107 DLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAV 166
           DL L+H P+     R                          ++T++ MQE    G  +++
Sbjct: 121 DLLLIHSPLSGTRRR--------------------------LETYKAMQEAVDEGIVRSI 154

Query: 167 GVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSAN 226
           GVSN+  ++I ELL     K  P  NQIEI P + + +L  +CK KG+VVEA+SP    +
Sbjct: 155 GVSNYGKHHIDELLTWKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--TH 212

Query: 227 APLLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
              LK   ++ +AK+ G +  +++I WS+Q GYV L KS + ER+  N K +
Sbjct: 213 GYKLKHPDVLLVAKETGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY 264

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  145 bits (367), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 146/271 (53%), Gaps = 46/271 (16%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGL 103
           G  HIDAA IY    E+G A+KD+  PR+EIFIT K    +Q   +P+ AL  SLK+LG+
Sbjct: 54  GVVHIDAAEIYRTYPELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGV 113

Query: 104 DYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKT 163
           DYVDLYL+H P+                 +++  +D++         W+ ++EL K+GK 
Sbjct: 114 DYVDLYLLHSPI-----------------IKESKLDVEA-------NWKYLEELYKSGKA 149

Query: 164 KAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSP 221
           K +GVSNF++ ++++LL     +V P  NQIE  P L      ++ F ++ GI++EAYSP
Sbjct: 150 KNIGVSNFAVKDLEKLLAVA--EVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSP 207

Query: 222 FGSANAPLLKE----------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI 271
            G    PL +           Q I +++KK+    AQ+++SW  +RG + +  S   ERI
Sbjct: 208 LG----PLQRRPEDADKLPFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERI 263

Query: 272 VSNFKI--FTLPEDDFKTISNLSKVHGTKRV 300
                I  F+L  ++ + I+ L   H   R+
Sbjct: 264 QQAQDIFSFSLANEEVQKITQLGLQHPALRL 294

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  144 bits (364), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 143/275 (52%), Gaps = 37/275 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL++G  +P LG GT+          V  ALKAGYRH+D A +Y NE EVG  ++     
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 69  --SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLG-LDYVDLYLMHWPVPLKTDRVT 123
                 R ++F TTKLW ++    + + A+ + L ++  L Y+D+ L+H P+     R  
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPLSGTRRR-- 128

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
                                   ++T++ MQE    G  +++GVSN+  ++I ELL   
Sbjct: 129 ------------------------LETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWE 164

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P + + +L  +CK KG+VVEA+SP    +   +K   ++ +A++ G
Sbjct: 165 ELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEVG 222

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
               Q++I WS+Q GYV L KS + ER+  N +++
Sbjct: 223 RNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY 257

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/289 (32%), Positives = 144/289 (49%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
                 R +IF TTKLW ++   R  +AA+ + L  + GL+Y+DL L+H P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
           +G+ L                   ++TW  MQE    G  K++GVSN+   +I ELL   
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             +  P  NQIEI P + + EL  +CK KG++VEA++P    +   +    ++ + K+  
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEVD 218

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
             P Q++I WS+Q GY+ L K+   +R+  N     F L ++  KT+ +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSDEQMKTLDH 267

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  145 bits (365), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/312 (32%), Positives = 158/312 (50%), Gaps = 57/312 (18%)

Query: 11  TLKL-NTGASIPVLGFGT---WRSVDNNG----------YHSVIAALKAGYRHIDAAAIY 56
           TL+L  +G  IP++GFG+   WR    +G             V +A+ AG+ HIDAA  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  LNEEEVGRAIKDSGVPREEIFITTKL--WGTEQRD---PEAALNKSLKRLGLDYVDLYLM 111
               EVGR +K+SGVPR++++IT K   W  + R    P  +L+ SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNF 171
           H                 +P +   T  ID KE      W  M+E+   G  K +GVSNF
Sbjct: 127 H-----------------VPFITVQTAGIDLKE-----AWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPL 229
            + +++ +  +   K +P  NQIE +  L Q    +IA+CK+  IVVE YSP      PL
Sbjct: 165 DVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPL----VPL 218

Query: 230 LK------EQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLP 281
            K      ++ +  +A+K+     Q+++ W  Q G VV+  S    R+  +  I  F L 
Sbjct: 219 TKGRPGPLDKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELT 278

Query: 282 EDDFKTISNLSK 293
            +DF +I+ + +
Sbjct: 279 AEDFDSITKIGR 290

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  144 bits (364), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 105/317 (33%), Positives = 154/317 (48%), Gaps = 56/317 (17%)

Query: 12  LKLNTGASIP---VLGFGT-WRSV---DNNGYHSVIAALKA-----GYRHIDAAAIYLNE 59
            KLN G  +P   ++G GT W  V   D N   +++  LK      G  H+DAA  Y+  
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGLDYVDLYLMHWPVPL 117
            EVGRA+ ++  PR+EIFIT K W   +   +P   L   LKRLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 118 KTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIK 177
                               +  +T  ++  + W +M+EL  +GK K +GVSNF+  +++
Sbjct: 125 --------------------ISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 178 ELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA- 234
            +L+    KV P  NQIE +  L      +  FCK+  I + AYSP G    PL K+ A 
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPAD 218

Query: 235 ---------IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPED 283
                    I  +A+ +   P Q+++ W  +RG V +  S   ERI    +IF   L +D
Sbjct: 219 GNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDD 278

Query: 284 DFKTISNLSKVHGTKRV 300
           +   I+ L   H   R+
Sbjct: 279 EVTEITKLGLDHEPLRL 295

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  142 bits (359), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 138/276 (50%), Gaps = 37/276 (13%)

Query: 14  LNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----- 68
            N G  IP +  GT+    +     V  ALKAGYRH D A +Y NE +VG  I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 69  -SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVTD 124
                R ++F TTKLW ++      + A+ + L ++ GL Y+D+ L+H P+  +T R   
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKR--- 126

Query: 125 GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPN 184
                                  ++TW  MQE  ++G  K +GVSN+   +++ELL+   
Sbjct: 127 -----------------------LETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 185 NKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
             + P  NQIEI P + + EL  +CK  G+VVEA++P    +   L +  ++ ++K+ G 
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221

Query: 245 EPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
              Q++I WS+Q GY+ L K+   +R+  N + +  
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  142 bits (358), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 92/290 (31%), Positives = 144/290 (49%), Gaps = 42/290 (14%)

Query: 14  LNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI------K 67
           L+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVTD 124
                RE+IF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        +
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL--------E 119

Query: 125 GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPN 184
           G+ L                   ++TW+ MQE    G  K++GVSN+   +I ELL  P+
Sbjct: 120 GSKL------------------RLETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPD 161

Query: 185 NKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
               P  NQIEI P + + EL  +CK KG++VEA++P    +   +    ++ + K+   
Sbjct: 162 LTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKEVDR 219

Query: 245 EPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKV 294
            P Q++I WS+Q GY+ L K+   +R+  N   +     DF+ +    K+
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAY-----DFELLDKQMKI 264

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  141 bits (356), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 92/288 (31%), Positives = 144/288 (50%), Gaps = 39/288 (13%)

Query: 14  LNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----- 68
           L+ G  IP L  GT+    +   + V  ALK GYRH D A +Y NE +VG  I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVTD 124
                RE++F TTKLW ++   +  + A+ + L+++  L Y+DL L+H P+     R   
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKR--- 125

Query: 125 GNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPN 184
                                  ++T++ MQE    G  K++GVSN+  ++++ELL    
Sbjct: 126 -----------------------LETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 185 NKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGV 244
            K  P  NQIEI P   + EL  +C+ +GIVVE Y+P    +   LK+  ++ +A++ G 
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVGK 220

Query: 245 EPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
              Q++I WS+Q GY+ L K+ N +R+  N  +  F L E   K   +
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQIKAFEH 268

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  141 bits (356), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 149/310 (48%), Gaps = 57/310 (18%)

Query: 15  NTGASIPVLGFGT---WRSVDNNG----------YHSVIAALKAGYRHIDAAAIYLNEEE 61
            T   IPVLGFGT   WR     G             ++ A+  G+ HID A  YL  EE
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGRAIKDSGVPREEIFITTKL----W-GTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVP 116
           VG A++ S +PR+++FIT K     W G +   P  A  K L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRPDI 132

Query: 117 LKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
            K               E+  +D+        + W  ++EL + G  KA+GVSNF +  +
Sbjct: 133 TK---------------ENAGIDLQ-------EAWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLK--- 231
           K++      + +P  +Q+E HP L      ++ +C+ K IVVEAYSP     APL +   
Sbjct: 171 KQM--ESYCRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APLFRARP 224

Query: 232 ---EQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFK 286
              +  + ++ KK+G    Q+++ W I RG V L  S   ERI        F L + D +
Sbjct: 225 GPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVE 284

Query: 287 TISNL-SKVH 295
            I+ + SK H
Sbjct: 285 LINEVGSKKH 294

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (354), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 90/289 (31%), Positives = 143/289 (49%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           K + G  +P +  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRL-GLDYVDLYLMHWPVPLKTDRVT 123
                 RE++F TTKLW ++   +  + A+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
           +G+ L                   ++TW+ MQE    G  K++GVSN+   ++ ELL   
Sbjct: 119 EGSKL------------------RLETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K  P  NQIEI P + + EL  +CK K +VVEA++P    +   + +  ++ + K+  
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEVD 218

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTISN 290
             P Q++I WS+Q GY+ L K+   +R+ SN     F L +D  K + +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  141 bits (356), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 147/289 (50%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----K 67
           +L+ G  IP +G G ++  +      V  AL+ GYR  D+A  Y NE+ V R I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGVPREEIFITTKLWGTEQRDPEA---ALNKSLKRLG-LDYVDLYLMHWPVPLKTDRVT 123
             G  RE+++ TTK+  T+    EA   +L KSL   G L Y+DL L+H P+  +T R  
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRR-- 130

Query: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183
                                   + TW+ ++E    G+ +++GVSN+   ++ ELL   
Sbjct: 131 ------------------------LGTWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWE 166

Query: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243
             K+ P  NQ+EI+P L + EL+ +C+E  I V+A+SP        L +  +  +A ++ 
Sbjct: 167 GLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYD 224

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLS 292
              AQ+++ WSIQ G++VL K+   ER+  NF I+   E   +T+S L+
Sbjct: 225 KGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIWDF-ELSAETMSELT 272

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  139 bits (351), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/307 (31%), Positives = 147/307 (47%), Gaps = 56/307 (18%)

Query: 15  NTGASIPVLGFGT---WRSVDNNG----------YHSVIAALKAGYRHIDAAAIYLNEEE 61
            +G  +PV+GFG+   WR     G             V  A+KAG+ HIDAA  Y    E
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGRAIKDSGVPREEIFITTKL--WG---TEQRDPEAALNKSLKRLGLDYVDLYLMHWPVP 116
           VG  I +SGVPRE++++T K   W     + + P  +L  SL ++ + YVDLYL+H    
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVH---- 127

Query: 117 LKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
                        +P +   T  ID KE      W  M+E+   G  K +GVSNF + ++
Sbjct: 128 -------------VPFINPETAGIDLKE-----AWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLK--- 231
           + +      K  P  NQIE    + Q    +I++CK+ GI +E YSP      PL K   
Sbjct: 170 EYI--RTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPL----VPLTKGKP 223

Query: 232 ---EQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFK 286
              +  +  MAKK+G    Q+++ W +Q G + +  S   +RI  +  I  F L  +DF 
Sbjct: 224 GPLDDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFT 283

Query: 287 TISNLSK 293
           +I+ + K
Sbjct: 284 SITEVGK 290

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  137 bits (346), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 157/311 (50%), Gaps = 54/311 (17%)

Query: 14  LNTGASIP---VLGFGT-W---RSVDNNGYHSVIAALKA-----GYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W      D      ++  LK      G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQR---DPEAALNKSLKRLGLDYVDLYLMHWPVPLK 118
           V  A+++S  PR+EIFIT K + T+ +   DP A LN SLK LGLDYVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
              + +G+     TLE+               W+ M++L K+GK K +GVSNF + ++++
Sbjct: 126 ---IKNGS-----TLEE--------------CWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGS----ANAPLLK- 231
           +L+     + P  NQIE +  L      ++ FCKE  I +EAY+P G      + P  K 
Sbjct: 164 ILKIAT--IKPQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKP 221

Query: 232 -EQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFKTI 288
               I +++KK+    AQ+++ W  +RG + +  S  P+R+    N   F L   +   I
Sbjct: 222 FYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDKI 281

Query: 289 SNLS-KVHGTK 298
           + L  K+  T+
Sbjct: 282 TELGLKLKATR 292

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  136 bits (342), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 105/316 (33%), Positives = 164/316 (51%), Gaps = 58/316 (18%)

Query: 14  LNTGASIP---VLGFGT--WRSVDNNGYHS------VIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   ++G GT  +++V+ +   S      ++ AL+  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQR---DPEAALNKSLKRLGLDYVDLYLMHWPVPLK 118
           VG+A+  +  PR+EIF+T K + T+ +    P A L  SLK++G DYVDLYL+H P   K
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFVSK 128

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
                + N     TLE+               W+ M++L K GK K +GVSNF++ ++++
Sbjct: 129 -----EANGF---TLEEA--------------WKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA-- 234
           +L+    +V P  NQIE  P L      +  FC++  I++EAYSP     APL K+ A  
Sbjct: 167 ILKIA--EVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPL----APLQKKTAQD 220

Query: 235 --------IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDD 284
                   + ++++K+    AQ+I+ W  +RG + +  S  P+RI    N   F L +++
Sbjct: 221 DSKPFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEE 280

Query: 285 FKTISNLSKVHGTKRV 300
              I+ L   H   R+
Sbjct: 281 VDEITELGLAHEPLRL 296

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  135 bits (340), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 109/326 (33%), Positives = 158/326 (48%), Gaps = 60/326 (18%)

Query: 12  LKLNTGASIP---VLGFGT-W-------RSVDNNGYHSVIAALK-AGYRHIDAAAIYLNE 59
             LN G  IP   ++G GT W        +  +     +  AL   G  HIDAA  Y   
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTEQR---DPEAALNKSLKRLGLDYVDLYLMHWPVP 116
            E+ +A+K+S  PR EIFIT K + T+ +   DP   LN  LK LGLDYVDLYL+H P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSPF- 125

Query: 117 LKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
              D    G++    TLE              K W+ M+ L K GK K++GVSNFS+ NI
Sbjct: 126 --FDPEFKGSL----TLE--------------KVWKDMETLYKEGKAKSIGVSNFSVKNI 165

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKE-- 232
           +E+L+     + P  NQIE +  L      ++ +C++  I +EAYSP G    PL K   
Sbjct: 166 EEILKIAG--IKPQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPE 219

Query: 233 --------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIV--SNFKIFTLPE 282
                     I ++A K+G   +Q++++W   RG + +  S   +RI+   N   F L +
Sbjct: 220 NSNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTK 279

Query: 283 DDFKTISNLSKVHGTKRVVDMKWGSF 308
           D+  T++ L       R+    W +F
Sbjct: 280 DEVDTLTKLGLEQPALRIY---WTNF 302

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 99/314 (31%), Positives = 159/314 (50%), Gaps = 50/314 (15%)

Query: 12  LKLNTGASIP---VLGFGT-WR-------SVDNNGYHSVIAALK-AGYRHIDAAAIYLNE 59
           + LN G  IP   ++G GT W        +  N+    ++ ALK  G  HIDAA IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  EEVGRAIKDSGVPREEIFITTKLWGTE---QRDPEAALNKSLKRLGLDYVDLYLMHWPVP 116
            EVG+A+  +  PR EIF+T K + T+      P   L+ +LK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 117 LKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
               + T+G      TLE+               W+ M++L ++GK K +GVSNF++ ++
Sbjct: 126 --VSKETNGF-----TLEEA--------------WKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA 234
           + +L+    ++ P  NQIE  P L      +  FC+E  I++EAYSP G       K+++
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDES 222

Query: 235 ------IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFK 286
                 + ++++K+    AQ+ + W  +RG + +  S  P+RI    N   F L +++  
Sbjct: 223 LPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVN 282

Query: 287 TISNLSKVHGTKRV 300
            I+ L   H   R+
Sbjct: 283 QITELGLEHEPLRL 296

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/326 (32%), Positives = 154/326 (47%), Gaps = 65/326 (19%)

Query: 8   SSATLKLNTGASIP---VLGFGT-WRS------------VDNNGYHSVIAALKAGYRHID 51
           S     LN G  IP   ++G GT W              VD   Y    A    G  HID
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQY----ALTLPGIIHID 59

Query: 52  AAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQR---DPEAALNKSLKRLGLDYVDL 108
           AA +Y    EV +A+K +   R+EIFIT K +    +   +P A L KSLK L LDYVDL
Sbjct: 60  AAEMYNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDL 119

Query: 109 YLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGV 168
           YL+H P   K          C  T+E+               W+ M++L K GK K +GV
Sbjct: 120 YLLHSPFITKES--------CGYTMEEA--------------WKQMEKLYKDGKAKNIGV 157

Query: 169 SNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSAN 226
           SNFS++++K +L+    ++ P  NQIE +  L      ++ FC++  I+VEAYSP G   
Sbjct: 158 SNFSVDDLKRILKI--CEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLG--- 212

Query: 227 APLLKE----------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSN 274
            PL K+          Q I ++AKK+G    Q+++ W  +R  + +  S   ERI    +
Sbjct: 213 -PLRKKPTDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQD 271

Query: 275 FKIFTLPEDDFKTISNLSKVHGTKRV 300
              F L  ++ + I+ L   H   R+
Sbjct: 272 LFSFDLTSEEVEKITKLGLAHEPSRL 297

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  131 bits (330), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 152/311 (48%), Gaps = 57/311 (18%)

Query: 11  TLKLNTGASIPVLGFGT---WRSVDNNG-----YHSVIA-----ALKAGYRHIDAAAIYL 57
           TLK  +G  +P +GFG+   WR   ++G     Y   +A     A++ G+ HID A  Y 
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 58  NEEEVGRAIKDSGVPREEIFITTKL--WGTEQRD---PEAALNKSLKRLGLDYVDLYLMH 112
             +EVG  I ++ VPRE ++IT K   W  E R    P  +L  SLK + LDYVDLY++H
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 113 WPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFS 172
                            +P +   T  ID KE      W  M+E+      + +GVSNF 
Sbjct: 129 -----------------VPNITTKTAGIDLKE-----AWLQMEEIYTRKMARNIGVSNFD 166

Query: 173 INNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLL 230
           + ++ E ++S   K  P  NQIE    + Q    ++ +C+E  IVVE YSP      PL 
Sbjct: 167 VESL-EYIKS-FAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPL----VPLT 220

Query: 231 K------EQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPE 282
           K      ++ +  +A K+G    Q+++ W  Q G VV+  +   ER+  +  I  F L +
Sbjct: 221 KGKPGPLDEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSK 280

Query: 283 DDFKTISNLSK 293
           +DF  I+N+ +
Sbjct: 281 EDFDQITNVGR 291

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  129 bits (324), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 100/315 (31%), Positives = 152/315 (48%), Gaps = 56/315 (17%)

Query: 14  LNTGASIP---VLGFGT-WR-------SVDNNGYHSVIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   ++G GT W        +  N+    ++ ALK  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQRD--PEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
           VG+A+  +  PR  IF+T K     +    P   L+ +LK++G DYVDLYL+H P     
Sbjct: 70  VGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF---- 125

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
                             V  +    +  + W+ M++L K+GK K +GVSNF++ +++ +
Sbjct: 126 ------------------VSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRI 167

Query: 180 LESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           L+    +V P  NQIE  P L      +  FC+E  I+VEAYSP G    PL K+ A   
Sbjct: 168 LKVA--EVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLG----PLQKKTAQDD 221

Query: 235 -------IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDF 285
                  + ++++K+    AQ+I+ W  +RG + +  S  P+RI    N   F L  ++ 
Sbjct: 222 SQPFFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEV 281

Query: 286 KTISNLSKVHGTKRV 300
             I+ L   H   R+
Sbjct: 282 DKITELGLEHEPLRL 296

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 150/315 (47%), Gaps = 48/315 (15%)

Query: 5   LKNSSATLKLNTGASIP---VLGFGT-W---RSVDNNGYHSVIAALK-----AGYRHIDA 52
           + ++ A + LN G  +P   ++G GT W   +  D+   H +I  L+      G  HIDA
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 53  AAIYLNEEEVGRAIKDSGVPREEIFITTK--LWGTEQRDPEAALNKSLKRLGLDYVDLYL 110
           A +Y    E+  A++ +  PR EIFIT K  L     +DP A L  SLK   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 111 MHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSN 170
           +H P   K             TLE                W  M++L K GK K +GVSN
Sbjct: 121 LHSPFVAKEKPGL--------TLEGA--------------WRQMEQLYKDGKAKNIGVSN 158

Query: 171 FSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAP 228
           FS+ ++K +L     ++ P  NQIE HP L      ++ FC+++ I +EA++P G     
Sbjct: 159 FSVEDLKRVLSVA--EIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVK 216

Query: 229 LLKEQ------AIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTL 280
             +++       I  ++ K+    AQ+I+ W  +RG + +  S   +RI    N   F L
Sbjct: 217 TQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDL 276

Query: 281 PEDDFKTISNLSKVH 295
            +++   I+ L   H
Sbjct: 277 EDEEVTKITRLGLQH 291

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  126 bits (316), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 97/311 (31%), Positives = 146/311 (46%), Gaps = 48/311 (15%)

Query: 14  LNTGASIP---VLGFGT-W---RSVDNNGYHSVIAALK-----AGYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W      D N  H+++  ++      G  H+D A +Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGLDYVDLYLMHWPVPLKT 119
              A+K++  PR EIF+T K    E+   DP   L+  LKR GL+YVDLYL+H P   K 
Sbjct: 70  FSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK- 128

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
               + N   I                  + W  ++EL   GK K +GVSNF + +++++
Sbjct: 129 ----EKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 180 LESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           L+    KV P  NQIE    L      ++ F ++  I +EAY+P G  +     EQA   
Sbjct: 168 LKVA--KVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPF 225

Query: 235 ---IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFKTIS 289
              I  + +K+    AQ+++ W  +RG + +  S  P+RI    N   F L +D+   I+
Sbjct: 226 YDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEIT 285

Query: 290 NLSKVHGTKRV 300
            L   H   R+
Sbjct: 286 KLGLAHPALRL 296

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 142/274 (51%), Gaps = 48/274 (17%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSG--VPREEIFITTKLWGTEQR---DPEAALNKSLKR 100
           G  HIDAA +Y    EVG+A+++S    PR+EIFIT K + T+ +   +P   L   LK+
Sbjct: 55  GIVHIDAAEVYRTYPEVGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKK 113

Query: 101 LGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKT 160
           LGLDYVDLYL+H P               I   ++G        +   + W+ M++L K 
Sbjct: 114 LGLDYVDLYLLHSPF--------------ISKEKNG--------FTMEEAWKYMEDLYKA 151

Query: 161 GKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEA 218
           GK K +GVSNFS+ +++ +L+S   +V P  NQIE +  L      ++ FC+E  I V A
Sbjct: 152 GKVKNIGVSNFSMADLQRILKSC--EVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVA 209

Query: 219 YSPFGSANAPLLKE----------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNP 268
           Y+P G    PL ++          + +  +A+K+    AQ+++ W  +RG + +  S   
Sbjct: 210 YTPLG----PLQRKSKNFEQENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKE 265

Query: 269 ERIVSNFKIFT--LPEDDFKTISNLSKVHGTKRV 300
           +RI     +FT  L + + + I+ L   H  +R+
Sbjct: 266 KRIKDAQYLFTFDLTDSEVEKITQLGLKHEPQRM 299

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 92/312 (29%), Positives = 154/312 (49%), Gaps = 44/312 (14%)

Query: 8   SSATLKLNTGASIP---VLGFGT-WRSVDNNGYHS------VIAALK-AGYRHIDAAAIY 56
            ++ + LN G  IP   ++G GT W   +    +S      +  AL+  G  HID A +Y
Sbjct: 4   QTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMY 63

Query: 57  LNEEEVGRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGLDYVDLYLMHWP 114
               EVG A+++S  PR+EIFIT K     +   +P+  L  +L+++GL+YVDLYL+H+P
Sbjct: 64  QTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP 123

Query: 115 VPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSIN 174
           +               P L D T++         + W++M++L   G  K +GVSNF + 
Sbjct: 124 I-------------IDPKLYDFTLE---------EAWKMMEDLYNEGLAKNIGVSNFRVE 161

Query: 175 NIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYS---PFGSANAPL 229
           ++++L  S +  + P  NQIE +  L      +  +C +  I +EA+    P    N   
Sbjct: 162 DLEQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKD 219

Query: 230 LKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFKT 287
           L    +  +A+K+     Q+++ W  QR  + +  S  PER+   + IF+  L +D+ + 
Sbjct: 220 LLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVEF 279

Query: 288 ISNLSKVHGTKR 299
           I+ L   H T R
Sbjct: 280 ITKLGSQHDTIR 291

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  124 bits (312), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 95/313 (30%), Positives = 160/313 (51%), Gaps = 54/313 (17%)

Query: 14  LNTGASIP---VLGFGT-W---RSVDNNGYHSVIAALK-----AGYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W      ++N    ++  +K      G  H+DAA  Y   +E
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQRDPEA--ALNKSLKRLGLDYVDLYLMHWPVPLKT 119
           +G+A+++S  PR+EIFIT K   T +            +K++G+DYVDLYL+H P+    
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL---I 145

Query: 120 DRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL 179
           ++  +G      TLE+               W+ +++L + GK K +GVSNF + +++ +
Sbjct: 146 EKEKNG-----VTLEE--------------VWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 180 LESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFGSANAPLLKEQA--- 234
           L+    KV P  NQIE H  L      ++ F ++  I +EAY+P G    PL ++Q+   
Sbjct: 187 LKVA--KVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDAG 240

Query: 235 -----IIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFKT 287
                + ++AKK+G   AQ+++ W  +R  + +  S  P+RI +   +F+  L +++ K 
Sbjct: 241 DFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKK 300

Query: 288 ISNLSKVHGTKRV 300
           I+ L   H   R+
Sbjct: 301 ITELGLKHKPLRL 313

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  123 bits (308), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 102/314 (32%), Positives = 153/314 (48%), Gaps = 54/314 (17%)

Query: 14  LNTGASIP---VLGFGT-WRSVDNNG-------YHSVIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W   + N           V  AL   G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREEIFITTKLWGTEQR---DPEAALNKSLKRLGLDYVDLYLMHWPVPLK 118
           +G+A++++  PR EI+IT K + T  +   +P       LK LG+DY+DLYL+H P    
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF--- 125

Query: 119 TDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKE 178
              +T+G      TLE              + W+ ++EL K+GK K +GVSNF+  +++ 
Sbjct: 126 ---ITEGRNGF--TLE--------------QAWKYLEELYKSGKAKNIGVSNFAKEDLER 166

Query: 179 LLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSPFG--------SANAP 228
           +L+    ++ P  NQIE    L      +  F KE  I++EAYSP G        + + P
Sbjct: 167 ILKIA--EIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLP 224

Query: 229 LLKEQAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFK 286
             K   I ++A+K+G   AQ+++ W  +RG + +  S  P R+     IFT  L   + +
Sbjct: 225 FYK--YINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVE 282

Query: 287 TISNLSKVHGTKRV 300
            I+ L   H   R+
Sbjct: 283 KITELGLKHEALRL 296

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  120 bits (302), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 139/277 (50%), Gaps = 45/277 (16%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGL 103
           G  H+DAA  Y    E+ +A+K+S  PR EIFIT K     +   +P  ALN +L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 104 DYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKT 163
           DYVDLY++H+P                        D + K+ +    W  M+ L K GK 
Sbjct: 113 DYVDLYVLHFP----------------------EFDPEYKDLSIETAW--MELLYKEGKA 148

Query: 164 KAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAYSP 221
           K +GVSNFSI +++ +++  +  V P  NQIE +  L      ++ +C++ G  +EAYSP
Sbjct: 149 KNIGVSNFSIEHLERVMKIAD--VKPQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSP 206

Query: 222 FGSANAPLLKE----------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKSVNPERI 271
                APL ++          + I +++ K+G   +++++ W  +RG V +  S   ERI
Sbjct: 207 L----APLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERI 262

Query: 272 VSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKWGSF 308
           V+   +F+    D + +  ++K+   +  + + W  F
Sbjct: 263 VNAQNLFSFDLTD-EEVDKITKLGLEQPALRLYWNEF 298

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  103 bits (257), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 92/311 (29%), Positives = 139/311 (44%), Gaps = 52/311 (16%)

Query: 14  LNTGASIPVL---GFGT-WRSVD--NNGYHSVIAALKA-----GYRHIDAAAIYLNEEEV 62
           LN G SIP +   G G  W  +    +G  +++  LK      G+ HI  A  Y N   +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 63  GRAIKDSGVPREEIFITTKLWGTEQ--RDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120
             A+K S  PR EI+IT K     +    P  AL +SL RLG DYVDLYL+H P      
Sbjct: 71  SAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP------ 124

Query: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180
                   C+ +  +G         +  K W+ M+ L KTGK K +GVSNF I +++ L 
Sbjct: 125 --------CLDSSPNGI--------SLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERLK 168

Query: 181 ESPNNKVVPATNQIEIHPLLPQD--ELIAFCKEKGIVVEAYSPF--------GSANAPLL 230
           ++   ++ P  N+IE H  L      +  + K   +++  YSP            + P  
Sbjct: 169 DA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPFY 225

Query: 231 KEQAIIDMAKKHGVEPAQLIISWSIQRGY--VVLAKSVNPERIVSNFKIFTLPEDDFKTI 288
           +   II +A+K+    AQ+++ W    G   V+    V   +  S+   F L  ++   I
Sbjct: 226 R--YIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMI 283

Query: 289 SNLSKVHGTKR 299
           + L K H   R
Sbjct: 284 TELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W
          - Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 71.2 bits (173), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 4/84 (4%)

Query: 7  NSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
          N     KLN G  IPV+GFG +     +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8  NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 67 K----DSGVPREEIFITTKLWGTE 86
          +    ++G  RE I+ TTKLW ++
Sbjct: 68 RKYLDETGEARENIWFTTKLWDSQ 91

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 91/209 (43%), Gaps = 40/209 (19%)

Query: 22  VLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTK 81
           + G  T+  + N   + ++  LKAG + ID A IY + E   +AI +  +P +   I TK
Sbjct: 4   IYGGYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTK 59

Query: 82  LWGTE----QRDP-EAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDG 136
             G       RD    ++ +SL  LG+  V+ +L+H P P             IP  E  
Sbjct: 60  ASGFSGGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP------------EIPLEE-- 105

Query: 137 TVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNK--VVPATNQI 194
                        T + +  L + GK +  G+SNFS  ++K + +   +K  V+P   Q 
Sbjct: 106 -------------TLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQG 152

Query: 195 EIHPLLPQ--DELIAFCKEKGIVVEAYSP 221
             + L     ++L    KE  I + AYSP
Sbjct: 153 NYNALSRAIVNDLFPLLKELHISLYAYSP 181

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 86/192 (44%), Gaps = 37/192 (19%)

Query: 46  GYRHIDAAAIYLNE-EEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAAL----NKSLKR 100
           G   I A+ IY     EVG A+  +  P+ EIF+T K   + Q +  A L    + +LK+
Sbjct: 5   GVIDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKK 62

Query: 101 LGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKT 160
           + ++YVD++ +H P   K       NVL    L+D  +  D               L ++
Sbjct: 63  ISVEYVDMHFLHSPFVFK-----QANVL---NLKDA-MHTD--------------HLRRS 99

Query: 161 GKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEA 218
            K    G S+ ++  ++ +L++ + +  P  NQI++   L      +   C+E  I++  
Sbjct: 100 NKANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSLRNQTPGISKLCQENDILMAV 157

Query: 219 YS---PFGSANA 227
           YS   P    NA
Sbjct: 158 YSTLDPLQRKNA 169

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 95/216 (43%), Gaps = 43/216 (19%)

Query: 18  ASIPVLGFGTW--RSVDNNGYHSVIAALKA-GYRHIDAAAIYLNEEEVGRAIKDSGVPRE 74
           A +P + +G +   ++  + +  + + L+  G    D A IY   E   ++I D G+  +
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSE---KSIGDLGIA-D 57

Query: 75  EIFITTKLWGTEQ----RDP-EAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLC 129
           ++ I TK    E+    RD    ++ +S   L +D V++Y +H P P+            
Sbjct: 58  DLVIDTKARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLHAPDPI------------ 105

Query: 130 IPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNK--V 187
            P  E               T + + EL K GK K  G+SN++ +++K++ E   +K  V
Sbjct: 106 TPIEE---------------TIDAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYV 150

Query: 188 VPATNQIEIHPLLP--QDELIAFCKEKGIVVEAYSP 221
           +P   Q   +      + +L    ++ GI   AYSP
Sbjct: 151 LPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSP 186

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/253 (23%), Positives = 107/253 (42%), Gaps = 68/253 (26%)

Query: 42  ALKAGYRHIDAAAIYLNEEEV-GRAIKD--SGVPREEIFITTKL-------WGTEQRDPE 91
           A+  G   ID +  Y   E + G+A+++     PREE FI TK+       +   + +  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  AALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTW 151
            ++ +S +RL  DY+DL  +H                          DI+  E++  K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH--------------------------DIEYVEYD--KIW 141

Query: 152 ELMQELPK---TGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAF 208
           E ++EL K    G  + +G+S + ++ +  L  S     VP     EI PL   D ++++
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLSY 191

Query: 209 CK--EKGIVVEAYSP--FGSANAPLLKEQAIIDMA--------KKHGVEP-----AQLII 251
           C    + +V+E      F  +N  ++   +++ M+        K H   P     AQ  I
Sbjct: 192 CNLTLQSVVLEKEGDRFFKESNIKVVSNGSVVCMSLLRSKGTIKDHPCSPELLECAQKSI 251

Query: 252 SWSIQRGYVVLAK 264
            ++ + G   LA+
Sbjct: 252 KYAAENGIPELAE 264

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 36.6 bits (83), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 253 WSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK 286
           WS  +G+VVL KS NPERI  N  +    +D +K
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLPSKDDSWK 35

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 81/207 (39%), Gaps = 40/207 (19%)

Query: 44  KAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTE-----QRDPEAALNKSL 98
           KAG + ID A IY + E++   I +  +P     I TK  G       + +   ++ +SL
Sbjct: 31  KAGVKDIDTARIYPDSEKI---IGELQLPNR-FTIHTKASGFSGGCLTKDNINKSIEESL 86

Query: 99  KRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELP 158
             LG+  V+ + +H P P                           E    +T   +  L 
Sbjct: 87  SLLGVPSVETFFLHSPDP---------------------------ETPIEETLGAINSLY 119

Query: 159 KTGKTKAVGVSNFSINNIKELLESPNNK--VVPATNQIEIHPLLP--QDELIAFCKEKGI 214
           + GK K  G+SNF+  ++K + E   +K  V+P   Q   +      +++L    +E   
Sbjct: 120 EQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHF 179

Query: 215 VVEAYSPFGSANAPLLKEQAIIDMAKK 241
              AYSP          EQ + D + +
Sbjct: 180 SFYAYSPIAGGFLAKTPEQVLGDKSGR 206

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 38.5 bits (88), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 67/306 (21%), Positives = 106/306 (34%), Gaps = 95/306 (31%)

Query: 20  IPVLGFGT-----WRSVDNNGYHSVIA-ALKAGYRHIDAAAIYLNEEE---VGRAIKDSG 70
           I  + FG+     W   D      ++  A   G R  D A +Y N E    +G  +K+  
Sbjct: 21  IGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEIILGEFLKNYK 80

Query: 71  VPREEIFITTKLWGTEQRD---------PEAALNK-----------------SLKRLGLD 104
           +PRE + I TKL+     +         PEA LN                  S++RLG  
Sbjct: 81  IPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGT- 139

Query: 105 YVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTK 164
           Y D+  +H   P                        DT    F +T   + ++   G T+
Sbjct: 140 YADIIQIHRADP------------------------DTP---FEETMRALNDIVVDGLTR 172

Query: 165 AVGVSNFSINNIKEL-LESPNNKVVPATNQIEIHPLLPQD---ELIAFCKEKGIVVEAYS 220
            +G S+       E+   +  N      N    + LL ++   ELI F K   I +  +S
Sbjct: 173 YIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWS 232

Query: 221 PF---------GSANAPLLKEQ-------------------AIIDMAKKHGVEPAQLIIS 252
           P          G  +    K+Q                    + ++AKK   + A + + 
Sbjct: 233 PLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALY 292

Query: 253 WSIQRG 258
           W IQ+G
Sbjct: 293 WVIQKG 298

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 74/182 (40%), Gaps = 38/182 (20%)

Query: 48  RHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKR----LGL 103
             +D A IY   EE   AI    +P+  I  T      E    + ++N+S++     LG+
Sbjct: 35  EELDTARIYPGSEE---AIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGV 91

Query: 104 DYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKT 163
           + V+++ +H P P              P  E               T + +  L K GK 
Sbjct: 92  ESVEIFYLHCPDP------------ATPLEE---------------TLDAIDALYKEGKF 124

Query: 164 KAVGVSNFSINNIKELLESPNNK--VVPATNQIEIHPLLPQDE--LIAFCKEKGIVVEAY 219
           K  GVSNFS  +++++      K  V+P   Q   + +  + E  L    +E G+   AY
Sbjct: 125 KKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLRELGLSFYAY 184

Query: 220 SP 221
           SP
Sbjct: 185 SP 186

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 65/290 (22%), Positives = 111/290 (38%), Gaps = 48/290 (16%)

Query: 46  GYRHIDAAAIY---LNEEEVGRAIKDSGVPREEIFITTKLWG--TEQRDPEAALNKSLKR 100
           G R  D A +Y   L+E  +G  +K   + RE + I TK++    E  D     N + +R
Sbjct: 53  GLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDLHHG-NSTNER 111

Query: 101 LGLDYVD---LYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQEL 157
             LD V+   L   H    +K      G    I  L+   +D DT +   ++    + ++
Sbjct: 112 NALDLVNQNGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA---LNDV 166

Query: 158 PKTGKTKAVGVSNFSINNIKELLESPNN----KVVPATNQIEIHPLLPQDELIAFCKEKG 213
              G  + +G S+       EL  +       K V + +   +     + ELI FCK+ G
Sbjct: 167 IVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELIPFCKKHG 226

Query: 214 IVVEAYSP--FGSANAPLLKE--------------------------QAIIDMAKKHGVE 245
           + +  +SP   G    PL ++                          + +  +A K  + 
Sbjct: 227 VGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIVRRVEHLAAKKNIS 286

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF--TLPEDDFKTISNLSK 293
            A L I+W++ +G   +    + ER+    K     L EDD K +    K
Sbjct: 287 MAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYLEETYK 336

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 61/268 (22%), Positives = 108/268 (40%), Gaps = 49/268 (18%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLG 102
           G R  D A +Y N   E  +G  +K   + RE + I +K++     D    L++  K + 
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIFFPV--DESLDLHQGSK-VD 109

Query: 103 LDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKT-- 160
            +Y+DL L  +   L    +  G    +  L  GT  ID  + + +     M+E+ ++  
Sbjct: 110 QEYIDLQL-SFQQGLNRKHIMAGVANSVERL--GTY-IDILQIHRLDKEASMEEIMRSLN 165

Query: 161 -----GKTKAVGVSNFSINNIKEL-LESPNNKVVPATNQIEIHPLL---PQDELIAFCKE 211
                G+ + +G S+       EL   +  N      N    + +L    ++ELI FCK+
Sbjct: 166 DVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELIPFCKK 225

Query: 212 KGIVVEAYSP--FGSANAP-------LLKEQAIIDM-------------------AKKHG 243
            G+ +  +SP   G    P       +L +   I M                   AKK G
Sbjct: 226 HGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEAIAKKKG 285

Query: 244 VEPAQLIISWSIQRGYVVLAKSVNPERI 271
           +  A + ++W + +G   +A   + ER+
Sbjct: 286 ISMAMVSMAWILNKGANAIAGLNSIERV 313

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 35.4 bits (80), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 114/289 (39%), Gaps = 55/289 (19%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREEIFITTKLWG--TEQRDPEAALNKSLKR 100
           G R  D A +Y N   E  VG  +K   + RE + I TK++    E  D     N + + 
Sbjct: 53  GLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIFFPVDESLDLHHGSNVNQEA 112

Query: 101 LGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKT 160
           + L       +     L    + DG    +  L  GT  ID  + + +     M+E+ ++
Sbjct: 113 MELQ------LTLQRGLSRKHIIDGVANSVERL--GTY-IDVLQIHRLDEETSMEEIMRS 163

Query: 161 -------GKTKAVGVSNFSINNIKEL--LESPNN--KVVPATNQIEIHPLLPQDELIAFC 209
                  G+ + +G S+       EL  +   N   K + A +   +     + ELI FC
Sbjct: 164 LNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQSYYNLINREDERELIPFC 223

Query: 210 KEKGIVVEAYSP--FGSANAPLLK--EQAIID------------------------MAKK 241
           K+ G+ +  +SP   G    P+ K  E+ + D                        +A++
Sbjct: 224 KKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDDEKEIVRRIQMVAER 283

Query: 242 HGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKTI 288
             V  A + ++W++ +G   +    + ER+    K   FTL ED+ K +
Sbjct: 284 RSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEIKLL 332

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 10/81 (12%)

Query: 42  ALKAGYRHIDAAAIYLNEE-EVGRAIKDSG--VPREEIFITTKL-------WGTEQRDPE 91
           A + G   ID +  Y N E  +G+A+ + G   PR+   I TK+       +     +  
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 92  AALNKSLKRLGLDYVDLYLMH 112
            ++ +S KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 54/140 (38%), Gaps = 43/140 (30%)

Query: 15  NTGASIP-----VLGFGT-----WRSVDNNGYHSVI-AALKAGYRHIDAAAIYLNEEE-- 61
           NTG  I       + +G+     W   D N    ++  A  +G R  D A  Y N +   
Sbjct: 11  NTGLKISPIIVGCMSYGSKDWHPWIIEDKNEVFKILKTAYDSGLRTFDTADGYSNGQSEI 70

Query: 62  -VGRAIKDSGVPREEIFITTKLW----------------------------GTEQRDPEA 92
            +G  +K+  +PRE + I TK+W                            G  ++    
Sbjct: 71  LLGEFLKEYEIPRETVIIMTKVWAPVDSSLEGFQRTGPMNEDQKVHFANQQGLSRKHIIE 130

Query: 93  ALNKSLKRLGLDYVDLYLMH 112
           A   S++RLG  Y+D+Y +H
Sbjct: 131 ACKNSVRRLGT-YIDVYQIH 149

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 40/207 (19%), Positives = 87/207 (42%), Gaps = 46/207 (22%)

Query: 44  KAGYRHIDAAAIYLNEEE-VGRAIKDSGVPREEIFITTKL-------WGTEQRDPEAALN 95
           +  +  +D +  Y + E  VG+A+++  +PR EI++ TK+       +   + +   ++ 
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVM 97

Query: 96  KSLKRLGLDYVDLYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQ 155
           +S++RL                    V +G  L +  L D  V+   +E       EL Q
Sbjct: 98  RSVERL--------------------VGEGGYLDVVYLHD--VEFQPQEACLAALDEL-Q 134

Query: 156 ELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCK---EK 212
           +L + G  + VGVS + ++ +  L+    +   P             D ++++C    + 
Sbjct: 135 KLKRAGIVRNVGVSGYPLSKLYSLVSLCYDAGTPL------------DCVLSYCHMNLQN 182

Query: 213 GIVVEAYSPFGSANAPLLKEQAIIDMA 239
            ++ E Y+ F S     +   +++ M+
Sbjct: 183 VMLEEYYAKFKSKGVQHVVNASVLSMS 209

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 78/194 (40%), Gaps = 16/194 (8%)

Query: 39  VIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSL 98
           VI  L     H+D A      ++V  AI D       I     +W  + +   A +NK++
Sbjct: 262 VIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGIVDGRNIWKNDFKKSSAFVNKAI 321

Query: 99  KRLGLDYVDL----YLMHWPVPLKTDRVTDGNV---LCIPTLEDGTVDIDTKEWNFIKTW 151
           ++LG D V +     L+H PV L  +   D  +       T +   V + TK  +     
Sbjct: 322 EKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVA 381

Query: 152 ELMQELPKT----GKTKAVGVSNF-----SINNIKELLESPNNKVVPATNQIEIHPLLPQ 202
             ++   K+    GK+K +  S+      SI+       SP  + +P   +I   PL P 
Sbjct: 382 AALEANAKSVESRGKSKLIHDSSVKARVASIDQKMSTRASPFEQRLPEQKKIFNLPLFPT 441

Query: 203 DELIAFCKEKGIVV 216
             + +F + K I +
Sbjct: 442 TTIGSFPQTKDIRI 455

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 33.1 bits (74), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 107/289 (37%), Gaps = 46/289 (15%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREEIFITTKL-WGTEQRDPEAALNKSLKRL 101
           G R  D A +Y N   E  +G  +K   + RE + I TK+ +  ++       N   +R 
Sbjct: 53  GLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIFYAVDETLDLPRSNVPNERN 112

Query: 102 GLDYVD---LYLMHWPVPLKTDRVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELP 158
            LD  +   L   H    +K      G    I  L+   +D DT +   ++    + ++ 
Sbjct: 113 DLDLANQGGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA---LNDVI 167

Query: 159 KTGKTKAVGVSNFSINNIKELLESPNN----KVVPATNQIEIHPLLPQDELIAFCKEKGI 214
             G  + +G S+       EL  +       K V + +   +     + ELI FCK  G+
Sbjct: 168 VEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELIPFCKRHGV 227

Query: 215 VVEAYSP--FGSANAPL-------LKEQAIIDM-------------------AKKHGVEP 246
            +  +SP   G    PL       L +  I +M                   A K  +  
Sbjct: 228 GLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQKEIVKRVEHLATKKNISM 287

Query: 247 AQLIISWSIQRGYVVLAKSVNPERIVSNFKIF--TLPEDDFKTISNLSK 293
           A L ISW++ +G   +    + ER+    K     L EDD K +    K
Sbjct: 288 AMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKYLEETYK 336

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLN---EEEVGRAIKDSGVPREEIFITTK---------------- 81
           A  +AG   ID A  Y N   EE +G  +    + R++I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSA 119

Query: 82  -LWGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +R  + ++  SL++L  D++D+  +HW
Sbjct: 120 NFSGNHRRSLQLSVRDSLRKLQTDWIDILYVHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL--------------- 82
           A  +AG   ID A  Y NEE    +G  +    + R++I I TK                
Sbjct: 61  AFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSA 119

Query: 83  --WGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +R    ++  SL++L  D++D+  +HW
Sbjct: 120 NYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL--------------- 82
           A  +AG   +D A  Y NE+    +G  +K   V R++I I TK                
Sbjct: 61  AFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSA 119

Query: 83  --WGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +R    ++  SL++L  D++D+  +HW
Sbjct: 120 NYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 49/219 (22%), Positives = 82/219 (37%), Gaps = 21/219 (9%)

Query: 20  IPVLGFG--TWRSVDNNGYHSVIAALKAGY----RHIDAAAIYLNEEE---VGRAIKDSG 70
           I  + FG  TW     +        LK  Y    R  D A +Y N +    +G  ++   
Sbjct: 21  IGCMSFGSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYN 80

Query: 71  VPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVTD---GNV 127
           +PRE + I TKL      + +         + L+ V++  +       + R +    G  
Sbjct: 81  IPRETVVIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLGTY 140

Query: 128 LCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKEL--LESPNN 185
           + I  +  G  D DT    F +T   + ++   G T+ VG S        E+  +   + 
Sbjct: 141 IDILQIHRG--DPDTP---FEETMGALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHG 195

Query: 186 KVVPATNQIEIHPLLPQD--ELIAFCKEKGIVVEAYSPF 222
                 +Q   H +  +D  ELI F K   I +  +SP 
Sbjct: 196 WFKFVNSQSCYHLMYREDERELIPFAKRHNIALTPFSPL 234

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL--------------- 82
           A  +AG   ID A  Y NEE    +G  +K   + R++I I TK                
Sbjct: 15  AFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEVGGGKSA 73

Query: 83  --WGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +     ++  SL++L  D++D+  +HW
Sbjct: 74  NYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa]
           {ON} complement(123375..124733) [1359 nt, 453 aa]
          Length = 452

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 66/160 (41%), Gaps = 26/160 (16%)

Query: 165 AVGVSNFSINNIKELLESPNN----KVVPAT------NQIEIHPLLPQDELIAFCKEKGI 214
           A  V    I N+ +L  S +N    +++P +      + I +  L PQ  ++A C  +G 
Sbjct: 187 ARSVGQVHITNLSQLKHSDSNPSGTRLLPTSIIKAHKSAIRMLRLNPQGTMVATCSVQGT 246

Query: 215 VVEAYSPFGSANAPLLKE-------QAIIDMAKKHGVEPAQLIISWSIQRGYVVLAKS-- 265
           ++  +S   + N  LL+E         I DMA  HG     ++        + VL+ +  
Sbjct: 247 LIRIFS---TLNGSLLREFRRGLDRADIYDMAFSHGGTKLAVVSDKQTLHIFQVLSSTHP 303

Query: 266 VNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDMKW 305
            N E  ++N K      D F    N  KVH  + V+   W
Sbjct: 304 QNNESTITNNKPNM--NDSFDHGKN--KVHALRDVIPNVW 339

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 39/84 (46%), Gaps = 16/84 (19%)

Query: 140 IDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESPNNKVVPATNQI----- 194
           ++ KE   I+ W  ++E    GK K + + NF INN+K+      NK    TN+      
Sbjct: 281 VERKERERIQ-WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRIT 339

Query: 195 ----------EIHPLLPQDELIAF 208
                     E+ PL+P  E++++
Sbjct: 340 PEIIIEKIKSELLPLIPDFEILSY 363

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL-----W--------- 83
           A  +AG   ID A  Y NE+    +G  ++   + R++I I TK      W         
Sbjct: 61  AFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDVGKNRSA 119

Query: 84  ---GTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +     ++  SL++L  D++D+  +HW
Sbjct: 120 NFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} similar
           to gnl|GLV|CAGL0K04015g Candida glabrata CAGL0K04015g
           and weakly similar to YGR031W uniprot|P53219
           Saccharomyces cerevisiae YGR031W Hypothetical ORF
          Length = 368

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 129 CIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNI 176
           C+  L+ G V +D K W    +  L + LP        GV N+ +NNI
Sbjct: 184 CVKLLDQGKVRVDDKLWRHKASESLKRYLPNA------GVRNYVLNNI 225

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL--------------- 82
           A  +AG   ID A  Y NE+    +G  +    + R++I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDVGGGKSA 119

Query: 83  --WGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
              G  +R    ++  SL++L  D++D+  +HW
Sbjct: 120 NYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 21/101 (20%)

Query: 33  NNGYHSVIAALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREEIFITTKL------- 82
           N  +  +    +AG   IDAA    NE+    +G  I+   + R++I I TK        
Sbjct: 50  NRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIKSDKKY 108

Query: 83  ----------WGTEQRDPEAALNKSLKRLGLDYVDLYLMHW 113
                      G  +R    ++  SL++L  D++D+  +HW
Sbjct: 109 KAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 39/99 (39%), Gaps = 4/99 (4%)

Query: 200 LPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHGVEPAQL----IISWSI 255
           +P    I +  EK +   AYSP G   A   K++ I   A+   V+P         +  +
Sbjct: 328 VPSSHTITYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKV 387

Query: 256 QRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKV 294
              Y  +  ++N  R  +   I   P  D    +NL+ +
Sbjct: 388 NAWYFGINNNINAVRTKTEHGIALPPATDGSMTTNLTSM 426

>KAFR0C02990 Chr3 complement(595952..596572) [621 bp, 206 aa] {ON}
           Anc_8.143 YGL183C
          Length = 206

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 170 NFSINNIKELLESPNNKVVPATNQIEIHP---LLPQDELIAFCKEKGIVVEAYSPFGSAN 226
           NF+  NIKE ++  N KV+     I+ +    LL Q E  AF KEK  +V+ Y  F   +
Sbjct: 75  NFNRLNIKEEIDKSNKKVIDIRESIDANKKKLLLYQKERKAF-KEKEKLVKNYHDFSKLH 133

Query: 227 APLLKEQAIIDMAK 240
             L     II++ K
Sbjct: 134 KSL--SNQIINLQK 145

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,847,220
Number of extensions: 1562395
Number of successful extensions: 4713
Number of sequences better than 10.0: 160
Number of HSP's gapped: 4465
Number of HSP's successfully gapped: 165
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)