Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR365C (ESF1)5.430ON62861024420.0
Smik_4.6325.430ON62761020690.0
Suva_2.5385.430ON62961120010.0
Skud_4.6355.430ON62961219050.0
NDAI0B056405.430ON66964415220.0
NCAS0F033505.430ON63962414940.0
KAFR0E039105.430ON62560714740.0
SAKL0G02442g5.430ON62358114040.0
Kwal_55.214445.430ON64463213211e-175
TDEL0E019505.430ON61760713071e-173
ZYRO0F09944g5.430ON61161712781e-169
Kpol_1016.85.430ON63743011811e-154
KNAG0C049405.430ON64242711581e-150
CAGL0L11638g5.430ON60841811351e-147
TBLA0A065405.430ON65945711241e-145
TPHA0H017805.430ON62241111161e-144
KLLA0E21165g5.430ON62744411081e-143
KLTH0F16148g5.430ON64645110891e-140
AER259W5.430ON61942210841e-139
Ecym_47905.430ON63042010671e-137
NCAS0D009802.354ON12352702.2
KLLA0C06028g6.37ON30574732.4
ACR026W6.1ON31963714.4
NCAS0A016005.330ON20562687.1
AFR468W4.77ON68918707.9
Skud_7.4674.77ON70852708.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR365C
         (628 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   945   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   801   0.0  
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   775   0.0  
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   738   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   590   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   580   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   572   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   545   0.0  
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   513   e-175
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   508   e-173
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   496   e-169
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   459   e-154
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   450   e-150
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   441   e-147
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   437   e-145
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   434   e-144
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   431   e-143
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   424   e-140
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   422   e-139
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   415   e-137
NCAS0D00980 Chr4 (190642..191013) [372 bp, 123 aa] {ON} Anc_2.35...    32   2.2  
KLLA0C06028g Chr3 complement(532044..532961) [918 bp, 305 aa] {O...    33   2.4  
ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic hom...    32   4.4  
NCAS0A01600 Chr1 (313121..313738) [618 bp, 205 aa] {ON} Anc_5.33...    31   7.1  
AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic ...    32   7.9  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   8.6  

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  945 bits (2442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/610 (79%), Positives = 483/610 (79%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXX 120
           KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPD                 
Sbjct: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180
                           NAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER
Sbjct: 121 GESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180

Query: 181 VAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDA 240
           VAIYPSEFGKERMQREEVEGPPKELFQ                   MDIGIKDLYEEGDA
Sbjct: 181 VAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIGIKDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                IVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360
           TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD
Sbjct: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGG 420
           FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGG
Sbjct: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGG 420

Query: 421 NEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEEEI 480
           NEKSSED                                             HTNDEEEI
Sbjct: 421 NEKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHTNDEEEI 480

Query: 481 EKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT 540
           EKNAKSKA              QGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT
Sbjct: 481 EKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT 540

Query: 541 FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMT 600
           FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMT
Sbjct: 541 FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMT 600

Query: 601 NNADDNEDIG 610
           NNADDNEDIG
Sbjct: 601 NNADDNEDIG 610

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  801 bits (2069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/610 (67%), Positives = 441/610 (72%), Gaps = 1/610 (0%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MA E P+KEG D RFAGIYSDPKFKNT+TKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXX 120
           KN QNN+ELEDFDKYF+KEAENDED+E + KTVVDRARGE+                   
Sbjct: 61  KNTQNNKELEDFDKYFQKEAENDEDTEASVKTVVDRARGEISGDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180
                           + KPE GD+SK LAVVNLDWDHVKSEDLMITFSSFVPKGGK+ER
Sbjct: 121 EQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLER 180

Query: 181 VAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDA 240
           VAIYPSEFGKERMQREEVEGPPKELFQ                   +DIGI DLYEEGDA
Sbjct: 181 VAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIGINDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                IVYCSD TTSKAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360
           TFDD VRDEC++LPKNYRPHQFSTDALQHS+VKLTWDETPADR+EVAKRAFTQKEIDDMD
Sbjct: 301 TFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGG 420
           FKAYLASDSDESD Q+DE+AKNKLKSLVG   FNSKKE   D DEEVDMEITFTPALEGG
Sbjct: 361 FKAYLASDSDESDEQIDEDAKNKLKSLVGGINFNSKKENVKDSDEEVDMEITFTPALEGG 420

Query: 421 NEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEEEI 480
           NE+ SE+                                             +   EE+I
Sbjct: 421 NEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKKYAEGEEDI 480

Query: 481 EKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDT 540
           + NAK+KA              QGTINNKAHFNMNEILRSEKEK+KK RYQ KERIVED 
Sbjct: 481 KNNAKAKA-ELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERIVEDN 539

Query: 541 FTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMT 600
           FTPDL DPRFKEVFEDHDFAIDPTQPE+K TQAM+KILKER KRVK+KKRK  GSEN++ 
Sbjct: 540 FTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVKDKKRKHDGSENDII 599

Query: 601 NNADDNEDIG 610
            N D   +IG
Sbjct: 600 KNGDSKGNIG 609

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/611 (65%), Positives = 443/611 (72%), Gaps = 1/611 (0%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MA +  +KE VDARFAGIY+DPKFKNT+T+DHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAVDKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXX 120
           K+A N +ELEDFDKYFEKEAEN+ED+E + K  VDRARGEVP+                 
Sbjct: 61  KDAHNTKELEDFDKYFEKEAENEEDTEADVKATVDRARGEVPNDYVSSGDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180
                           +AKPESGD SK LAVVNLDWDHVKSEDLMITFS FVPKGGKIER
Sbjct: 121 GESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIER 180

Query: 181 VAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDA 240
           +++YPSEFGKERMQREE+EGPPKELFQ                   +DIGIKDLYEEGDA
Sbjct: 181 ISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIGIKDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                IV CSD +T++AIY+NCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360
           TFDD  RD CS LPKNYRPHQFSTDALQHS+VKLTWDETPADRVEVAKRAFTQKEIDDMD
Sbjct: 301 TFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDED-EEVDMEITFTPALEG 419
           FKAYLASDSDESD +V+E+AK+KLKSLVG  GFNSKKE  ND D EEVDMEITFTPALEG
Sbjct: 361 FKAYLASDSDESDEEVNEDAKSKLKSLVGGLGFNSKKENANDGDEEEVDMEITFTPALEG 420

Query: 420 GNEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEEE 479
           G+EK  E                                              H  DEEE
Sbjct: 421 GDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKKHVADEEE 480

Query: 480 IEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVED 539
           I+ NAKSKA              + +IN+KAHFNMNEILRSEKEKHKK RYQKKERIVED
Sbjct: 481 IKNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERIVED 540

Query: 540 TFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNM 599
            FTPDLEDPRFKEVFEDHDFAIDPTQPE+KGTQAM+KILKER KRV ++KRK G +EN++
Sbjct: 541 NFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVHDRKRKHGKNENDV 600

Query: 600 TNNADDNEDIG 610
           T + +DN++IG
Sbjct: 601 TEDGNDNKNIG 611

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/612 (65%), Positives = 437/612 (71%), Gaps = 3/612 (0%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           MAG+  +KE +DARFAGI SDPKFKNT+T+DHKIKLDSRFSKKDLEVQHKSKVDKYGRKI
Sbjct: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXX 120
           K+A+NN+ELEDFDKYFEKEAE+DEDSEV AK VVDRARGEVP                  
Sbjct: 61  KDARNNKELEDFDKYFEKEAEHDEDSEVAAKIVVDRARGEVPSDYVSSSDEFTSSDSESS 120

Query: 121 XXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180
                           +   ESGD+SK LAVVNLDWDHVKSEDLMITFSSFVP+GGKIER
Sbjct: 121 GESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIER 180

Query: 181 VAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDA 240
           +AI+PSEFG+ERM+REEVEGPPKELFQ                    DIGI DLYEEGDA
Sbjct: 181 IAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIGINDLYEEGDA 240

Query: 241 DKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGM 300
           DKDVDS                +V CSDTT++KAIYDNCDGTEYESTANMFDLRYVPDGM
Sbjct: 241 DKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGM 300

Query: 301 TFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMD 360
           TFDD  RDEC+ LPKNYRPHQFSTDALQHS+VKLTWDETPADR+EVAKRAFTQKEIDDMD
Sbjct: 301 TFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMD 360

Query: 361 FKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPND--EDEEVDMEITFTPALE 418
           FKAYLASDSDESD QVDE+AKNKLKSLVG   FN KK+  ND  E+ EVDMEITFTPALE
Sbjct: 361 FKAYLASDSDESDEQVDEDAKNKLKSLVGGLDFNMKKKGANDGKEEGEVDMEITFTPALE 420

Query: 419 GGNEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEE 478
           G NEK  E                                              H  DEE
Sbjct: 421 GENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKKHVADEE 480

Query: 479 EIEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVE 538
           EI+ NAKSKA              +G++N+KAHF+M EILRSEKEKHK+GRYQKKERIVE
Sbjct: 481 EIKNNAKSKA-ELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERIVE 539

Query: 539 DTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENN 598
           DTF PDLEDPRFKEVFEDHDFAIDPTQPE+K TQAMS ILKER KRVK+KKRK   + N+
Sbjct: 540 DTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVKDKKRKHSDNGND 599

Query: 599 MTNNADDNEDIG 610
           +  N D  ++IG
Sbjct: 600 VAKNGDSKKNIG 611

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/644 (52%), Positives = 397/644 (61%), Gaps = 41/644 (6%)

Query: 1   MAGENPK-KEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRK 59
           MA  N + KE  D RFA IY+DPKF+ TK KD KIKLD RFSKKDLE++ KSKVDKYGRK
Sbjct: 1   MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRK 60

Query: 60  IKNAQNN-RELEDFDKYFEKEAENDEDSEVNAK-----------------------TVVD 95
           + +++ N +E+ DFDKYFEK+ E  E  E+  +                       T +D
Sbjct: 61  LADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNID 120

Query: 96  RARGEVPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLD 155
           RARG+VP                                    +PESG+ SK LAVVNLD
Sbjct: 121 RARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLD 180

Query: 156 WDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXX 215
           WDHVKS DLMITFSSF+P+GG+IE +AIYPSEFGKERMQRE+VEGPPKELFQ        
Sbjct: 181 WDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSK 240

Query: 216 XXXXXXXXXXX--MDIGIKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSK 273
                         D+ IKDLYEEGDADKDVD+                +VYC++  T+ 
Sbjct: 241 SKKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETAT 300

Query: 274 AIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVK 333
           AIY NCDGTEYESTANMFDLRYVPDGM F D+ RD+C  LPKNY+PHQFSTDALQHS+VK
Sbjct: 301 AIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVK 360

Query: 334 LTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGF 393
           LTWDETP +R EVAKRAFTQKEIDDMDFKAYLASDSD S+ +++E+AKNKLK+LVG  GF
Sbjct: 361 LTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGGGF 420

Query: 394 NSK-----KETPNDEDE-EVDMEITFTPALEGGN--EKSSEDXXXXXXXXXXXXXXXXXX 445
            S+     K     EDE EVDMEITF PAL+  +  E    +                  
Sbjct: 421 GSREIFGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKAR 480

Query: 446 XXXXXXXXXXXXXXXXXXXXXXXXXXXHTN-DEEEIEKNAKSKAXXXXXXXXXXXXXXQG 504
                                      HT  D+ E +KN KS+A                
Sbjct: 481 KQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETG-S 539

Query: 505 TINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPT 564
           TINNKAHFNMNEILRSEKEK K+G+YQ K++IVED F PDL DPRFKEVFEDHDFAIDP+
Sbjct: 540 TINNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPS 599

Query: 565 QPEFKGTQAMSKILKERSKRV----KNKKRKLGGSENNMTNNAD 604
           +PEFK T+AM +ILKERSKR+     NKKR+L  +EN    ++D
Sbjct: 600 RPEFKETKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSD 643

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/624 (53%), Positives = 389/624 (62%), Gaps = 20/624 (3%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M+ +N  K   D+RF+GIY+DPKF+ TK K+ KIKLD RFSKKDLE++ K+KVDKYGRKI
Sbjct: 1   MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI 60

Query: 61  K--NAQNNRELEDFDKYFEKEAENDEDSEVNAK---TVVDRARGEVPDXXXXXXXXXXXX 115
              N  NN+EL+DFDKYFEKE E+ ++ +   +     VDRARGEVP             
Sbjct: 61  HEDNDMNNKELKDFDKYFEKEGESADEKKEEEEIETVTVDRARGEVPADYVSSSDEYTSS 120

Query: 116 XXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKG 175
                                 A PE+GD +K LAVVNLDWDHV+S DLMITFS F+PKG
Sbjct: 121 ESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGFLPKG 180

Query: 176 GKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLY 235
           GKIE++ + PSEFGKERMQREE EGPP+ELFQ                   +   IKDLY
Sbjct: 181 GKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDV--DIKDLY 238

Query: 236 EEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRY 295
           EEGDADKDVD+                +VYC+    ++AIY+NCDGTEYESTANMFDLRY
Sbjct: 239 EEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRY 298

Query: 296 VPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKE 355
           VPDGM FDD+ RD+CS LPKNY+PHQFSTDALQHS+VKLTWDETPA+RVEVAKRAFTQKE
Sbjct: 299 VPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKE 358

Query: 356 IDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGD---------FGFNSKKETPNDEDEE 406
           I+DMDFKAYLASDSD S+ +V+++AKNKLKSLVGD         FG    K+T   EDEE
Sbjct: 359 IEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFG---SKDTLEGEDEE 415

Query: 407 VDMEITFTPALEGGNEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 466
           VDMEITF P L  G EK+ E                                        
Sbjct: 416 VDMEITFDPGLSEGVEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLK 475

Query: 467 XXXXXXHTNDEEEIEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHK 526
                 H +  E     AKSKA               G IN KAHFNM EILRSEKEK K
Sbjct: 476 SLKGKKHNDSTEGDASTAKSKAELELLMMDDEDDTETG-INKKAHFNMKEILRSEKEKSK 534

Query: 527 KGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK 586
           KG+YQ K RIVED F PDL DPRFKEVFEDHDFAIDP++PEFK T AM +ILKERSKR  
Sbjct: 535 KGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSS 594

Query: 587 NKKRKLGGSENNMTNNADDNEDIG 610
              +K   S + M N A++  DI 
Sbjct: 595 KNAQKKKRSHSLMDNQANETSDIS 618

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/607 (55%), Positives = 389/607 (64%), Gaps = 20/607 (3%)

Query: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71
           D RF+ IY+DPKFKN KTK  KI+LDSRFSK+DLE+++K+KVDKYGRK K+  + +EL+D
Sbjct: 10  DPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGSKKELDD 69

Query: 72  FDKYFEKEAENDEDSEVNAKTV--VDRARGEVPDXXXXXXXXXXXXXXXXXXXXXXXXXX 129
           F+KYFEKE E ++      +    VDRARGEVP                           
Sbjct: 70  FEKYFEKEDEEEKKDTEETEEKPKVDRARGEVPSDYVSSSDEYTSSESEDSEEEELDSDV 129

Query: 130 XXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFG 189
                  N KPE+GD SK LAVVNLDWDHVKS DLM+TFSSFVPKGGKI R+ IYPSEFG
Sbjct: 130 ESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFG 189

Query: 190 KERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKDVDSXXX 249
           KER+QREEVEGPPKELFQ                    D+ IKDLYEEGDA+KDVDS   
Sbjct: 190 KERLQREEVEGPPKELFQKKNKKKASHKEDFDSDS---DVDIKDLYEEGDAEKDVDSKAL 246

Query: 250 XXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDE 309
                        +VYC++  T++AIY+NCDGTEYESTANMFDLRYVPDGMTFDD+ RDE
Sbjct: 247 RQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDE 306

Query: 310 CSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDS 369
           C+ LPKNY+P QFSTDALQHS+VKLTWDETPADRVEVAKRAF+QKEI+DMDFKAYLASDS
Sbjct: 307 CNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASDS 366

Query: 370 DESDGQVDEEAKNKLKSLVG---DFGFNSKKETPNDEDEEVDMEITFTPALEGGNEKSSE 426
           DES+ +V+E +KNKLK+LVG   DFG N      +D + EVDMEITFTP L+   E   E
Sbjct: 367 DESEEEVNENSKNKLKALVGESLDFGTNG----ASDGESEVDMEITFTPGLDEAKESEEE 422

Query: 427 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEEEIEKNAKS 486
                                                             E E E+ AK+
Sbjct: 423 KEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKAETENEEAAKA 482

Query: 487 KAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLE 546
           KA              Q ++N KAHFN+NEI+RSEKEK KKG+YQ+KE+IVED F PDL 
Sbjct: 483 KAELELLMIEDEDDTEQ-SLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDLS 541

Query: 547 DPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRV-------KNKKRKLGGSENNM 599
           DPRFKEVFEDHDFAIDP+QPEFK T AM +IL ERSKR        KNKKRKL  S +  
Sbjct: 542 DPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTSKN 601

Query: 600 TNNADDN 606
             NA  N
Sbjct: 602 GKNAISN 608

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/581 (51%), Positives = 375/581 (64%), Gaps = 16/581 (2%)

Query: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71
           D RF+GI+SDPKFK+ K K+ KIKLD RFSKKDLE++ K+KVDKYGR++K+  +N+E +D
Sbjct: 13  DPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDV-DNKETKD 71

Query: 72  FDKYFEKEAENDEDSEVNAK----TVVDRARGEVPDXXXXXXXXXXXXXXXXXXXXXXXX 127
           F++YFEKE E+   S+   +    T +DRARGEVP                         
Sbjct: 72  FERYFEKEEESSSPSDEEGESTKVTSLDRARGEVPSDYLSSSEEESSSESEEESENSELE 131

Query: 128 XXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSE 187
                     +KP +GD ++ LAVVNLDWDHVKS DLM+TFSSFVPKGGKI ++AIYPSE
Sbjct: 132 SEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSE 191

Query: 188 FGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKDVDSX 247
           FGKERMQREEVEGPP+ELFQ                    D+ IKDLYEEGDA+KD DS 
Sbjct: 192 FGKERMQREEVEGPPRELFQGKKKKSQRKDGDDS------DVDIKDLYEEGDAEKDYDSK 245

Query: 248 XXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVR 307
                          +V+C++  T++AIY NCDGTEYESTANMFDLRYVP+GM F D+ +
Sbjct: 246 ALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPK 305

Query: 308 DECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLAS 367
           DEC  +PKNY+P QFSTDALQHS+VKLTWDETPA+RVE++KRAFTQKEI+DMDFKAYLAS
Sbjct: 306 DECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLAS 365

Query: 368 DSDESDGQVDEEAKNKLKSLVGD---FGFNSKKETPNDEDEEVDMEITFTPALEGGNEKS 424
           DS+ S+ +++E+++NKLKSLV +    G  S  +  ++E  +VDMEITFTP L+   +K 
Sbjct: 366 DSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLDEA-KKD 424

Query: 425 SEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHTNDEEEIEKNA 484
            ED                                              +   +E+EK  
Sbjct: 425 DEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEVEKEK 484

Query: 485 KSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPD 544
           KSKA              +  +N KAHFNM EILRSEKEK K+ +YQ +E+IVED F PD
Sbjct: 485 KSKA-ELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKPD 543

Query: 545 LEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRV 585
           L DPRF+EVFEDHDFAIDP+QPEFKGT AM +ILKER++RV
Sbjct: 544 LNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV 584

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 300/632 (47%), Positives = 374/632 (59%), Gaps = 46/632 (7%)

Query: 7   KKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNN 66
           K+E  D RFA ++SDPKF+ TK K  KIKLD RFSKKDL+ + K++VDKYGR +K  Q N
Sbjct: 9   KEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLK-GQEN 67

Query: 67  RELEDFDKYF---------------EKEAENDEDSEVNAKTV----------VDRARGEV 101
           ++ +DFDKY+               E++++++ +S   AK +          +DRARGEV
Sbjct: 68  KDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEV 127

Query: 102 PDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKS 161
           P                                  + KP+SGD SK LAVVNLDWDHVKS
Sbjct: 128 PSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKS 187

Query: 162 EDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXX 221
            DLMITFSSFVP GGKI ++A+YPSEFGKER++REE+EGPP+E+F+              
Sbjct: 188 TDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSD 247

Query: 222 XXXXXMDIGIKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDG 281
                     +DLYEEGDA+ D D+                +VYC++  T++AIY NCDG
Sbjct: 248 SDVDV-----RDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDG 301

Query: 282 TEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPA 341
           TE+ESTANMFDLRYVPDGMTFDD+ RDEC+ +PKNY+P QFSTDALQHS VKLTWDETPA
Sbjct: 302 TEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPA 361

Query: 342 DRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSL------VGDFGFNS 395
           DRV ++KRAFTQKEI+DMDFKAYLASDS+ES+ + +++ K KLKSL      VGD     
Sbjct: 362 DRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFD 421

Query: 396 KKETPNDEDEEVDMEITFTPALEGGNEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 455
             + P + + +VDM+ITF P L  G E   +D                            
Sbjct: 422 --QAPEEGESDVDMQITFAPGLAEGAE---DDKQENAEETTLEKLKRKEKERKKMRKERI 476

Query: 456 XXXXXXXXXXXXXXXXXHTNDEEEIEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMN 515
                                 E   ++AKSKA                 +N KAHFNMN
Sbjct: 477 KELKKQAEEEKKQKRKESRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMN 536

Query: 516 EILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMS 575
           EI+RSEKEK KK RYQ K++IVED F PDL DPRF EVFED DFAIDP+QPEFKGT AM 
Sbjct: 537 EIVRSEKEKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMK 596

Query: 576 KILKERSKRV---KNKKRKLGGSENNMTNNAD 604
           +IL+ER+KR    +NKKRK  G+  N    +D
Sbjct: 597 QILQERTKRSHKGQNKKRKADGNLANQNGQSD 628

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  508 bits (1307), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 308/607 (50%), Positives = 383/607 (63%), Gaps = 22/607 (3%)

Query: 8   KEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNR 67
           K   D RF+ IY DPKF N KTK  K+KLD RFSKKDLE++ K+KVDKYGR++++ ++++
Sbjct: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63

Query: 68  ELEDFDKYFEK---EAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXXXXXX 124
           E +DFDKYFE+   E + D+D+E+     VDRARGEVP                      
Sbjct: 64  ESKDFDKYFEQSDEEKKKDKDTEI---LTVDRARGEVP-SDYVSSSDEFTSSDSEVSDNE 119

Query: 125 XXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIY 184
                         +P SGD SK LAVVNLDWD+V+S DLMITFSSF+P GG+IE++AIY
Sbjct: 120 VESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIY 179

Query: 185 PSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKDV 244
           PSEFGKERMQREEVEGPPKELFQ                    DI +KDLYEEGDADK+V
Sbjct: 180 PSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDS----DIDVKDLYEEGDADKNV 235

Query: 245 DSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDD 304
           D+                +VYC++   +++IY+NCDGTEYESTAN+FD+RYVPDGM FD 
Sbjct: 236 DNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDG 295

Query: 305 DVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAY 364
             +D C+ LPKNY+P QFSTDALQHS+VKLTWDETPADR++VAKRAFTQKEI+DMDFKAY
Sbjct: 296 KPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAY 355

Query: 365 LASDSDESDGQVDEEAKNKLKSLV-GDFGFNSKKETPND---EDEEVDMEITFTPALEGG 420
           LASDSD+S+ +VD ++K+KLKSLV G   F+  ++  ++    DEEVDMEITFTP L+  
Sbjct: 356 LASDSDDSEDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPGLDEA 415

Query: 421 NEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXHTNDEEE 479
           N+   E                                                T+D   
Sbjct: 416 NKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGKQTSD--- 472

Query: 480 IEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVED 539
           IE++ KSKA              + +IN KAHFNM EIL+SEKEK KK +YQ K +IV D
Sbjct: 473 IEQDPKSKAELELLMMDDEDDTEK-SINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVD 531

Query: 540 TFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK--NKKRKLGGSEN 597
            F PDLEDPRFKE+FE HDFAIDPTQ EF+GT+AM ++L +RSK+    N KRK+   EN
Sbjct: 532 DFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQEN 591

Query: 598 NMTNNAD 604
           +   N D
Sbjct: 592 DTNENGD 598

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  496 bits (1278), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 303/617 (49%), Positives = 378/617 (61%), Gaps = 38/617 (6%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M  +   K   D RFAGI +DPKF+N K K  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKT----------VVDRARGEVPDXXXXXXX 110
                +++L+DFDKYFEKE +  ++ E ++ +          VVDRARGE+P+       
Sbjct: 61  TG--ESKDLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSES 118

Query: 111 XXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSS 170
                                      AKPESGD SK LAVVNLDWDHV++ DLMITFSS
Sbjct: 119 EDSESDLSEEESEADVAEAVE-----EAKPESGDPSKTLAVVNLDWDHVRAADLMITFSS 173

Query: 171 FVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIG 230
           F+P GGKIE++ IYPSEFGKERMQREE EGPP+E+F                     D+ 
Sbjct: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDS--------DVD 225

Query: 231 IKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANM 290
           I+DLYEEGDADK+VD+                IVYC++  T ++IY NCDGTEYESTAN+
Sbjct: 226 IRDLYEEGDADKEVDNAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANI 285

Query: 291 FDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRA 350
           FDLRYVP+GM FDD+ +DEC  LPKNY+P +FSTDALQHS+VKLTWDETP DR+EV+KRA
Sbjct: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345

Query: 351 FTQKEIDDMDFKAYLASDSDESDG--QVDEEAKNKLKSLVGD-FGFNSKKETPNDEDEEV 407
           F+QKE++DMDF+AYLAS +DESDG    +EEAKNKLKSLVG    +  ++E      EE 
Sbjct: 346 FSQKELEDMDFQAYLASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQQE------EEP 399

Query: 408 DMEITFTPALEGGNEKSSEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 467
           DMEITFTP L+    ++ ED                                        
Sbjct: 400 DMEITFTPGLDDSKPQADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLR 459

Query: 468 XXXXXHTNDEEEIEKNAKSKAXXXXXXXXXXXXXXQGTINNKAHFNMNEILRSEKEKHKK 527
                    + E E +AKSKA              + ++N KAHFNMNEIL+SEKEK KK
Sbjct: 460 SGK---NKKQVEDESDAKSKAELELLMMEDEDDTEK-SLNKKAHFNMNEILKSEKEKKKK 515

Query: 528 GRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKN 587
           G+YQ K +I+ED F PDL DPRF EVFE+ DFAIDP+QPE+K T+AM +IL+ERSKR   
Sbjct: 516 GKYQDKGKIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHK 575

Query: 588 KKRKLGGSENNMTNNAD 604
           K++ L    ++  N  D
Sbjct: 576 KRKPLADDGDSKDNKHD 592

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  459 bits (1181), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 245/430 (56%), Positives = 303/430 (70%), Gaps = 15/430 (3%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M+GE+  K+  D RF+GIYSDPKFKN+K K+ KIKLD RF K DL+++HKSKVDKYGRK+
Sbjct: 1   MSGEDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKL 60

Query: 61  KNAQNNRELEDFDKYFEKEAENDEDSEVNAKT---VVDRARGEVPDXXXXXXXXXXXXXX 117
           K+ ++N+ELEDFDKYFEKE E D++ E+  +    V+DRARGEVP               
Sbjct: 61  KDVKDNKELEDFDKYFEKEDEEDKEEEIGTEAKVKVLDRARGEVPSDYESSSEEFTSSDS 120

Query: 118 XXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGK 177
                               +KPESGD SK LAVVNLDWD+VKS+DLMITFSSF+PKGGK
Sbjct: 121 ESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGK 180

Query: 178 IERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMD---IGIKDL 234
           IE++ IYPSEFGKERM REEVEGPP+ELF                         + I++L
Sbjct: 181 IEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIREL 240

Query: 235 YEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLR 294
           YEEGDA+KDVDS                +VYC++  ++++IY+NCDGTEYES+AN+FDLR
Sbjct: 241 YEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLR 300

Query: 295 YVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQK 354
           YVPDG  FDD+ RDEC  LPKNY+  QF+TDALQHS+VKLTWDETPADRVE+AKRAFTQK
Sbjct: 301 YVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQK 360

Query: 355 EIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLV------GDFG-FNSKKETPNDEDEEV 407
           EI++MDFKAYLASDSDES+ + +++ KNKLKSLV      GD   F+ K +  N+E+++V
Sbjct: 361 EIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGD--NNEEDDV 418

Query: 408 DMEITFTPAL 417
           DMEITFTP L
Sbjct: 419 DMEITFTPGL 428

 Score =  108 bits (269), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%)

Query: 504 GTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDP 563
            T+N KAHFNMNEI+RSEKEK KK +YQ K +IVED F PDL DPRFKE+FEDHDFAIDP
Sbjct: 516 STLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDP 575

Query: 564 TQPEFKGTQAMSKILKE 580
           TQ EFK T AM +ILKE
Sbjct: 576 TQSEFKETTAMKEILKE 592

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  450 bits (1158), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 251/427 (58%), Positives = 291/427 (68%), Gaps = 20/427 (4%)

Query: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNA-QNNRELE 70
           D RF+G+Y+DPKF++TK K  K+KLDSRFSKKDLEV+ K+KVDKYGRKIKN   N +ELE
Sbjct: 8   DPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANKKELE 67

Query: 71  DFDKYFEKE-----AENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXXXXXXX 125
           DFDKYFEKE     +E+ E  E   K VVDRARGEVPD                      
Sbjct: 68  DFDKYFEKEDEAKESEDAEAPEAPVKVVVDRARGEVPDDYVSSADEFTSSDSESSGSSES 127

Query: 126 XXXXXX-----XXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIER 180
                           + KPESGD SK LAVVNLDWDHVKS DLMITF+ F+PKGGKIER
Sbjct: 128 ESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIER 187

Query: 181 VAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXX-----XXMDIGIKDLY 235
           + IYPSEFGKER+ REE EGPPKELF                          D+ IKDLY
Sbjct: 188 ICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKDLY 247

Query: 236 EEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRY 295
           EEGDA+KD+DS                +VYC++  T+KAIYDNCD TEYESTANMFDLRY
Sbjct: 248 EEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRY 307

Query: 296 VPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKE 355
           VP+GMTFDDD RDEC  LPKNY+P  F+TDALQHS+VKLTWDETPADRVE+AKRAF+QKE
Sbjct: 308 VPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKE 367

Query: 356 IDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKE----TPNDEDEEVDMEI 411
           IDDMDFKAYLASDS++SD +VDE  KN+LK+LVG     S+ +       D++E +DMEI
Sbjct: 368 IDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGAEEDEDDEEGMDMEI 427

Query: 412 TFTPALE 418
           TFTP L+
Sbjct: 428 TFTPGLD 434

 Score =  114 bits (285), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 2/108 (1%)

Query: 503 QGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAID 562
           + T+N K HFNMNEI+RSEKEK KK ++Q K RIVED F PDL D RFKEVFEDHDFAID
Sbjct: 521 KSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAID 580

Query: 563 PTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMTNNADDNEDIG 610
           P++PEFK T AM KIL+ERS R ++K +K   +E   + +  D  DI 
Sbjct: 581 PSRPEFKETPAMQKILQERSNRARSKGKKRKSAEQ--STDTSDKTDIS 626

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  441 bits (1135), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 237/418 (56%), Positives = 284/418 (67%), Gaps = 13/418 (3%)

Query: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71
           D RF+ IY+DPKFK + +K  KIKLD RF KKDLEV  ++KVDKYGRKIK   +++++ED
Sbjct: 8   DPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEG-SSKDIED 66

Query: 72  FDKYFEK------EAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXXXXXXX 125
           FDKYFEK      E   DE     +K +VDRARGEVP                       
Sbjct: 67  FDKYFEKDEKSAEEESADEGDVAKSKKIVDRARGEVPSDYVSSEDEFTSSDSDTSGDSDY 126

Query: 126 XXXXXX--XXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAI 183
                          K E+GD +K LA VNLDWDHV+S D+M+TFSSF+PKGGKIE++ I
Sbjct: 127 DSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKICI 186

Query: 184 YPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKD 243
           YPSEFGKERM+REEVEGPP+ELFQ                    D+ IKDLYEEG+AD  
Sbjct: 187 YPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEES---DVDIKDLYEEGNADDQ 243

Query: 244 VDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303
           VD                 ++YC++  ++KAIY+NCDGTEYESTAN+ DLRYVPDGM FD
Sbjct: 244 VDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFD 303

Query: 304 DDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKA 363
           D+ +D+C  LPKNY+PHQFSTDALQHS+VKLTWDETP DRVEVAKRAFTQKEI+DMDFKA
Sbjct: 304 DEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKA 363

Query: 364 YLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDMEITFTPALEGGN 421
           YLASDSDES+ +V+EEAKNKLKSLVG+       +  +DEDE +DMEITFTP L+  N
Sbjct: 364 YLASDSDESEEEVNEEAKNKLKSLVGE-SLKIDGKDGSDEDEGMDMEITFTPGLDEAN 420

 Score =  109 bits (273), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 75/84 (89%)

Query: 506 INNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQ 565
           IN+KAHFNMNEILRSEKEK KKG++QKK+RIVED F P+L+D RFKEVFEDHDFAIDP+Q
Sbjct: 499 INSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQ 558

Query: 566 PEFKGTQAMSKILKERSKRVKNKK 589
           PEFK T+AM +ILKER KR ++ K
Sbjct: 559 PEFKETKAMKEILKERRKRSRDSK 582

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  437 bits (1124), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 237/457 (51%), Positives = 301/457 (65%), Gaps = 38/457 (8%)

Query: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60
           M+   PK+   DARFAG+++DPKF+ +K    K+KLD+RFSKKDL+V +KSKVD+YGRKI
Sbjct: 1   MSERKPKE---DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKI 57

Query: 61  KNAQNNRELEDFDKYF-------------------------EKEAENDEDSEVNAKTV-V 94
            + +N ++ +DFDKY+                         + + + D+D +V A+   +
Sbjct: 58  ID-RNEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARL 116

Query: 95  DRARGEVPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNL 154
           DRARG+VP                                  +AKPE+GD SK +AVVNL
Sbjct: 117 DRARGDVPSDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNL 176

Query: 155 DWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXX 214
           DWDHVKS DLMITFS F+PKGGKI ++AIYPSEFGKERMQREE+EGPPKELF+       
Sbjct: 177 DWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGK 236

Query: 215 XXXXXXXXXXXXMDIGIKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKA 274
                        D+ I DLYEEGDADK++DS                +VYC++  T+++
Sbjct: 237 KSTAEDNEDDVS-DVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAES 295

Query: 275 IYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKL 334
           IY NCDGTEYESTAN+FD+RYVPD MTFDD  RDEC  LPKNY+P QFSTDALQHS+VKL
Sbjct: 296 IYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKL 355

Query: 335 TWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGD---- 390
           TWDETPADRVE++KRAF+QKEID+MDFKAYLASDSDES+ +++ ++KNKLKSLVG     
Sbjct: 356 TWDETPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFG 415

Query: 391 --FGFNSKKETPNDEDEE-VDMEITFTPALEGGNEKS 424
             FG +++ +    +DE+ VDMEITFTP L+   E S
Sbjct: 416 NVFGKDTEYDLDGSDDEDGVDMEITFTPGLDEKKEAS 452

 Score =  107 bits (268), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 65/80 (81%)

Query: 506 INNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQ 565
           +NNKAHFNMNEILRSEKEK KK +YQ K +IV+D F P+L D RF E+FEDH FAIDPTQ
Sbjct: 539 VNNKAHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQ 598

Query: 566 PEFKGTQAMSKILKERSKRV 585
           PEFK T AM +IL ER+KR 
Sbjct: 599 PEFKQTSAMKEILNERTKRA 618

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  434 bits (1116), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/411 (57%), Positives = 280/411 (68%), Gaps = 9/411 (2%)

Query: 11  VDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELE 70
            D RF+G+++DPKFKN + K+ KIKLDSRFSK DLEV  K++VDKYGRKI N  NN+E +
Sbjct: 9   TDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNL-NNQEAK 67

Query: 71  DFDKYFEKEAENDEDSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXXXXXXXXXXXXX 130
           DFDKYFEKE +     E+  K ++DRARGEVP                            
Sbjct: 68  DFDKYFEKEEDGKG-EEIAVKPLIDRARGEVPSDYQSSLDDYTSSESEDSEDEDLESEGE 126

Query: 131 XXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGK 190
                   KPESGD SK +AVVNLDWDHVK+ DL++TFSSFVPKGGKIER+AI+PSEFGK
Sbjct: 127 SEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPSEFGK 186

Query: 191 ERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKDVDSXXXX 250
           +RM+REE+EGPPKELFQ                    D+ I DLYEEGD DK+VDS    
Sbjct: 187 QRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDS--DVDINDLYEEGDVDKEVDSKSLR 244

Query: 251 XXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDEC 310
                       +V+C++ +T++AIY+NCDGTEYESTAN+FDLRYVPDGM F+D   DEC
Sbjct: 245 QYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYDEC 304

Query: 311 SILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSD 370
           + LPKNY P  F+TDALQHS+VKLTWDETPADRVE+AKRAFTQKEID+MDFKAYLAS   
Sbjct: 305 TELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYLAS-DS 363

Query: 371 ESDGQVDEEAKNKLKSLVG---DFGFNSKKETPND-EDEEVDMEITFTPAL 417
           E     +EE KNKLKSLVG     G  S  +  +D ED EVDMEITFTP L
Sbjct: 364 EESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTPGL 414

 Score =  111 bits (278), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 66/107 (61%), Positives = 80/107 (74%), Gaps = 9/107 (8%)

Query: 504 GTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDP 563
            TIN KAHFNM EILRSEKEK KK ++Q KE+IVED F  DL DPRF E+FEDHDFAIDP
Sbjct: 502 STINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFKADLNDPRFNEMFEDHDFAIDP 561

Query: 564 TQPEFKGTQAMSKILKERSKRV------KNKKRKLG---GSENNMTN 601
           TQ E+K T AM +ILKERSKR       +++KRK+    GS+ +++N
Sbjct: 562 TQSEYKETAAMKEILKERSKRSTMKKANRSEKRKISPSDGSQKDISN 608

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  431 bits (1108), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 237/444 (53%), Positives = 296/444 (66%), Gaps = 33/444 (7%)

Query: 3   GENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKN 62
           GE  +K   D RF+GI++DPKF++TK+K+ KIKLD RFSK+DLEV+ K+KVDKYGRKI +
Sbjct: 5   GEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD 64

Query: 63  AQNNRELEDFDKYFEKEAENDE---------------DSEVNAKTVVDRARGEVPDXXXX 107
           A  N++++DFD+YF KE   D+               ++ V+AK+V DRARGE P     
Sbjct: 65  A--NKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSV-DRARGEPP--ADY 119

Query: 108 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMIT 167
                                         +KP SG+ +  LAVVNLDWDHVKS DL +T
Sbjct: 120 VSSSDEESSSESEEESGDSDIESEEIELEESKPASGNATNTLAVVNLDWDHVKSADLFVT 179

Query: 168 FSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXM 227
           F SFVPKGG+I+++AIYPSEFGKERMQREE+EGPPKELFQ                    
Sbjct: 180 FKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDD--------D 231

Query: 228 DIGIKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYEST 287
           +I ++ +YEEGDA+ D DS                +VYCSD  T+++IY NCDGTEYEST
Sbjct: 232 EINVESIYEEGDAE-DYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYEST 290

Query: 288 ANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVA 347
           AN+FDLRYVPDGM  DDD RDEC+ LPKNY+P QFSTDALQHS VKLTWDETPADRVE++
Sbjct: 291 ANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEIS 350

Query: 348 KRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGD---FGFNSKKETPNDED 404
           KRAFTQKEI++MDFKAYLASDS+ES+ + D++ KNKLK+LV D    G  S  +   DED
Sbjct: 351 KRAFTQKEIEEMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDED 410

Query: 405 E-EVDMEITFTPALEGGNEKSSED 427
           + E DMEITFTP L+   ++ + D
Sbjct: 411 DNEADMEITFTPGLDESGQQDTND 434

 Score =  127 bits (318), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 2/107 (1%)

Query: 503 QGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAID 562
           + TINNKAHFNMNEIL+SEKEK KK +YQ KE+IV+D FTPD+ DPRFKEVFEDHDFAID
Sbjct: 504 ESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFTPDVNDPRFKEVFEDHDFAID 563

Query: 563 PTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSENNMTNNADDNEDI 609
           PTQPEFK T AM KILKER+  V++ K+  G   N+   N + ++DI
Sbjct: 564 PTQPEFKKTPAMEKILKERT--VRSSKKSRGKKRNHEIANTEHSKDI 608

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/451 (51%), Positives = 288/451 (63%), Gaps = 37/451 (8%)

Query: 1   MAGENPKKEG--VDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR 58
           M+ EN  ++G   D RFAG+ +DPKF+ T+ K  KIKLD RFSKKDLE + K++VDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 59  KIKNAQNNRELEDFDKYFEKE----------------------AENDEDSEVNAKTV-VD 95
           ++K  Q +++  DFDKY+EKE                        +DE+   +AKTV +D
Sbjct: 61  RLK-GQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLD 119

Query: 96  RARGEVPDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLD 155
           RARGEV                                     + +SGD SK LAVVNLD
Sbjct: 120 RARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLD 179

Query: 156 WDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXX 215
           WDHVKS DLM+TFSSFVPKGGKI RVAIYPSEFGKER+ +EE EGPP+E+F+        
Sbjct: 180 WDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKS 239

Query: 216 XXXXXXXXXXXMDIGIKDLYEEGDADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAI 275
                       ++ +KDLYEEGDAD D D+                +VYC++  T+++I
Sbjct: 240 HGDDSDE-----ELTVKDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESI 293

Query: 276 YDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLT 335
           Y NCDGTEYESTANMFDLRYVPDGM FDD+ RDEC  +PKNYRP +FSTDALQHS VK T
Sbjct: 294 YKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFT 353

Query: 336 WDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNS 395
           WDETPADR  +AKRAFTQ+EI+DMDFKAYLASDS++S+ + ++E KNKLKSLV       
Sbjct: 354 WDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVG 413

Query: 396 KK----ETPNDEDEEVDMEITFTPAL-EGGN 421
           +K    + P D + +VDM+ITF PAL EGG+
Sbjct: 414 EKSIFDQDPKDGESDVDMQITFAPALAEGGS 444

 Score =  135 bits (339), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/92 (71%), Positives = 75/92 (81%), Gaps = 3/92 (3%)

Query: 506 INNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQ 565
           +N KAHFNMNEI+RSEKEK KK ++Q K RIVED F PDL DPRF EVFEDHDFAIDP+Q
Sbjct: 526 LNKKAHFNMNEIVRSEKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQ 585

Query: 566 PEFKGTQAMSKILKERSKRV---KNKKRKLGG 594
           PEFKGT AM +IL+ER+KR    KNKKR+  G
Sbjct: 586 PEFKGTAAMKQILQERNKRSQKGKNKKREANG 617

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  422 bits (1084), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/422 (54%), Positives = 281/422 (66%), Gaps = 14/422 (3%)

Query: 4   ENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNA 63
           E   K+ +D RFA I SDPKF+  K K+ KIKLD RFSK+DLE + K+KVDKYGR+I  A
Sbjct: 6   EGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTA 65

Query: 64  QNNRELEDFDKYFEKEAENDE----DSEVNAKTVVDRARGEVPDXXXXXXXXXXXXXXXX 119
               E +DF+KYF KE+        D E ++   +DRARGEVP                 
Sbjct: 66  PGKEE-KDFEKYFTKESSESAAEESDKEDSSVAKLDRARGEVP-ADYVSSSDEESSSESE 123

Query: 120 XXXXXXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIE 179
                              KPESGD SK LAVVNLDWDHVK  DL++ F+SFVP+GGKIE
Sbjct: 124 ADSDDATAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIE 183

Query: 180 RVAIYPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGD 239
           RVAIYPSEFGKERMQREEVEGPP+E+F+                    +IG+KDLYE+GD
Sbjct: 184 RVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDD-------EIGLKDLYEQGD 236

Query: 240 ADKDVDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDG 299
           A+KD DS                +VYC++  T++AIY NCDGTEYESTANMFDLRYVP+G
Sbjct: 237 AEKDYDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEG 296

Query: 300 MTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDM 359
           +TFDD+ R+EC+ +PK+Y+P QFST ALQH  VKLTWDETPADRVE+AKRAF+QKEI+DM
Sbjct: 297 VTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDM 356

Query: 360 DFKAYLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDED-EEVDMEITFTPALE 418
           DFKAYLASDS+ES+   + EAKNKL+SLV       K    ++ D EE D++ITFTP LE
Sbjct: 357 DFKAYLASDSEESEADDNSEAKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTPGLE 416

Query: 419 GG 420
           GG
Sbjct: 417 GG 418

 Score =  105 bits (261), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 66/76 (86%)

Query: 505 TINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPT 564
           +IN+ AHFNMN+ILRSEKE+ KK +YQKK++IVED F PDL DPRFKEVFED DFAIDP+
Sbjct: 499 SINSSAHFNMNDILRSEKERGKKSKYQKKDKIVEDDFKPDLNDPRFKEVFEDRDFAIDPS 558

Query: 565 QPEFKGTQAMSKILKE 580
           QPEFK T AM +IL+E
Sbjct: 559 QPEFKETAAMKQILQE 574

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  415 bits (1067), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 224/420 (53%), Positives = 274/420 (65%), Gaps = 17/420 (4%)

Query: 12  DARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNAQNNRELED 71
           D+RFAGI++DPKF+  K    KI LD RFSKKDLE + K+KVDKYGR+I  + + +E +D
Sbjct: 14  DSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRI-GSYDEKEAKD 72

Query: 72  FDKYF------EKEAENDEDSEVN--AKTVVDRARGEVPDXXXXXXXXXXXXXXXXXXXX 123
           FD+YF      EK   +DE+ E    A + +DRARGEVP                     
Sbjct: 73  FDRYFSKNESVEKIQSDDEEGETEDIAVSALDRARGEVP-LDYESSSDENSSSESEEESE 131

Query: 124 XXXXXXXXXXXXXNAKPESGDISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAI 183
                         +KPE+GD +K  AVVNLDWDHV+S DL+ TF+SFVP GG I++VAI
Sbjct: 132 DSALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAI 191

Query: 184 YPSEFGKERMQREEVEGPPKELFQXXXXXXXXXXXXXXXXXXXMDIGIKDLYEEGDADKD 243
           YPSEFGKERM+REEVEGPP+ELF+                    DI I DLYE  DA+KD
Sbjct: 192 YPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENS-----DIDINDLYEVDDAEKD 246

Query: 244 VDSXXXXXXXXXXXXXXXXIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFD 303
            DS                +VYCSD  T+KAIY NCDGTE+ESTANMFDLRYVPD M F+
Sbjct: 247 YDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFE 306

Query: 304 DDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKA 363
           DD RD+C  +PK+Y+P QFST ALQHS VKLTWDETPADRVE++KRAF QKEI++MDFKA
Sbjct: 307 DDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKA 366

Query: 364 YLASDSDESDGQVDEEAKNKLKSLVGDFGFNSKKET--PNDEDEEVDMEITFTPALEGGN 421
           YLASDSD S+G+ +E+ KN L+SLV D    + K     +  +EE D+EITFTP LE G+
Sbjct: 367 YLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGD 426

 Score =  127 bits (318), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (80%)

Query: 503 QGTINNKAHFNMNEILRSEKEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAID 562
           + T+NN AHFNMNEI++S+KEK KK RYQ K  IV+D F PDL DPRFKEVFEDHDFAID
Sbjct: 506 KSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAID 565

Query: 563 PTQPEFKGTQAMSKILKERSKRVKNKKR 590
           P+QPEFK T AM +IL+ER++R    K+
Sbjct: 566 PSQPEFKKTPAMKEILEERTRRSSKMKK 593

>NCAS0D00980 Chr4 (190642..191013) [372 bp, 123 aa] {ON} Anc_2.354
           YMR159C
          Length = 123

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 544 DLEDPRFKEVFED-HDFAIDPTQP-EFKGTQAMSKILKERSKRVKNKKRKLG 593
           D+ + RF+E+FED    +I+ ++P   +  Q + K+LKE+ + +K+ K  + 
Sbjct: 13  DIRESRFQELFEDVTTVSIEGSEPTSVQAIQQLQKMLKEKEEEIKSLKEIIA 64

>KLLA0C06028g Chr3 complement(532044..532961) [918 bp, 305 aa] {ON}
           similar to uniprot|Q92328 Saccharomyces cerevisiae
           YOL009C MDM12 Required for normal mitochondrial
           morphology and distribution Mdm12p is a mitochondrial
           outer membrane protein. An Mdm12p homolog exists in S.
           Pombe which confers a dominant negative phenotype when
           expressed in S. cerevisiae
          Length = 305

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/74 (24%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 530 YQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKK 589
           Y KK+  +  +F  D+ DP    + E+    +DP+ P F G +A+ +I   R+ ++  + 
Sbjct: 139 YLKKQLFI--SFLCDVSDP----LLENDKLQVDPSGPNFMGKRALERISLIRNIKIHTEL 192

Query: 590 RKLGGSENNMTNNA 603
            +L   E ++  + 
Sbjct: 193 GQLDQGEGSVLRSV 206

>ACR026W Chr3 (404011..404970) [960 bp, 319 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL266W (DIM1)
          Length = 319

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/63 (25%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 355 EIDDMDFKAYLASDS----DESDGQVDEEAKNKLKSLVGDFGFNSKKETPNDEDEEVDME 410
           EI + ++KAYLA+ +    D++ G + E+ K K+++++ + G + K+    D+ + + + 
Sbjct: 249 EIMEKNYKAYLATTNDAMVDDAKGSLAEQVKQKIETVLAETGLSDKRAGKCDQTDFLKLL 308

Query: 411 ITF 413
             F
Sbjct: 309 YAF 311

>NCAS0A01600 Chr1 (313121..313738) [618 bp, 205 aa] {ON} Anc_5.330
           YHR060W
          Length = 205

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%)

Query: 318 RPHQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQVD 377
           R + F+ D+L+ S     WDE+    + V     T+ E+D +  K  L +D D  DG ++
Sbjct: 63  RANYFNKDSLRGSYGVDYWDESYIGELTVEITGSTRPEVDIIRKKPILKTDDDGDDGSLE 122

Query: 378 EE 379
           E+
Sbjct: 123 EK 124

>AFR468W Chr6 (1281915..1283984) [2070 bp, 689 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR145W (ENP2)
          Length = 689

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 15/18 (83%)

Query: 545 LEDPRFKEVFEDHDFAID 562
           LED RFKE+FED DF +D
Sbjct: 480 LEDERFKEMFEDEDFLVD 497

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 31.6 bits (70), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 545 LEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVKNKKRKLGGSE 596
           L D RFKE+FE+ +F +D T  +FK    + K L+E  +    + R L  +E
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPV-KSLRETEEGAAKRIRALTAAE 527

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,383,953
Number of extensions: 2701573
Number of successful extensions: 13287
Number of sequences better than 10.0: 138
Number of HSP's gapped: 13761
Number of HSP's successfully gapped: 167
Length of query: 628
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 512
Effective length of database: 40,180,143
Effective search space: 20572233216
Effective search space used: 20572233216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 69 (31.2 bits)