Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR363W (ESC2)5.425ON45644319240.0
Smik_4.6285.425ON45844514310.0
Suva_2.5345.425ON45245712851e-175
Skud_4.6315.425ON45844712711e-173
NDAI0B056005.425ON4572976834e-84
NCAS0F033105.425ON4423076814e-84
KAFR0E038705.425ON3962996627e-82
ZYRO0F09812g5.425ON4162766421e-78
TBLA0A037105.425ON4612845371e-62
SAKL0G02266g5.425ON4842845293e-61
Kwal_55.214685.425ON4652844779e-54
KLTH0F16280g5.425ON4732934577e-51
Ecym_55245.425ON4152843417e-35
TPHA0E018105.425ON4531263393e-34
AER251W5.425ON4072743346e-34
Kpol_1027.265.425ON4431963217e-32
CAGL0A02706g5.425ON3691283053e-30
TDEL0E020005.425ON4361193059e-30
KNAG0C049805.425ON3451302666e-25
KLLA0E21275g5.425ON3922822431e-21
KLTH0E00682g5.718ON40772820.14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR363W
         (456 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   745   0.0  
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   555   0.0  
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   499   e-175
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   494   e-173
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   267   4e-84
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   266   4e-84
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   259   7e-82
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   251   1e-78
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   211   1e-62
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   208   3e-61
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   188   9e-54
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   180   7e-51
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   135   7e-35
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   135   3e-34
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   133   6e-34
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   128   7e-32
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   122   3e-30
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   122   9e-30
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   107   6e-25
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    98   1e-21
KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON...    36   0.14 

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/443 (86%), Positives = 385/443 (86%)

Query: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60
           MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV
Sbjct: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60

Query: 61  PPSKHXXXXXXXXXXXXAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKESV 120
           PPSKH            AKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKESV
Sbjct: 61  PPSKHSTLTLSDSEDSDAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKESV 120

Query: 121 VEINSSESDLDEDKNFPXXXXXXXXXXXXXXPAGKYKRQKSSLLYTYDENDDFFKELAKE 180
           VEINSSESDLDEDKNFP              PAGKYKRQKSSLLYTYDENDDFFKELAKE
Sbjct: 121 VEINSSESDLDEDKNFPRSRSRSRSSIRSISPAGKYKRQKSSLLYTYDENDDFFKELAKE 180

Query: 181 AKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKS 240
           AKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKS
Sbjct: 181 AKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLMKS 240

Query: 241 YKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNF 300
           YKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNF
Sbjct: 241 YKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNF 300

Query: 301 XXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLKNVEETQEIKENDT 360
                              RQEMERKLEKKRN             LKNVEETQEIKENDT
Sbjct: 301 EATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEIKENDT 360

Query: 361 VMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLP 420
           VMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLP
Sbjct: 361 VMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLP 420

Query: 421 QKTRVKLLFDHDELDMNECIADQ 443
           QKTRVKLLFDHDELDMNECIADQ
Sbjct: 421 QKTRVKLLFDHDELDMNECIADQ 443

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/445 (65%), Positives = 330/445 (74%), Gaps = 2/445 (0%)

Query: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVT- 59
           MT  S+SI E  INL+ D+TSF+D++SD+FFMDNS+D DEID +D S R+SVIVDSKV+ 
Sbjct: 1   MTRSSKSIGELPINLNSDSTSFTDDSSDNFFMDNSFDEDEIDDNDGSKRRSVIVDSKVSN 60

Query: 60  -VPPSKHXXXXXXXXXXXXAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKE 118
                              A + +    RSS++NVN E  T+PK D PSGRTRGRS MKE
Sbjct: 61  FPSDCLSSPSSSLDNEKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE 120

Query: 119 SVVEINSSESDLDEDKNFPXXXXXXXXXXXXXXPAGKYKRQKSSLLYTYDENDDFFKELA 178
           SVVEIN  ES   +D+                 P GKYKRQKSSLLY YDENDDFFKELA
Sbjct: 121 SVVEINPRESKSIDDEKLHRSRSRSRSSIRSLSPTGKYKRQKSSLLYAYDENDDFFKELA 180

Query: 179 KEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLM 238
           KEAKK+T++SKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS+ILPAALDGL 
Sbjct: 181 KEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLT 240

Query: 239 KSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 298
           KSYKIPKVMKDIYKVENVTLYW NAKLL FMTCNSLHIPQDFENEVSDIDVTIVSKEYEK
Sbjct: 241 KSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 300

Query: 299 NFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLKNVEETQEIKEN 358
           NF                    +E+ERKLE+KRN             L+NV+E QE  EN
Sbjct: 301 NFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELRNVKEKQERTEN 360

Query: 359 DTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQ 418
           +TV+N K LQE  +L  N+S  E+VM+IAL GQDNKKIYV+VRRSTPFSK+AEYYRIQKQ
Sbjct: 361 ETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQ 420

Query: 419 LPQKTRVKLLFDHDELDMNECIADQ 443
           LPQK R+KLLFDHD+LDM+ECIADQ
Sbjct: 421 LPQKARIKLLFDHDKLDMHECIADQ 445

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  499 bits (1285), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 283/457 (61%), Positives = 327/457 (71%), Gaps = 32/457 (7%)

Query: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60
           MTG+S+       N+D +NTS SD++SDDFFMDNS+D  + + SD+SN ++VIV+SK+T 
Sbjct: 1   MTGNSKDSGSALGNIDANNTSLSDDDSDDFFMDNSFDEIDNNQSDDSNERNVIVESKIT- 59

Query: 61  PPSKHXXXXXXXXXXXXAKEQHQSLSRSSSKNVNIE-------------DITEPKPDKPS 107
                            ++  H SL  S  ++ NI              +I +PK DKPS
Sbjct: 60  ----------------DSQPFHLSLPSSEDEDKNISQRSLSDSESASSANIVKPKSDKPS 103

Query: 108 GRTRGRSVMKESVVEINSSESDLDEDKNFPXXXXXXXXXXXXXX-PAGKYKRQKSSLLYT 166
           GRTRGRSV+KESVVEI+SSES   + K +P               P  KYKRQK+SLL T
Sbjct: 104 GRTRGRSVIKESVVEIDSSESKTKK-KEYPHRSRSRSKSSVRSISPEQKYKRQKNSLLNT 162

Query: 167 YDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEF 226
           YDENDDFFKELAKEAKK+T+ISKESTPDQ KRVYNIKF SKLEGTINKAVQVKVLGKYEF
Sbjct: 163 YDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEF 222

Query: 227 SKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSD 286
           S+ILPAALDGLMKSYKIPKVMKDIYK ENVTLYWNNAKLL FMTCNSLHIPQDFENE+SD
Sbjct: 223 SRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISD 282

Query: 287 IDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXL 346
           ID+TIVSKEYEKNF                   RQEME KLEKKRN             L
Sbjct: 283 IDITIVSKEYEKNFEATLESKLKEEETALFAKERQEMEMKLEKKRNEREESEFREFEFEL 342

Query: 347 KNVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPF 406
           +NVEET+E+K N+T MN   L+EG S+  N+   E+VM+IALMGQDNKKIYV+VR STPF
Sbjct: 343 RNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPF 402

Query: 407 SKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQ 443
            K+AEYYRIQKQLPQK R+KLLFDHDEL++NECIADQ
Sbjct: 403 FKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIADQ 439

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  494 bits (1271), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 271/447 (60%), Positives = 326/447 (72%), Gaps = 6/447 (1%)

Query: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60
           M   ++ I+ PSI LD DNTS S + SDDFFM+NS+D DEIDHSDESNRQ+VIVDSKV+V
Sbjct: 1   MINHAKGITGPSIKLDSDNTSISGD-SDDFFMENSFDEDEIDHSDESNRQNVIVDSKVSV 59

Query: 61  PPSKHXXXXXXXXXXXXAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKESV 120
             S++              ++ QS +RSSS++++   + + +P+KPS RTRGRS+ K+S 
Sbjct: 60  SSSRYLSLGSSDEEDDDINQRSQSHNRSSSESLDGRKLIKCRPEKPSDRTRGRSMTKDSA 119

Query: 121 VEINSSESDLDEDKNF----PXXXXXXXXXXXXXXPAGKYKRQKSSLLYTYDENDDFFKE 176
           VE ++ ES  +E K                     P  K+KRQK SL+  YDENDDFFKE
Sbjct: 120 VETSAPES-TNEAKRLHGFRSRSRSRSRSSIRSVSPERKHKRQKCSLVDIYDENDDFFKE 178

Query: 177 LAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDG 236
           LAKEAKK TTISKE TP+Q KRVYNIKFLSKLEGTINKAVQVKVLGKYEFS+ILPAALDG
Sbjct: 179 LAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDG 238

Query: 237 LMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEY 296
           L+KSYKIPKVM  IYKV NVTLYWNNAKLL FMTCNSL+I QDFENE+SDIDVTIVSKEY
Sbjct: 239 LVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEY 298

Query: 297 EKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLKNVEETQEIK 356
           EKNF                   RQE+ERKLEKKRN             L+NV+ETQE++
Sbjct: 299 EKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELRNVKETQELE 358

Query: 357 ENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQ 416
           EN+ ++NTK LQ   SL GN+   E+V+++ALMGQDNKKI+V+VR STP  K+AEYYRIQ
Sbjct: 359 ENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQ 418

Query: 417 KQLPQKTRVKLLFDHDELDMNECIADQ 443
           K+LPQK R++LLFDHDEL+M+EC+ADQ
Sbjct: 419 KRLPQKARIRLLFDHDELNMSECVADQ 445

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  267 bits (683), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 145/297 (48%), Positives = 197/297 (66%), Gaps = 14/297 (4%)

Query: 152 PAGKYKRQKSSLLYTYDENDDFFKELAKEAKKSTTISKESTPDQR-KRVYNIKFLSKLEG 210
           P  K  +  S+L    DEND+FFKE+AKEAKK  +++KESTPD+  KR+YNI+F+SKL+G
Sbjct: 149 PIRKTPKLSSTLQMEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDG 208

Query: 211 TINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMT 270
           T+NK VQVKVLGK++F KILPAAL GL+K+Y IP V++  Y V+NV+LYWN+AKLL FMT
Sbjct: 209 TMNKCVQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMT 268

Query: 271 CNSLHIPQDFENEVSDIDVTIVSK----EYEKNFXXXXXXXXXXXXXXXXXXXRQ-EMER 325
           CNSL+IPQ FENEV+++D+ ++SK    E EK                     ++ E++ 
Sbjct: 269 CNSLNIPQAFENEVTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQE 328

Query: 326 KLEKKRNXXXXXXXXXXXXXLKNVEETQEIKENDTVMNTKLLQEGGSLS---GNSSSMEE 382
           KL K+                  +E   E+K N    +   + E   L+   GN+    +
Sbjct: 329 KLAKEL-AKEEKENEVFEEFEHELENVSELKTNGYDADASTVNEANELALEEGNA----D 383

Query: 383 VMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNEC 439
           VM+IAL+GQDNKKI+V+VR +TPFSK+AEYYRIQKQLPQ  ++KL+FDH+EL + E 
Sbjct: 384 VMKIALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  266 bits (681), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 152/307 (49%), Positives = 195/307 (63%), Gaps = 30/307 (9%)

Query: 157 KRQKSS----LLYTYDENDDFFKELAKEAKKSTTI---SKESTPD-QRKRVYNIKFLSKL 208
           KRQKS+    L    DEND+FFKE+AKEAKK  +I   SKE+TPD Q KRVY+I+FLS+L
Sbjct: 133 KRQKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQL 192

Query: 209 EGTINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTF 268
           +GTINK VQVKVLGK++F KILP  L+GL+KSY IP V++  YKV+NVTLYWNN KLL F
Sbjct: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252

Query: 269 MTCNSLHIPQDFENEVSDIDVTIVS--------KEYEKNFXXXXXXXXXXXXXXXXXXXR 320
           MTCNSL+IPQ FENEV+++D+ I+S         E  K                      
Sbjct: 253 MTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKE 312

Query: 321 QEMERKLEKKRNXXXXXXXXXXXXXLKNVEETQEIK----ENDTVMNTKLLQEGGSLSGN 376
            E  +  E K N             LK+  E ++ +    END  MN         + G+
Sbjct: 313 GEKNKPKESK-NTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMN---------IDGS 362

Query: 377 SSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDM 436
            +    +M+IAL+G DNKKIYV+VR STPFSK+AEYYR+QKQLPQ  +++L+FDHDEL++
Sbjct: 363 DNEKSSIMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNL 422

Query: 437 NECIADQ 443
            E + DQ
Sbjct: 423 EETVGDQ 429

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  259 bits (662), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 145/299 (48%), Positives = 186/299 (62%), Gaps = 43/299 (14%)

Query: 157 KRQKSSLLYTY---DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTIN 213
           KRQKS +  T    DENDDFFKELA  A+K +    ES   + KR+YNI+F+SKL+G+IN
Sbjct: 116 KRQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSIN 175

Query: 214 KAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNS 273
           K+V+VKVLGK+ FSKILPAAL GL+ +YKIP +M +IY VENV LYWNNAKLL FMTC+S
Sbjct: 176 KSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDS 235

Query: 274 LHIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNX 333
           L IP  FENE+S++D+ IVSKE+ +                      QE E KLE++   
Sbjct: 236 LSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTL-----------QE-EAKLERQ--- 280

Query: 334 XXXXXXXXXXXXLKNVEETQEIKENDTVMNTKLLQE---------GGSLSGNSSSMEEVM 384
                           EE +++ E D  +  +   E           SL  +    E +M
Sbjct: 281 ----------------EEIKDVDEGDDFVLKEFEAELRDVAPSNANLSLDTDGEDSEPLM 324

Query: 385 RIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQ 443
           ++ALMGQDNKKIYV+VR ST  SK+ EYY+ QK L +  +VKLLFDHDELD+NE + DQ
Sbjct: 325 KLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNETVGDQ 383

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  251 bits (642), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 127/276 (46%), Positives = 180/276 (65%), Gaps = 22/276 (7%)

Query: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227
           DEND+FFK++AK+   +   ++E+TP+Q +R+YN++FLSKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209

Query: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287
            +LP+ L+G ++ YKIP VMK IY  ENVTLYW  AKLL FMTCNSL IPQ FENE+SDI
Sbjct: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269

Query: 288 DVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLK 347
           D+T++ KE E  F                        R LE ++N             ++
Sbjct: 270 DITVIPKEKENEFEQMINS------------------RLLEDEQNPPDTAETGNLDARVE 311

Query: 348 NVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFS 407
             E  +E+K  D         E   L     +  ++M+IAL+G+DNKKI+V+VR +T  +
Sbjct: 312 EFE--KELKNVDNSTTNHETTELIDLEDEGDT--DLMKIALVGEDNKKIFVNVRNTTILT 367

Query: 408 KIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQ 443
           K+AEYYRI+K+LP+   +KL+FDH+EL++NE I DQ
Sbjct: 368 KVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQ 403

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  211 bits (537), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 177/284 (62%), Gaps = 33/284 (11%)

Query: 173 FFKEL--AKEAKKSTTISKE--STPDQR--KRVYNIKFLSKLEGTINKAVQVKVLGKYEF 226
           FFK L  +     S+T+  +  +T DQ   KR+YN++F+SK+EGT++K VQVKVLGK+ F
Sbjct: 185 FFKALKHSSSVPPSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLGKFPF 244

Query: 227 SKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSD 286
           SKILP AL    + YKIP V+K  Y+V NVTLYWN++KLL FMTCNSL+IPQ +ENE+SD
Sbjct: 245 SKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENEISD 304

Query: 287 IDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXL 346
           +++ +++K  EK++                   +Q +E+ L +K N              
Sbjct: 305 VEIIVITKTNEKSY-----------EDKINMSLKQNIEQNLAQKSNEIKELRKLKVESFE 353

Query: 347 KNV--EETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEV-----MRIALMGQDNKKIYVH 399
            N   E  +E+KE         L + G  +  +++++++     ++IAL+ QDNKK+YV 
Sbjct: 354 HNSIQEFEKELKE---------LSQDGVDTKQTANIDDIPNESHIKIALLTQDNKKLYVK 404

Query: 400 VRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQ 443
           VR STPFS++  Y+R QKQL +  ++KL+FD++ELD+NE + DQ
Sbjct: 405 VRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLNETVGDQ 448

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  208 bits (529), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 171/284 (60%), Gaps = 41/284 (14%)

Query: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227
           D+ D FF E+ + A +++T+ +ES+P+  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280

Query: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287
           KILP+ LD ++K+Y+IPK ++++YK++NVTLYWN AK+L FMTCNSL IPQ++ +E++D+
Sbjct: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340

Query: 288 DVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLK 347
           D+T+VSKEYE  +                   ++ +E +L                  +K
Sbjct: 341 DITLVSKEYEMKY---------------EAEFKEMVENEL------------SGSSVDVK 373

Query: 348 NVEETQEIKENDTVMNTKLLQEGGSLSGNSSSME--------EVMRIALMGQDNKKIYVH 399
           NV      K++D   N   LQ   S S   S ++          +++AL+GQDNKK++V 
Sbjct: 374 NV------KKDDFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVK 427

Query: 400 VRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQ 443
            R ST F KIA+YY+  K LP  T++KL FDH  L + + + D 
Sbjct: 428 ARSSTLFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLEDRVEDH 471

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  188 bits (477), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 164/284 (57%), Gaps = 30/284 (10%)

Query: 162 SLLYTYDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVL 221
           SL    +E++ FF+EL +EA ++T+  KE +P   KRVYNIKFLS LEG++N  + VKV 
Sbjct: 195 SLAAEDNEDEKFFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVK 254

Query: 222 GKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFE 281
           GK+ FS+ILP AL  L+K YK+ K +K  Y+ ENV+LY N  K+L FM CNSLHIP ++E
Sbjct: 255 GKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYE 314

Query: 282 NEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXX 341
            EVSD+ +T+VS++ E                       QE  + LE+ R+         
Sbjct: 315 GEVSDVSMTLVSRDRE-----------------------QEYVKTLEQSRHATPDLSREE 351

Query: 342 XXXXLKN--VEETQEIKEN-DTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYV 398
               +    +EE ++  E  ++  +  LL++      N  ++    +IALM QDNKKIYV
Sbjct: 352 TSPKIPGFSIEEFEKDLEGFESGESNNLLEDTPQTENNHGTI----KIALMAQDNKKIYV 407

Query: 399 HVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIAD 442
           +VR++T  + + E+YR  K L    R K +FD+++L ++  I D
Sbjct: 408 NVRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQLSTKIDD 451

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  180 bits (457), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 160/293 (54%), Gaps = 25/293 (8%)

Query: 152 PAGKYKRQKSSLL--YTYDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLE 209
           P G  +  +++ L  +  DE+D FF+EL +EA ++ +  KES+P   +R+YNIKF+S LE
Sbjct: 188 PRGSSRAVRTNSLPQHEKDEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLE 247

Query: 210 GTINKAVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFM 269
           G+  + + VKV GK  F +ILP AL  ++K YKIP  +  IY+ + VTLY +  K+L FM
Sbjct: 248 GSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFM 307

Query: 270 TCNSLHIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEK 329
            CNSL IP +F+ EVSD+ +TI+SK  E+NF                     E+     +
Sbjct: 308 NCNSLQIPLEFKGEVSDVCLTIISKGQEQNF---------EALYEQSKHSNHELVPAFIE 358

Query: 330 KRNXXXXXXXXXXXXXLKNVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALM 389
                           L+NV    +  +N +V N    Q          S+++ +RIALM
Sbjct: 359 PGTETPDFTVEEYEKELRNV----DFNKNTSVQNQPPPQ----------SVDDNIRIALM 404

Query: 390 GQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIAD 442
            QDNKKI V  R  T F+ +AE+Y+    LP + +V L FD++EL ++  ++D
Sbjct: 405 SQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHLDSKVSD 457

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  135 bits (341), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 148/284 (52%), Gaps = 36/284 (12%)

Query: 173 FFKELAKEAKKSTTIS-----KESTPDQRK---RVYNIKFLSKLEGTINKAVQVKVLGKY 224
           F  E+ +EA++++++      K  + + ++    +YN+ F+SKLEG+ NK + V++ GK 
Sbjct: 136 FLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRINVRITGKK 195

Query: 225 EFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEV 284
           +FS  LP AL   +K YKI   + D Y+++NV +Y    ++  FMTC+S +I + + +  
Sbjct: 196 KFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSS 255

Query: 285 SDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXX 344
            DI+V IV  E    F                   +Q++E K+++               
Sbjct: 256 IDIEVYIVPNELASEF---------------EIQWKQKIETKMKRVSISASPVDLDSDGI 300

Query: 345 XLKN----VEETQEIKENDTVMNTKLLQEGGSLS----GNSSSMEEVMRIALMGQDNKKI 396
              N    V E ++   N   ++   +Q    +S    GN     E++++ L+G DNKK+
Sbjct: 301 EFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGN-----ELIKVVLLGSDNKKV 355

Query: 397 YVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECI 440
           YV+V+ +T F K+AE+YR  K+LP  T++ L FDHD++D +  I
Sbjct: 356 YVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTI 399

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  135 bits (339), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 90/126 (71%)

Query: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227
           D +D+FFK + + +K+ +T+S   TP+   R YNI ++SKL G+  + +Q KVLG   F+
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287
           K+LP  L+ L+K  KIP  ++ +YK ENVTLYWN +KLL FM C+SL IPQ ++NE+S++
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 288 DVTIVS 293
           ++ ++S
Sbjct: 272 EIILIS 277

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 49/75 (65%), Gaps = 5/75 (6%)

Query: 373 LSGNSSSMEE-----VMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKL 427
           +S N SS++E     V++I+LM  DNKKI+V+VR ST   K+ +Y++  K L    R+K+
Sbjct: 365 ISDNESSIKEHGTSNVIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKV 424

Query: 428 LFDHDELDMNECIAD 442
           +FDHD L ++  I D
Sbjct: 425 IFDHDVLSLDSMIGD 439

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  133 bits (334), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 141/274 (51%), Gaps = 29/274 (10%)

Query: 176 ELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALD 235
           EL+       T + +   D   RVYN+ F+S++EG+ N+ V VKV G+ +F+  L  AL 
Sbjct: 142 ELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALA 201

Query: 236 GLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKE 295
              K + I K +K  Y+ + V +Y    ++  FMTC+S +I + +    +DI+V IV  +
Sbjct: 202 AFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVD 261

Query: 296 YEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEKKRNXXXXXXXXXXXXXLKN------V 349
               F                    QE +RK E++               +++      V
Sbjct: 262 EATAF-------------------EQEWKRKFEERVRMLSNSSFLEVMDDIEDDNDDFLV 302

Query: 350 EETQEIKENDTVMN-TKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSK 408
            E ++   N   +N T+L    G+ +  SS   ++++I L+G DNKK+++HVR +T   K
Sbjct: 303 NEYEKALVNARSLNETELAVREGTPADESS---QLLKIVLLGSDNKKVFIHVRPTTTLLK 359

Query: 409 IAEYYRIQKQLPQKTRVKLLFDHDELDMNECIAD 442
           +AE+YR+ K+LP   ++ L+FDH+E+D+++ I +
Sbjct: 360 VAEHYRVAKELPPTVQLSLMFDHEEIDLDDTICN 393

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  128 bits (321), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 108/196 (55%), Gaps = 22/196 (11%)

Query: 119 SVVEINSSESDLDEDKNFPXXXXXXXXXXXXXXPAGKYKRQKSSLLYTY----------- 167
           S+ EI+S E D   DK F                  K KR K  L  T            
Sbjct: 93  SIHEIDSYEEDTSSDKEFSVVEKNIE--------GSKSKRNKRWLDRTVSREEPSKRQKY 144

Query: 168 ---DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKY 224
              +ENDDF K +   +   T +   ++     R+YNI F SKL+G+++K +Q +VLGK 
Sbjct: 145 EEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQ 204

Query: 225 EFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEV 284
           +FS+I+   LD   K YK+ +V K  YK + VT+YW+ AKLL FMTCNSL IP +F++E+
Sbjct: 205 QFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEI 264

Query: 285 SDIDVTIVSKEYEKNF 300
           S I++TI+SKE E+ F
Sbjct: 265 SHIELTIISKENEQQF 280

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 49/61 (80%)

Query: 383 VMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIAD 442
           ++++AL+G DNKKI+V+ R +T F K+AEYY + ++LP+ T+VKL+FD +++D++  + D
Sbjct: 369 IVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMVKD 428

Query: 443 Q 443
           Q
Sbjct: 429 Q 429

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 90/128 (70%), Gaps = 1/128 (0%)

Query: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227
           DEND FF+ +AK ++ S  +   S   ++ +VY ++F+S ++GT  K+VQVK LG + FS
Sbjct: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180

Query: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287
           K++ AAL GLM+++++P VM+ +Y+ E+V  YWN AK+L FMTC++L +PQ + ++  +I
Sbjct: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240

Query: 288 DVTIVSKE 295
            +  V +E
Sbjct: 241 QLVPVKEE 248

 Score = 74.3 bits (181), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 47/63 (74%)

Query: 381 EEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECI 440
           EEV+R+AL GQDNKK+YV+V+ +T F+++ EYYR QKQLP+ T++ L  D + LD +  +
Sbjct: 294 EEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPHATV 353

Query: 441 ADQ 443
             Q
Sbjct: 354 KSQ 356

 Score = 31.2 bits (69), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 16/19 (84%)

Query: 22 FSDENSDDFFMDNSYDIDE 40
          FSDE+SD+FFM  S D++E
Sbjct: 3  FSDEDSDEFFMGTSEDVEE 21

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  122 bits (305), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 57/119 (47%), Positives = 86/119 (72%)

Query: 176 ELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALD 235
           E  +E ++ +T S       R++++N+ FLSKLEGT+++A+Q+KVLGKY+F+ IL + L+
Sbjct: 167 EPVEETRQMSTSSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLE 226

Query: 236 GLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSK 294
            +++ +KIP  +   Y V+NVTLYWN  KLL FMTC+SL I     NEV++I+VT+VSK
Sbjct: 227 RVVEEFKIPYPVMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSK 285

 Score = 92.0 bits (227), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 53/62 (85%)

Query: 382 EVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIA 441
           EV+++AL+GQDN ++YV+VRRSTPFSK+AEYY++ K LP + ++ L FDH++LD+NE + 
Sbjct: 363 EVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLNETVG 422

Query: 442 DQ 443
           DQ
Sbjct: 423 DQ 424

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  107 bits (266), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 80/130 (61%), Gaps = 11/130 (8%)

Query: 168 DENDDFFKELAK------EAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVL 221
           D+ + FF+EL +      E  ++ T S   +P     VY ++F S+LEGT+ K+VQVKV+
Sbjct: 99  DDEEQFFQELLRARTQSVEPAETATTSTVPSP-----VYRVRFQSQLEGTLGKSVQVKVI 153

Query: 222 GKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFE 281
           G      +LP+ L  L+++ ++P+V++  Y    V +Y   A++L FM CNSL + Q+FE
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 282 NEVSDIDVTI 291
           NEV ++DV +
Sbjct: 214 NEVLEVDVVL 223

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 36/52 (69%)

Query: 383 VMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDEL 434
           +M+IAL+  DN+++YV V   TP S++ EYYR+++ LP    ++L  D +++
Sbjct: 273 LMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQV 324

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 125/282 (44%), Gaps = 18/282 (6%)

Query: 155 KYKRQKSSLLYTYDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINK 214
           ++K  ++  + T DE  DF KE+   AK        +     KR+YNI F+S LEG+ +K
Sbjct: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHA--DTHNNGKVTKRIYNINFISTLEGSQDK 164

Query: 215 AVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSL 274
            V VKV G   F  ILP  +   ++SYKIP+ ++  Y    + L+    ++L F  C+SL
Sbjct: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224

Query: 275 HIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXRQEMERKLEK-KRNX 333
            IP+      + +D+ IV      N+                     E +  LE+  R+ 
Sbjct: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDE 284

Query: 334 XXXXXXXXXXXXLKNVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDN 393
                        K  E T ++ +         L +    S NS      +R+ L+ + N
Sbjct: 285 KFKLFEKELESAPKLAERTDDVID---------LLDSDIESSNS------IRLTLIDKAN 329

Query: 394 KKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELD 435
           K+  + V  +T F++IA  Y+    L +   V L+FD++EL+
Sbjct: 330 KRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

>KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON}
           highly similar to uniprot|P27796 Saccharomyces
           cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with
           broad chain length specificity cleaves 3-ketoacyl-CoA
           into acyl- CoA and acetyl-CoA during beta-oxidation of
           fatty acids
          Length = 407

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%), Gaps = 5/72 (6%)

Query: 211 TINKAVQVKVLGKYEFSKIL--PAALDGLMKSYKIPKVMKDI-YKVENVTLY-WNNAKLL 266
           +I +++++ +LGKY   +++  P  + G+  +Y IPKV+KD    +E V ++  N A   
Sbjct: 279 SIAESMELPILGKYVACQVIGVPPEIMGVGPAYAIPKVLKDCGLAIEKVDVFEINEAFAG 338

Query: 267 TFMTC-NSLHIP 277
             + C N L IP
Sbjct: 339 QALYCINKLQIP 350

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,708,393
Number of extensions: 1866026
Number of successful extensions: 8647
Number of sequences better than 10.0: 50
Number of HSP's gapped: 8900
Number of HSP's successfully gapped: 62
Length of query: 456
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 343
Effective length of database: 40,524,141
Effective search space: 13899780363
Effective search space used: 13899780363
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)