Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR367W (KEI1)5.433ON22122110851e-152
Suva_2.5395.433ON2272279421e-130
Smik_4.6335.433ON2212219281e-128
Skud_4.6365.433ON2342348921e-122
CAGL0A02794g5.433ON2162217253e-97
KAFR0E039305.433ON2112207113e-95
NCAS0F033705.433ON2112246853e-91
KNAG0C049205.433ON2172146811e-90
TDEL0E019205.433ON2202216185e-81
Kpol_1062.305.433ON2142135993e-78
ZYRO0F10010g5.433ON2082155923e-77
SAKL0G02508g5.433ON2282255849e-76
TPHA0E017705.433ON2172135622e-72
TBLA0A065205.433ON2062144831e-60
Kwal_55.214325.433ON2072064812e-60
TBLA0G020105.433ON2132044743e-59
AER256C5.433ON2392244677e-58
NDAI0B056605.433ON1611694547e-57
KLTH0F16082g5.433ON2062054533e-56
KLLA0E21099g5.433ON2242234468e-55
Ecym_47625.433ON2212254362e-53
KAFR0K007007.86ON138124701.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR367W
         (221 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   422   e-152
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   367   e-130
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   362   e-128
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   348   e-122
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   283   3e-97
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   278   3e-95
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   268   3e-91
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   266   1e-90
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   242   5e-81
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   235   3e-78
ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   232   3e-77
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   229   9e-76
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   221   2e-72
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   190   1e-60
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   189   2e-60
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   187   3e-59
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   184   7e-58
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   179   7e-57
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   179   3e-56
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   176   8e-55
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   172   2e-53
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    32   1.9  

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  422 bits (1085), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 208/221 (94%), Positives = 208/221 (94%)

Query: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60
           MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS
Sbjct: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60

Query: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNN 120
           VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTC             EDTANIDGNN
Sbjct: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNN 120

Query: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180
           ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH
Sbjct: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180

Query: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
           HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  367 bits (942), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 191/227 (84%), Gaps = 6/227 (2%)

Query: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60
           MRSSL+ LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQW+AYLWS
Sbjct: 1   MRSSLVALPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANI---- 116
           VFTLIVF+QGLYLIHKPNLLVFSQICVLYT+DTI TC             E  A+I    
Sbjct: 61  VFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADA 120

Query: 117 --DGNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASF 174
                  +  NPI+TGKLT R  D S Q A+ESYEY++TILITLVSLIFRFYFNFILASF
Sbjct: 121 SSTATQTINYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASF 180

Query: 175 VQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
           VQELLHHPKYLVDRDDVEQ+LKNKPIWKRLWAKSQKGCYKLCKNLLE
Sbjct: 181 VQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLLE 227

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  362 bits (928), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 179/221 (80%), Positives = 190/221 (85%)

Query: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60
           MRS LLTLPKSFLGFMPLYLAVEIVLGISILNKCSG YGILALFTGHPLDFMQW+AYLWS
Sbjct: 1   MRSFLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWS 60

Query: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNN 120
           VFTLI+FSQGLYLIHKPNLL+FSQIC LYT+DT+ TC             EDTA    + 
Sbjct: 61  VFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQ 120

Query: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180
           +  SN IST +LT R  DISKQSATESYEY++TILITLVSLIFRFYFN ILASFVQELLH
Sbjct: 121 SNNSNLISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLH 180

Query: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
           HPKYLVDRDDVEQNLKNKPIWKRL+AKSQKGCYKLCKNLL 
Sbjct: 181 HPKYLVDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  348 bits (892), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 176/234 (75%), Positives = 189/234 (80%), Gaps = 13/234 (5%)

Query: 1   MRSSLLTLPK----SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIA 56
           MR+S LTLPK    SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQW+A
Sbjct: 1   MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVA 60

Query: 57  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXED---- 112
           YLWSVFTLIVFSQGLYLIHKPNLLVFSQIC+LYT+DTI TC             E+    
Sbjct: 61  YLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDF 120

Query: 113 --TANIDGNNALQSN---PISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYF 167
              AN   + AL++N   PI  GKLT R  D S QSATE+YEY++TI ITL SLIFRFYF
Sbjct: 121 GSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYF 180

Query: 168 NFILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
           N IL SFVQELLHHPKYLVDRDDVEQ+LKNKPIWKRLWAKSQK CY+LCKNLLE
Sbjct: 181 NLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLLE 234

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  283 bits (725), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 168/221 (76%), Gaps = 5/221 (2%)

Query: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60
           MR + ++ PKSF GF+PLYL VEIVLGI+ILNKCSGAYGILALFTGHPLD+MQWI+YLWS
Sbjct: 1   MRLNKISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWS 60

Query: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNN 120
           VFTLIVFSQGL++IHKP L+VFSQI V +T DT+ TC               +AN + + 
Sbjct: 61  VFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWF---QSANEEKHE 117

Query: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180
              S P+   +   R  D++ Q A+E YEYT+T+L TLV+L+FR YFNFILASFVQELL 
Sbjct: 118 T--SAPVGVSQNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLR 175

Query: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
           HPKY+VD+DDVEQ+LKNK   KR W KSQK CYKLC++ L+
Sbjct: 176 HPKYMVDQDDVEQDLKNKSAIKRWWIKSQKFCYKLCRHTLQ 216

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  278 bits (711), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 136/220 (61%), Positives = 161/220 (73%), Gaps = 10/220 (4%)

Query: 1   MRSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWS 60
           MR++  +LPKSFLG +PLYLAVEIVLGI+  NK SGA+GILALFTGHPL FMQW+ YLWS
Sbjct: 1   MRTTSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWS 60

Query: 61  VFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNN 120
             TL VF+QGL+ IHKPN+L FSQI V Y+IDT+  C              D  N++   
Sbjct: 61  TVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNC------FFTLWFTGDWFNVES-- 112

Query: 121 ALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLH 180
             Q+       +T+R  DIS Q A++ YEY+MTI ITL SL+FRFYFNFILASFVQELL 
Sbjct: 113 --QTEAAVGSTITKRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLR 170

Query: 181 HPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           HPKY+ D+DD+EQ+LKNK IWKR W K QK CYKLCKNLL
Sbjct: 171 HPKYMFDQDDIEQDLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  268 bits (685), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 159/224 (70%), Gaps = 18/224 (8%)

Query: 1   MRSSLLTLPK---SFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAY 57
           M    +TLPK   SF G +PLYL VEIVLGI+I NKCSGAYGILALFTGHPLDF+QW+ Y
Sbjct: 1   MAHHSITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFY 60

Query: 58  LWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANID 117
           LWS+FTLI+F+QGLY IHKP LL FSQI V Y++DTI TC                    
Sbjct: 61  LWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFT------------- 107

Query: 118 GNNALQSNPISTGK-LTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQ 176
            +   Q+ P  T + L  R   +  Q ATE+YEY MTI ITLV+L FR YFN +LA+FVQ
Sbjct: 108 -SQWFQTEPTGTEEALQRRNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQ 166

Query: 177 ELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           ELLHHPKYLVD+DDVEQ+LKNKP+WKR W K+QK  YK+C +LL
Sbjct: 167 ELLHHPKYLVDQDDVEQDLKNKPVWKRWWIKNQKWSYKVCSHLL 210

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  266 bits (681), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 160/214 (74%), Gaps = 4/214 (1%)

Query: 7   TLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIV 66
           +LPK+F G  PLY+ VEIVLG+++LNKCSGA+GILALFTGHPLD MQW +YLWSVFTL+V
Sbjct: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66

Query: 67  FSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSNP 126
           ++QGLY IHKP LL FSQI V+++IDT+ TC             E  +N D   A+ +  
Sbjct: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEE--SNTDA--AMGTAA 122

Query: 127 ISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLV 186
            +  +L +RG +I  Q ATESYEY  TI+IT+VSL+FR YFNF+LASFVQELL HP+YLV
Sbjct: 123 SAVARLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLV 182

Query: 187 DRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           D+DD+EQ+LKNK   +R W  SQK  Y +C+++L
Sbjct: 183 DQDDIEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  242 bits (618), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 154/221 (69%), Gaps = 8/221 (3%)

Query: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61
           RS  + LPKSFLGF+PLY+ VEI LGISI+NKCSGAYGILALFTGHPLD MQW+ Y+WS+
Sbjct: 5   RSKSMGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSI 64

Query: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTAN--IDGN 119
           FTLI+  QGLY IHKPN+L FS I + + IDT+ T              E  +N   D  
Sbjct: 65  FTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTK 124

Query: 120 NALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELL 179
           ++    P+      +    I+ Q A+E +EY +T+ IT++SL  + YF FI+ASFVQELL
Sbjct: 125 SSYSDAPV------DYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELL 178

Query: 180 HHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
            HP+Y++D+DDVEQ+LK++  WKR W KSQK CYK+ K+LL
Sbjct: 179 LHPRYMLDQDDVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  235 bits (599), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 115/213 (53%), Positives = 147/213 (69%), Gaps = 16/213 (7%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67
           LP+SF GF+PLY+ VE VLGI+ILNKCSGAYGILALFTGHPL+  QW++YLWSVFTLI++
Sbjct: 17  LPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTLIIY 76

Query: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSNPI 127
           SQGL+ +H P+LL +SQI V+++ DT  TC               +   DG+        
Sbjct: 77  SQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGS-------- 128

Query: 128 STGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVD 187
                   G+D   Q A+E+YEYT TILIT+V+L+ R YFNFILA+F QEL  HPKY+VD
Sbjct: 129 --------GVDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVD 180

Query: 188 RDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
            DDVEQ+LKNK    + W KS+K CY L +++L
Sbjct: 181 FDDVEQDLKNKNKIVQWWIKSKKSCYNLARHIL 213

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  232 bits (592), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 110/215 (51%), Positives = 145/215 (67%), Gaps = 12/215 (5%)

Query: 6   LTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLI 65
           L LPK FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QW+ YLWS+F+ +
Sbjct: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64

Query: 66  VFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSN 125
           V++QGL+   KP+LLVFSQI + ++IDT  TC             ED       N     
Sbjct: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLED-------NTPTQK 117

Query: 126 PISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYL 185
            I+   + E       Q A++S+E+ MTI ITL SLI R YFNF+LASFVQ LL HP+Y+
Sbjct: 118 SIAAAAMQE-----PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYM 172

Query: 186 VDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           VD  DVEQ L+ +P+WKR+W ++Q  C +  K LL
Sbjct: 173 VDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  229 bits (584), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 117/225 (52%), Positives = 154/225 (68%), Gaps = 6/225 (2%)

Query: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61
           ++ ++ LPKSFLGF+PLY+ VE+ LGISI NK SG YGILALFTGHPLDFMQW  Y  SV
Sbjct: 3   KAEMVHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSV 62

Query: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXE---DTANIDG 118
            TL+V+  GL+ I KPN L +S + V++TIDT+  C             E   D     G
Sbjct: 63  LTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVG 122

Query: 119 NNALQSNPISTG---KLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFV 175
            + LQS   + G   +L  R   ++ QSA++ YEYTMT+L T+++L  RFYFNFILA+FV
Sbjct: 123 TSKLQSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFV 182

Query: 176 QELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           Q++L HPKY+VD+DDVEQ+LKNK +++RL  KS+K CY  C+  L
Sbjct: 183 QQMLRHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRAL 227

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  221 bits (562), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 110/213 (51%), Positives = 141/213 (66%), Gaps = 13/213 (6%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67
           LPKSF GF+PLY+ VE VLGI+I NKCSG YGILALFTGHPL  +QW++YLWS FTL+++
Sbjct: 17  LPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSSFTLLIY 76

Query: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSNPI 127
           +QGL+ +H PNLL + QI + Y+ DTI TC             E  A   G+N   S   
Sbjct: 77  AQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNA---GDNINSSTT- 132

Query: 128 STGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVD 187
                    +D   Q A+ES E+  T+ +TL++L+ RFYFNFILASF Q+L  HPKY++D
Sbjct: 133 ---------VDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMID 183

Query: 188 RDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           +DDVEQ+LKNK I  + W KS+K CY   K  L
Sbjct: 184 QDDVEQDLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  190 bits (483), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 91/214 (42%), Positives = 129/214 (60%), Gaps = 22/214 (10%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67
           LPK F G  PLYL VE+VLGI+I NKC GAYGILALF GHPL+F QW+ Y WS+  L ++
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSNPI 127
           +QGL  +H+P L  FSQ+ + +++DT+ TC               T      N     P 
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYF---------THEWFAANTTTRPP- 124

Query: 128 STGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVD 187
                       + Q A+++YEY++++L+TL SL+ R YFNFI+ SF+QEL   P Y +D
Sbjct: 125 ------------AAQGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLD 172

Query: 188 RDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLLE 221
            D+VE  L++  + +RLW ++Q  CY L + +L 
Sbjct: 173 TDEVETELRHSSLLRRLWLQNQHYCYILSRRILS 206

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  189 bits (481), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 137/206 (66%), Gaps = 5/206 (2%)

Query: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNL 79
           + VEI LGI++LNKCSG YGIL L TGH LDFMQW+ YL S+ T+IV+S GL  I+KP++
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 80  LVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNA-LQS----NPISTGKLTE 134
           L +S I + +T DT+ TC             +++   D N+  LQS    N  S   +++
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 135 RGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQN 194
           RG  +S QSA++  EY  TIL+T+ +L  RFYFNFI+ +FVQ LL HPKY+VD+DDVEQ+
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 195 LKNKPIWKRLWAKSQKGCYKLCKNLL 220
           LK++   +R W +++   YK+C+  L
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRYL 206

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  187 bits (474), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 137/204 (67%), Gaps = 10/204 (4%)

Query: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVF 67
           LP SF    PLYL VE++LGI ILNKCSG YGILALFTGHPL  +QW+ Y+WS+FTL+++
Sbjct: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72

Query: 68  SQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQSNPI 127
           +QG++ I KPN+ +FSQI  ++++DTI T               D +N    N+LQ    
Sbjct: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTL-FLTLYFALDWFSSDHSNKQSENSLQR--- 128

Query: 128 STGKLTERGIDIS-KQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLV 186
                TE+ I++S KQ A+ +YE  + +++TL +LI R Y+N +LASF+ +L  +PK+++
Sbjct: 129 -----TEKDIELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFII 183

Query: 187 DRDDVEQNLKNKPIWKRLWAKSQK 210
           D+DDVE +LKNK  +K+    S+K
Sbjct: 184 DQDDVETDLKNKSFFKKFGGISKK 207

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  184 bits (467), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 100/224 (44%), Positives = 135/224 (60%), Gaps = 12/224 (5%)

Query: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61
            S++  LPKSF G +PLY+ VE+ LGI+I NK  G +G+LALFTGHPLD +QW+ YLWS 
Sbjct: 23  HSNMNHLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSF 81

Query: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXED-----TANI 116
            TL+V+  GL  I++P L  +  + V+Y+ DTI TC              D     TA  
Sbjct: 82  VTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKE 141

Query: 117 DGNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQ 176
           D  +A Q      G +T     +S QSA++SYEY  T+  TL +L  RFY NF++ASFVQ
Sbjct: 142 DDADATQ------GSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQ 195

Query: 177 ELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
            +  H K+    DDVEQ+LK+K +  R +AK Q+ CY LC+  L
Sbjct: 196 RMFQHNKFAAGCDDVEQDLKHKSVAYRAYAKMQRWCYFLCRRYL 239

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  179 bits (454), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 89/169 (52%), Positives = 120/169 (71%), Gaps = 9/169 (5%)

Query: 52  MQWIAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXE 111
           MQW+AYLWS+F LI+F+QGLY IHKP LL FSQI V +T+DT+ TC              
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 112 DTANIDGNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFIL 171
           +     G +A+Q+   STG + +R   ++ Q AT  YEY +T+LIT ++L FRFYFN IL
Sbjct: 61  E-----GESAVQT---STG-VQKRDTSLASQGATAGYEYFVTMLITFITLTFRFYFNCIL 111

Query: 172 ASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           ASFVQELL +PK+++D+DDVEQ+LKNK + KR W K++K CY+LCK++L
Sbjct: 112 ASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVL 160

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  179 bits (453), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 141/205 (68%), Gaps = 4/205 (1%)

Query: 20  LAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNL 79
           + VEI LGI+ILNKCSG YGIL L TGH LDFMQW+ YL SVFTL+V+S GL  ++KP L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 80  LVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQ--SNPISTGK--LTER 135
             ++ + + +T DT+ TC             +++   D ++A Q  S  IS+G   LT R
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 136 GIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQNL 195
           G  +S QSA+++ EY  TIL++L++L+ RFYFNFI+ +FVQ L  HPKYLVD+DDV+Q+L
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 196 KNKPIWKRLWAKSQKGCYKLCKNLL 220
           K+K +W+R W +++   Y++C + L
Sbjct: 181 KHKKLWQRWWIRAENWSYRVCHHYL 205

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  176 bits (446), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 91/223 (40%), Positives = 136/223 (60%), Gaps = 6/223 (2%)

Query: 2   RSSLLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSV 61
           +S+++ LP++FL + PLY+ VE+ LG+   NK SG YG+LALFTGHPLDF+QW  Y+WS+
Sbjct: 4   QSNMVHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSI 62

Query: 62  FTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANI----D 117
           F L+VF  G+  ++KPN+L+ S +  ++++DTI +C             E + ++     
Sbjct: 63  FCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKS 122

Query: 118 GNNALQSNPISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQE 177
              AL      T       +D SK SA+  YE+ + IL+TLV L  RFYFNFI+ +F Q+
Sbjct: 123 AGTALGPAHEGTTSTISTKVDTSK-SASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQ 181

Query: 178 LLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           LL   K+  D++D+E NL N+ I  +   K +K C+ LCK  L
Sbjct: 182 LLRSGKFTFDQNDIEVNLHNRNILFKWRYKFEKWCFYLCKRYL 224

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  172 bits (436), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 88/225 (39%), Positives = 134/225 (59%), Gaps = 13/225 (5%)

Query: 5   LLTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTL 64
           ++ LP+SF G +PLY+ VE+ LG++I NK  G YGILALFTG PLD +QW  Y+WS   L
Sbjct: 1   MVYLPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAAL 59

Query: 65  IVFSQGLYLIHKPNLLVFSQICVLYTIDTISTCXXXXXXXXXXXXXEDTANIDGNNALQS 124
           +VF++GL  ++KP L+ +  +  +Y++DT+  C             EDT++  G+N +  
Sbjct: 60  LVFTKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSS--GSNPVSG 117

Query: 125 NPISTGKLTERG---------IDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFV 175
             I    + + G         +D   QSA+  YEY+ TIL+TL+    RFY NFI+ASFV
Sbjct: 118 KGIGVVDVGKSGTQNFAYRRTVD-DTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFV 176

Query: 176 QELLHHPKYLVDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220
           + ++   +Y+ + DDVE +LKN  +  R +  +Q+ CY  C+  L
Sbjct: 177 RRMMKQNRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa]
           {ON} Anc_7.86 YAL017W
          Length = 1381

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 11/24 (45%), Positives = 16/24 (66%)

Query: 188 RDDVEQNLKNKPIWKRLWAKSQKG 211
           RDD + N+K++ IW   WAK + G
Sbjct: 580 RDDSDMNMKDECIWASFWAKRKNG 603

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,457,883
Number of extensions: 828520
Number of successful extensions: 2916
Number of sequences better than 10.0: 24
Number of HSP's gapped: 2943
Number of HSP's successfully gapped: 25
Length of query: 221
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 116
Effective length of database: 41,441,469
Effective search space: 4807210404
Effective search space used: 4807210404
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 63 (28.9 bits)