Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR320C (SWA2)5.352ON66866832640.0
Smik_4.5795.352ON66766822810.0
Skud_4.5865.352ON64266820430.0
Suva_2.4895.352ON65966820350.0
NDAI0C043205.352ON70672011421e-146
TDEL0E027505.352ON56458810591e-136
ZYRO0D10186g5.352ON63570310531e-134
KAFR0C018505.352ON64661710461e-133
CAGL0H07095g5.352ON66154910271e-130
KNAG0C055005.352ON58568010211e-130
Kpol_339.135.352ON68660210181e-128
NCAS0F028705.352ON70031010131e-127
SAKL0G08822g5.352ON5825628521e-105
TBLA0H019705.352ON8403118094e-96
TPHA0E011105.352ON6933837933e-95
Kwal_34.159775.352ON5975657847e-95
KLLA0B10197g5.352ON6216947841e-94
KLTH0H14872g5.352ON6235957465e-89
AGR352C5.352ON6485756724e-78
Ecym_81815.352ON6613156701e-77
NCAS0B070102.152ON6251131039e-04
TDEL0B051402.152ON599115990.003
NCAS0H008306.21ON33882950.006
Kpol_1028.516.328ON11767890.007
ZYRO0G06512g2.152ON604111950.009
NCAS0G024802.152ON596111930.016
YCR060W (TAH1)6.328ON11169850.017
KAFR0F007202.152ON608112910.023
Kpol_1048.212.152ON597111900.030
NDAI0B043402.152ON664116890.045
CAGL0L12936g2.152ON600115890.046
Skud_3.1356.328ON11870820.058
CAGL0L04048g2.152ON587113870.079
TBLA0I023106.328ON116119800.089
Ecym_61784.126ON35098830.20
Smik_14.2072.152ON617111820.28
KLTH0H02068g7.313ON370153810.32
Suva_3.956.328ON11169760.33
KNAG0H035302.152ON614111810.37
YBL084C (CDC27)7.412ON758123810.41
YNL121C (TOM70)2.152ON617111800.51
NDAI0F028102.152ON609111790.61
Smik_2.367.412ON751123790.63
NDAI0I004406.328ON12872740.67
TPHA0D038606.328ON12072740.69
Skud_2.247.412ON769123790.69
Suva_14.2192.152ON617111790.74
NCAS0E024907.412ON809127780.82
Skud_15.1686.21ON348121770.85
Suva_2.347.412ON763123780.87
Ecym_20906.328ON17264750.87
Kwal_27.107407.412ON628122780.93
SAKL0A01672g6.328ON12869730.95
TPHA0I015102.152ON603111780.97
Suva_12.1141.456ON370171761.2
YOR007C (SGT2)6.21ON34687751.7
TDEL0C027207.412ON700123761.7
Skud_14.2112.152ON617111761.7
Kpol_1018.1067.412ON75372751.8
Smik_10.3061.456ON394141742.0
KAFR0J025706.328ON12134702.2
KLTH0E02178g5.617ON593134752.2
Smik_3.1596.328ON11594692.7
Ecym_55825.617ON584124724.4
CAGL0C03553g6.369ON440121724.4
Smik_15.1766.21ON34587715.2
TBLA0E019907.313ON374163715.4
Suva_5.2768.197ON24056705.9
KLLA0A07062g5.617ON581114716.1
Skud_10.2511.456ON393144707.0
Ecym_33512.313ON294163707.0
SAKL0D05148g1.256ON753117717.1
KLLA0C08910g6.328ON11569667.6
Kwal_33.147672.152ON594110708.5
AFR001W4.126ON35079698.6
AAR054C6.328ON133100668.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR320C
         (668 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...  1261   0.0  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...   883   0.0  
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...   791   0.0  
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...   788   0.0  
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...   444   e-146
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...   412   e-136
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...   410   e-134
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...   407   e-133
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...   400   e-130
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...   397   e-130
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...   396   e-128
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...   394   e-127
SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} simila...   332   e-105
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...   316   4e-96
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...   310   3e-95
Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320...   306   7e-95
KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {...   306   1e-94
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...   291   5e-89
AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}...   263   4e-78
Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar t...   262   1e-77
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    44   9e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    43   0.003
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    41   0.006
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    39   0.007
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    41   0.009
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    40   0.016
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    37   0.017
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    40   0.023
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    39   0.030
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    39   0.045
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    39   0.046
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    36   0.058
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    38   0.079
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.089
Ecym_6178 Chr6 (328935..329987) [1053 bp, 350 aa] {ON} similar t...    37   0.20 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    36   0.28 
KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {...    36   0.32 
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    34   0.33 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    36   0.37 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    36   0.41 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    35   0.51 
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    35   0.61 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.63 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.67 
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    33   0.69 
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    35   0.69 
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    35   0.74 
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    35   0.82 
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    34   0.85 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    35   0.87 
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    33   0.87 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    35   0.93 
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    33   0.95 
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    35   0.97 
Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032...    34   1.2  
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    33   1.7  
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    34   1.7  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    34   1.7  
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    33   1.8  
Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032...    33   2.0  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   2.2  
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    33   2.2  
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    31   2.7  
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    32   4.4  
CAGL0C03553g Chr3 complement(354713..356035) [1323 bp, 440 aa] {...    32   4.4  
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    32   5.2  
TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.3...    32   5.4  
Suva_5.276 Chr5 (436636..437358) [723 bp, 240 aa] {ON} YER148W (...    32   5.9  
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    32   6.1  
Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032...    32   7.0  
Ecym_3351 Chr3 complement(665793..666677) [885 bp, 294 aa] {ON} ...    32   7.0  
SAKL0D05148g Chr4 (407168..409429) [2262 bp, 753 aa] {ON} simila...    32   7.1  
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    30   7.6  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    32   8.5  
AFR001W Chr6 (437333..438385) [1053 bp, 350 aa] {ON} Syntenic ho...    31   8.6  
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    30   8.7  

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/668 (94%), Positives = 628/668 (94%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP
Sbjct: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60

Query: 61  LIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDTIQKPD 120
           LIPSPKVDFSAPPLV                 ALANTDDDFNQLFGMGTVTTTDTIQKPD
Sbjct: 61  LIPSPKVDFSAPPLVPTNSTTKSNTANNTPPSALANTDDDFNQLFGMGTVTTTDTIQKPD 120

Query: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180
           EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK
Sbjct: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180

Query: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240
           QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN
Sbjct: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240

Query: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300
           DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT
Sbjct: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300

Query: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360
           KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT
Sbjct: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360

Query: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420
           DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA
Sbjct: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420

Query: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480
           SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480

Query: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQN 540
           ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFIN                       QN
Sbjct: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINPPPVKKSMPVKKKTTTTSPATKKQN 540

Query: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600
           LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL
Sbjct: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600

Query: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660
           TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK
Sbjct: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660

Query: 661 FKLQNDIN 668
           FKLQNDIN
Sbjct: 661 FKLQNDIN 668

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score =  883 bits (2281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/668 (68%), Positives = 527/668 (78%), Gaps = 1/668 (0%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           MSDPFAHLLTS KNKDSA+ SK+ T +SSNSPS+  S VAD+++TDK+ NDSLHSISA P
Sbjct: 1   MSDPFAHLLTSFKNKDSAAESKKETLRSSNSPSLPDSVVADISKTDKTINDSLHSISASP 60

Query: 61  LIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDTIQKPD 120
           LIPS KV FS PPLV                  L + DDDFN+LFG GT   TDT+QK +
Sbjct: 61  LIPSSKVGFSVPPLVSSNNTISANSTNSSPRPPLDHIDDDFNELFGNGTTAATDTLQKVN 120

Query: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180
           +DY  + E    NGD+ALVDEVKDMEIARLMSLGLSIE+AT+FY +D+TYERYL++LKS 
Sbjct: 121 DDYCRNNEGRKSNGDEALVDEVKDMEIARLMSLGLSIEKATKFYNDDITYERYLKVLKSN 180

Query: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240
           QK+  D   R+    +  E+S LSN  G+++NNLFS+AT+FFNKGK+LVDQWTSFPPE N
Sbjct: 181 QKKSKDRTARESPGDVNFERSELSNNFGSENNNLFSIATNFFNKGKELVDQWTSFPPEEN 240

Query: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300
           DRLNN+    +K EDYD P  ND  N    ED++  + L   +N D+DLLTDFETKI+IT
Sbjct: 241 DRLNNHPNLRNKSEDYDSPLENDPYNGFSIEDDKSEKGLLSENNLDEDLLTDFETKIEIT 300

Query: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360
           KRT  DV  S SP+SGILIEEN  R EPL+E++LLDFSEGN+T S S+E ++LFN N N 
Sbjct: 301 KRTVSDVDPSPSPSSGILIEENPLRKEPLVENNLLDFSEGNVTKSNSSESNSLFNGNRNP 360

Query: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420
           +S IPISDIELSGYNEFKAKG++ FKNGDY+NSLQEYEKSLN+LP NHPLRIIALSNIIA
Sbjct: 361 NSAIPISDIELSGYNEFKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIA 420

Query: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480
           SQLK+GEYSKSIENSSMAL LFP +KA W N IS+SDP+RSFNDIWPKIMIRRAESFEHL
Sbjct: 421 SQLKVGEYSKSIENSSMALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHL 480

Query: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQN 540
           ESF  ALETYQELI KNFFD+KIMQGKRRCQ+FIN                         
Sbjct: 481 ESFSNALETYQELINKNFFDEKIMQGKRRCQNFINPPPVKKFSPVKKATSTQSPTEKSTP 540

Query: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600
            ++SS++S  S D+TS+IKK+ELENAKLALYDKVFE+ISSWK+ K DDIRHLLANLS LL
Sbjct: 541 TSSSSTSS-NSPDTTSKIKKQELENAKLALYDKVFERISSWKNDKGDDIRHLLANLSGLL 599

Query: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660
           TWCNWKD+ MQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAEN+FS+LSIAWDK
Sbjct: 600 TWCNWKDIPMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENVFSSLSIAWDK 659

Query: 661 FKLQNDIN 668
           FK QNDIN
Sbjct: 660 FKQQNDIN 667

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/668 (63%), Positives = 492/668 (73%), Gaps = 26/668 (3%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           MSDPFAHLL SLKNKDSA+  KETT QS++ PS +GS V DV +TDK   +SLHS+SA P
Sbjct: 1   MSDPFAHLLASLKNKDSATEFKETTSQSTDLPSSSGSVVPDVLKTDKGNYESLHSVSAWP 60

Query: 61  LIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDTIQKPD 120
           LIP  KV FSA PLV                 A  N DDDF+++FG   +  T  +Q+  
Sbjct: 61  LIPPSKVSFSAAPLVPSNSTSSANTASNTPSPAPVNIDDDFDEIFGSDAIAATGGLQQ-- 118

Query: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180
                       +GDDALVDEVKDMEIARLMSLGLS+++ATEFY +D+TYERYLEILKSK
Sbjct: 119 ---VDQDSHDDDDGDDALVDEVKDMEIARLMSLGLSVQKATEFYNDDITYERYLEILKSK 175

Query: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240
           QK+  D   R+K + IK++K GL N   +D+NNL S+ATDFFNKGK+L+DQWTSFPPE N
Sbjct: 176 QKKHRDRIAREKSNDIKIKKPGLFNNTDSDNNNLLSIATDFFNKGKELMDQWTSFPPEEN 235

Query: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300
           +RL ++    D+  DYDL            E+N         DN D+DLLTDFE KIDIT
Sbjct: 236 NRLKSHLNLEDESNDYDLS----------LEENPCNSG---GDNLDEDLLTDFEAKIDIT 282

Query: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360
           KR + +V+ S SP+  I I+E+S + E  ++DSLLDFS  N T S S E++TLF E+SN 
Sbjct: 283 KRASKNVASSPSPSFDIPIDEDSGKKESSMDDSLLDFSPENFTKSDSTENNTLFGESSNA 342

Query: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420
            S +PISDIELSGY+EFKAKG +LFKNGDY+NSLQEYEK+LN+LP NHPLRII LSNIIA
Sbjct: 343 VSVVPISDIELSGYSEFKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIA 402

Query: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480
           SQLK+GEYSKSI NS +AL LFP +KA W NKISNSDP+RSFNDIWPKIMIRRAESFEHL
Sbjct: 403 SQLKVGEYSKSIVNSDLALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHL 462

Query: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQN 540
           ESFK ALETYQELI +NFFDDKIMQGKRRCQ+FI+                         
Sbjct: 463 ESFKNALETYQELISRNFFDDKIMQGKRRCQNFISPPLVRKSTPVKKTTPTLKK------ 516

Query: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600
              +   SP  +D  S++K++ELENAKLALYDKVF KI +WK GK+DDIRHLL+NLS LL
Sbjct: 517 --PAPDPSPAPIDIPSKVKEQELENAKLALYDKVFGKIGTWKGGKEDDIRHLLSNLSQLL 574

Query: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660
           TWCNWKDVSMQDLVMPK+VKI YMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK
Sbjct: 575 TWCNWKDVSMQDLVMPKKVKIAYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 634

Query: 661 FKLQNDIN 668
           FK QNDIN
Sbjct: 635 FKQQNDIN 642

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score =  788 bits (2035), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/668 (62%), Positives = 498/668 (74%), Gaps = 9/668 (1%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           MSDPFAHLLTSLKNKDS + SK+TTPQ+ +  + + + VA  A T +  ND LHS SA P
Sbjct: 1   MSDPFAHLLTSLKNKDSGTESKKTTPQTKDFTATSATVVASAATTTQGNNDGLHSFSASP 60

Query: 61  LIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDTIQKPD 120
           +IP+  V FS  PLV                 + AN +DDFN+LFG  T+ T + +Q+ D
Sbjct: 61  MIPASNVSFSVAPLVPSNSNSNANSASNTPTPSPANIEDDFNELFGSNTMATANELQQVD 120

Query: 121 EDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSK 180
           ++YYG+  D  ++GD  LVDEVKDMEIARLMSLGLSIE+AT+FY +DVTYE+YLEI K K
Sbjct: 121 QNYYGN-SDGSHDGDGVLVDEVKDMEIARLMSLGLSIEKATDFYNSDVTYEKYLEISKLK 179

Query: 181 QKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEAN 240
           QK+  D     + +G   + + L N    ++NNLFSMATDFFNKGK+LVDQWTSFPPEAN
Sbjct: 180 QKKHKDRIASHRPTGSSSKNASLFNNASPNNNNLFSMATDFFNKGKELVDQWTSFPPEAN 239

Query: 241 DRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDIT 300
           DRL+NY    DK++ Y+LP  NDS +  L +  E  ++L   ++ D DLLTDFETKIDIT
Sbjct: 240 DRLSNYVNVEDKLDHYELPLENDSYDGSLPQRKEDEKDLLGGNDLDDDLLTDFETKIDIT 299

Query: 301 KRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNT 360
           K+ A D + S SP  GIL+E+  R+ EP  ED+LLDFS  N++   S  +S +  E+ NT
Sbjct: 300 KKDAKDTTPSPSPPPGILVEDALRKEEPQREDNLLDFSTDNIS---STNNSAISREDGNT 356

Query: 361 DSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIA 420
           +   PISDIELSGYNEFKAKGTSLFKNGDY+NSLQEYEKSLN+LPL HPLRIIALSNIIA
Sbjct: 357 NPVAPISDIELSGYNEFKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIA 416

Query: 421 SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHL 480
           SQLKIGEYSKSIENS  AL LFP++K+ W +KIS SDP+RS+NDIWPKIMIRRAESFEHL
Sbjct: 417 SQLKIGEYSKSIENSDTALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHL 476

Query: 481 ESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQN 540
           ESFK ALETYQEL+ +NFFDDKIMQGKRRCQDF+N                         
Sbjct: 477 ESFKNALETYQELVTRNFFDDKIMQGKRRCQDFVNPAPARKPSPVKKTTPTPAPMKK--- 533

Query: 541 LTASSSNSPISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLL 600
              +S+ SP  VD+ S +K++ELENAKLALYD V +KI  WK GKDDDIRHLLANLS LL
Sbjct: 534 --PTSTPSPAPVDNASRVKEQELENAKLALYDNVSDKIGCWKCGKDDDIRHLLANLSGLL 591

Query: 601 TWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDK 660
           TWCNWKDVS+Q+LVMPK+VKITYMKAVAKTHPDKIP+SLSLENKMIAEN+F+TLS AWDK
Sbjct: 592 TWCNWKDVSVQELVMPKKVKITYMKAVAKTHPDKIPKSLSLENKMIAENVFTTLSFAWDK 651

Query: 661 FKLQNDIN 668
           FK QNDIN
Sbjct: 652 FKQQNDIN 659

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score =  444 bits (1142), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 291/720 (40%), Positives = 406/720 (56%), Gaps = 66/720 (9%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVA-RTDKSPNDSLHSISAP 59
           MSDPFA LLTS KN  + + +  TT   +   S T  + + +    +K+   SL + +  
Sbjct: 1   MSDPFASLLTSFKNGQNTTNNNTTTDTDTKKLSATTPSQSSIQFNLNKASTPSLDTFALA 60

Query: 60  PLIPSPK------VDFSAPPLVXXXXXXXXXXXXXXXXXAL-ANTDDDFNQLFGMGTVTT 112
           PLIPS +         ++PPL+                 +  A   DD +  F +   T+
Sbjct: 61  PLIPSSRDASKSNSRVTSPPLIEDDFSDLFNSNEQKNITSPPAPKKDDIDSAFDI--FTS 118

Query: 113 TDTIQKPDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYER 172
           T  +++  + +    E      ++ +VDEVKDME+ARLMSLGLSI++A ++Y+  + YE 
Sbjct: 119 TPPLEQQQQQHGLVTEHEKDYEEEIIVDEVKDMEVARLMSLGLSIDQANKYYDKGILYED 178

Query: 173 YLEILKSK----QKERNDLAIRKKESGIKME-------KSGLSNIVGTDSNNLFSMATDF 221
            +   + K    Q  RN    + K +  K          +   N    ++ NLFSMATD 
Sbjct: 179 IIRKQREKKLKQQSPRNKNNAQDKNNTQKYSDLFDNTYANKRFNESQNNTGNLFSMATDI 238

Query: 222 FNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSPNRI----LFEDNEVVE 277
             KGK+LVDQ T++P E N+RL  Y +  D  E+  L + + SP       L   +    
Sbjct: 239 LYKGKELVDQLTAYP-EENNRLYKYREPIDNEENPFLQEGSRSPASARSPSLSGSHVASA 297

Query: 278 NLPPADNP-------------DQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSR 324
           +  P+  P             +  L+ DF+ K+ I  +  P ++ +  P+      E + 
Sbjct: 298 SAKPSSKPSYVERNSLKYEDNNTTLIDDFDYKLTINSK-EPSMAKNIPPSITPDTTETNN 356

Query: 325 RNEPLIEDSLLDF---------SEGNLTNSKSNEDSTLFNENSN-----TDSTIPISDIE 370
            N      +LLDF            N++ +K N  S+     S      T +T+PIS IE
Sbjct: 357 NN------ALLDFDGLSTVTAPGSSNISVNKKNTSSSSATSPSPSPASITIATVPISHIE 410

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSK 430
           LSG+ EFK +G+ LFKNGDY+++LQEYEKSLNTLP  HPLRII+ SNIIA+QLKIGEYSK
Sbjct: 411 LSGHIEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSK 470

Query: 431 SIENSSMALELFPSSK--AKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALE 488
           SIE+  +AL LFP  K  + W   I +S P+RSF DIW K+++R+AES+EHLE++K AL+
Sbjct: 471 SIEDCKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALD 530

Query: 489 TYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNS 548
           +YQ+LI+  F + KIM GKRRCQ  +N                       ++ T +S   
Sbjct: 531 SYQKLIENGFTNSKIMDGKRRCQKILNPPPPPQTSKSPTPTPVSILKHKEKDTTTAS--- 587

Query: 549 PISVDSTSEIKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDV 608
            +        K RE+EN K+ALYDKV  KI++WK  KD DIRHLL+NLS++LTWC+W  +
Sbjct: 588 -VQRLQDENAKSREIENQKVALYDKVESKINAWKLDKDTDIRHLLSNLSTVLTWCDWPSI 646

Query: 609 SMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668
           S  DLVMPK+VKITY+KA+ KTHPDKIPESL LENKMIAEN+FS LS+AWDKFKL N++N
Sbjct: 647 SQADLVMPKKVKITYLKAITKTHPDKIPESLDLENKMIAENVFSILSLAWDKFKLDNNMN 706

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score =  412 bits (1059), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 243/588 (41%), Positives = 338/588 (57%), Gaps = 78/588 (13%)

Query: 96  NTDDDFNQLFGMGTVTTTDTIQKPDEDYYGSK----------EDHLYNGDDALVDEVKDM 145
           N  DD ++LFG+     T    +   D + +           E  L    + +VDEVKDM
Sbjct: 40  NVHDDLDELFGLKKRDETVVKNQVVGDSFDAAFEAFDRPQKVEKSLEESPEMVVDEVKDM 99

Query: 146 EIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSGLSN 205
           E+A+LMSL L I++AT++YE  V YE+      S+Q+   +L  R+++   + ++   + 
Sbjct: 100 EVAKLMSLNLDIDQATDYYERGVLYEQL-----SRQRREQELIRRREQMLRQQQQQQQTP 154

Query: 206 IVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSP 265
               DS + FS+A+    KG++ VDQ++ FP E  DRL     T  +VE  DLP      
Sbjct: 155 EEKFDSGSFFSLASGILEKGRQFVDQFSGFPQE-QDRL-----TRVRVEQ-DLP------ 201

Query: 266 NRILFEDNEVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRR 325
                E  + VE  P  +  + +LL +F+ KI++                    EE  R 
Sbjct: 202 ----VERPKSVEP-PTVEVEEGNLLGEFQEKINL--------------------EEPKRS 236

Query: 326 NEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLF 385
             P  + +LLDF  G               E   T + +PIS +E+SGY E+K +GT  F
Sbjct: 237 PTPPPQATLLDFDNGTPP------------ERIKTITPVPISHLEISGYKEYKDRGTEFF 284

Query: 386 KNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSS 445
           K GDY+++ QEYEKSLN+LP NH LRI+A SN+ A+  K+GEY + + +   ALE+FP  
Sbjct: 285 KAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIESALEMFPKD 344

Query: 446 KAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQ 505
              W   I +S P R+F ++WPKI+ RRAE+FEH+E++++AL+ YQ LI+KN F+DKIM 
Sbjct: 345 PNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKNNFNDKIMG 404

Query: 506 GKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNSPISVDSTSEIK----KR 561
           GKRRCQ  +N                           +  +  P +  +   +K    + 
Sbjct: 405 GKRRCQKVLNPTEPKATSPNRSPTPVPK--------VSEDTKQPKTYANVERVKQENQRN 456

Query: 562 ELENA-KLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVK 620
           EL+ A K ALYD VF++I SWK GK DDIRHLLANLS++LTWC+WK VS  DLVMPK+VK
Sbjct: 457 ELQEAEKAALYDTVFQQIESWKAGKGDDIRHLLANLSTVLTWCDWKPVSTSDLVMPKKVK 516

Query: 621 ITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668
           ITYMKAVAKTHPDKIP SL LE +MIAE++FS+LS+AW+KFKL NDIN
Sbjct: 517 ITYMKAVAKTHPDKIPSSLELEKRMIAEDVFSSLSVAWEKFKLANDIN 564

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 1  MSDPFAHLLTSLKNKDSASASKETTPQ 27
          MSDPFA LL+S ++  S S SKE TP+
Sbjct: 1  MSDPFADLLSSFRSGGSDSVSKEATPE 27

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score =  410 bits (1053), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 263/703 (37%), Positives = 378/703 (53%), Gaps = 103/703 (14%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           M DPFA LLT  K         E+ PQ+  +  +             S N++  + S+  
Sbjct: 1   MGDPFADLLTQFK-------GGESKPQNQGNKPLAAQY---------SENNTRETSSSLS 44

Query: 61  LIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTT---DTIQ 117
           L P P    S                           DDDF QLFG+ + T T   D   
Sbjct: 45  LQPEPVTTASN-----------------------YKIDDDFEQLFGIKSNTNTNNSDVNN 81

Query: 118 KPD---EDYYGSKEDHLY-----------NGDDALVDEVKDMEIARLMSLGLSIEEATEF 163
           +P+   ++ + S  D L               + LVDEV+DME+A+LMSLG SI+ A   
Sbjct: 82  RPNTTNQNEFDSAIDLLQITPEKQRQSAEREPEQLVDEVRDMEVAKLMSLGYSIDGANTS 141

Query: 164 YENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSGLSN-IVGTDSNNLFSMATDFF 222
           YE  + Y+  +E  K K+  R +L     E+  + E    +N   G ++ +LFS+A+  F
Sbjct: 142 YEQGMLYDDVIEERKKKKLHRRELQRLMAETNWERETPETNNDESGKNNVDLFSIASGIF 201

Query: 223 NKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYD-----LPQVNDSPN-------RILF 270
           NKGKK+VD  + FP E ND L   S+   + + ++      P+ + +PN       ++ +
Sbjct: 202 NKGKKIVDHLSLFPDEENDLLPYRSERLKQRQTFEPELPRRPRKDPTPNPRTQGTPQVEY 261

Query: 271 EDNEVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLI 330
           E     +  P     + DLL DF+ K+ +  +     S S SP++               
Sbjct: 262 ESTLQYQQ-PTIQAQEGDLLGDFQDKLSLRSQGNKSTSASQSPSN--------------- 305

Query: 331 EDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDY 390
            ++LLDF   +  ++ S   S   +   +   T+PI++IELSGYNEFK +   LFK GDY
Sbjct: 306 -ETLLDF---DAPSANSTSASVSVSRQGSVVPTVPITEIELSGYNEFKDRAGELFKTGDY 361

Query: 391 INSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWK 450
           + +LQEYEKS NTLP  HPLRII+ SN++ASQLK G+Y +S+  +SMAL+LFP    +W 
Sbjct: 362 VAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQWT 421

Query: 451 NKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGKRRC 510
             I NS+P +++ D+WPKI+ RRAE+FEH E+F++A   YQ LI+KNF  +KIM GKRRC
Sbjct: 422 QLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSLIEKNFCTNKIMDGKRRC 481

Query: 511 QDFIN-----XXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNSPISVDSTSEIKKRELEN 565
           Q  +N                            +NL     ++          K+ E + 
Sbjct: 482 QKVLNPEKPKVVQKKPASSKSPSPSPNHSDKKYKNLQKVKEDN---------RKQAEEDT 532

Query: 566 AKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMK 625
            + ALYD+V+++I  W+ GK +DIRHLL+NL ++LTW +WK VS  DLVMPK+VKITY++
Sbjct: 533 QRHALYDRVYDQIKLWESGKANDIRHLLSNLQTVLTWVDWKPVSPADLVMPKKVKITYLR 592

Query: 626 AVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668
           AVAKTHPDKI +SL L+ KMIAE++FS+LS AW+KFK +NDIN
Sbjct: 593 AVAKTHPDKISDSLPLDKKMIAESVFSSLSSAWEKFKSENDIN 635

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score =  407 bits (1046), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 261/617 (42%), Positives = 354/617 (57%), Gaps = 99/617 (16%)

Query: 99  DDFNQLFGMGTVTTTDTIQKPDEDY----------YGSKEDHLYNGDDALVDEVKDMEIA 148
           DDF +LFG  T        +P  ++          Y +K+D       ++VDEVKDMEIA
Sbjct: 82  DDFEELFGSSTSNNFSVSPEPTNNFKTVTDVPNVTYEAKQD-------SVVDEVKDMEIA 134

Query: 149 RLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKE-------SGIKMEKS 201
           +LMSLGLSIE+A  +Y   ++Y+  L     K+ ER     RK         +  K +K+
Sbjct: 135 QLMSLGLSIEKANSYYSKGISYDTLL-----KKLERRRYGSRKGRDTPTFGGNTNKDDKA 189

Query: 202 GLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKVEDYDLPQV 261
                  +++ NLFSMA+  FNKGK+ +DQ T++P E  DRL+ Y    D  E   +  +
Sbjct: 190 YAKLFDSSENTNLFSMASGLFNKGKEFIDQMTAYP-EETDRLSRY---RDISEISSMKPL 245

Query: 262 NDSPNRILFEDNEVVENLPPADNPDQDLLTDFETKIDITKRTAP--DVSHSSSPTSGILI 319
             SP  +              D  D D ++  +   D  K  AP  +V   S P S  L+
Sbjct: 246 RKSPGIV--------------DGFDMDRISQHQ---DTDKGKAPTREVQQESPPPSHDLL 288

Query: 320 E--ENSRR----NEPLIEDSLL---DFSEGNLTNSKS-NEDSTLFN-----ENSNTDSTI 364
           +  +N+ +     E L ++S+L   D  +  L  SKS   DS LF      ENSN    I
Sbjct: 289 DNFQNNLKLDDNKEELSKESVLLDIDNDDSTLLKSKSLTSDSLLFQDENVLENSNI-PKI 347

Query: 365 PISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLK 424
           PIS IELSGYNE+ ++G+S FKNGDYI++L+EYEKSLNTLP +HPLRIIA SNI A++LK
Sbjct: 348 PISSIELSGYNEYNSRGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELK 407

Query: 425 IGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFK 484
           IGEYS  ++ +  AL+LFP    KW   I +S+P +S+ DIW K+++R+AE+ EHLE+F+
Sbjct: 408 IGEYSNLVKKADKALKLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFE 467

Query: 485 KALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTAS 544
            A + Y  LI+ N F DKIM GKRRCQ  +N                       +     
Sbjct: 468 LAYKQYHSLIENNVFSDKIMDGKRRCQKVLN------------------PEIAKKTQQKP 509

Query: 545 SSNSPISVDSTSEIKKRELENA-------------KLALYDKVFEKISSWKDGKDDDIRH 591
           SS+ P +V + S  K   +E               KL LYD V  KI++WK  K +DIRH
Sbjct: 510 SSSKPAAVPTPSTQKYESVERIKEQNRQEEENEAEKLKLYDIVEAKINAWKSNKPEDIRH 569

Query: 592 LLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIF 651
           LLANL ++LTW  WK +S+ DLVMPK+VK+TY+KA+AKTHPDKI  SL+LE+KMIAEN F
Sbjct: 570 LLANLPTILTWTEWKPISVNDLVMPKKVKVTYLKAIAKTHPDKISSSLNLESKMIAENAF 629

Query: 652 STLSIAWDKFKLQNDIN 668
           STLS+AWDKFK +N++N
Sbjct: 630 STLSVAWDKFKEENNMN 646

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score =  400 bits (1027), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 339/549 (61%), Gaps = 31/549 (5%)

Query: 136 DALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESG 195
           + ++DEV+DME+A+LMSLGL+I++A+ +YE  +T+E  L   K KQK  N    R   S 
Sbjct: 128 EEVIDEVRDMELAKLMSLGLNIDKASSYYERGITFEDVLR--KRKQKASNGYQQR---SN 182

Query: 196 IKMEKSG--LSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTHDKV 253
           I  ++ G  + NI  T  +   S+ +   NKGK+LV+Q +++  E N+R+N +       
Sbjct: 183 IDRKQGGGEIRNIFDTRGSGSESLFSGILNKGKELVNQLSTYTEEENERMNKFKG----Y 238

Query: 254 EDYDLPQV----NDSPNRILFEDNEVVENLPP-ADNPDQDLLTDFETKIDITKRTAPDVS 308
           E+Y + +      +S +  +F  +   E +P  A  P  +      +KI+  KR   +  
Sbjct: 239 EEYSMSETYLEKENSMDPGVFSRSSQ-EKIPQRAARPSHEKSNSSRSKIN--KRMTTEAP 295

Query: 309 HS----SSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTI 364
           H        +S I  +++SR +    E +LLDF   N  +S     S   N+N+ + + I
Sbjct: 296 HKPFNDDDQSSLIESKDSSRESSMPGEGTLLDFDNDNHASSPVVNTS---NQNTVSITQI 352

Query: 365 PISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLK 424
           PIS IE+SGYNEFKA+GT  FKNGDY ++++EYEKSLNTLP+ HPLRIIA SNIIAS++K
Sbjct: 353 PISHIEISGYNEFKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIK 412

Query: 425 IGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFK 484
           IG++S+S+ ++  A++L P  K+ W   I NSDP RS+NDIWPKI++R+AES+E +E +K
Sbjct: 413 IGQHSQSVVDAQEAMKLLPEEKSLWTAAIQNSDPVRSYNDIWPKIILRQAESYEAIEKYK 472

Query: 485 KALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTAS 544
            AL+ YQ L++KN F +K++ GKRRCQ  +                          +   
Sbjct: 473 LALDAYQTLLEKNLFSEKVIAGKRRCQHALGLDSKPKSNPPSKSATPAPAPRRAPTVNRQ 532

Query: 545 SSNSPISVDSTSEIKKR-----ELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSL 599
           +        +  ++KK      +LE+ K+ALYDKV   I+SWK+GK DDIR+LL+NL ++
Sbjct: 533 TEVVNKKSVNAEKLKKENERLAKLEDQKVALYDKVEGIINSWKNGKQDDIRYLLSNLQAV 592

Query: 600 LTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWD 659
           +TW  WK V   +LV+P++VKITYMKAVAK HPDK+P SL+LE +MIAE++FSTLS +W+
Sbjct: 593 ITWTQWKPVQSSELVLPRKVKITYMKAVAKLHPDKLPSSLTLEQQMIAESVFSTLSDSWE 652

Query: 660 KFKLQNDIN 668
            FK  NDIN
Sbjct: 653 NFKKSNDIN 661

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score =  397 bits (1021), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 242/680 (35%), Positives = 357/680 (52%), Gaps = 107/680 (15%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
           M+DPFA LLTS K      A+K  +P+     ++ G      A T        H++   P
Sbjct: 1   MADPFASLLTSFKESSKKPAAKSESPEPV---TVKGGGEPATAST--------HAVFMEP 49

Query: 61  LIPSP--KVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDTIQK 118
           LIPS   +  F   P                     A +DD F+ +F +        +++
Sbjct: 50  LIPSGGGQGSFQQKP---------------------AGSDDKFDDVFDLFNSEPAAEVKE 88

Query: 119 PDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILK 178
           PD        D   + + A+VDEV+DME+A++MSLG  I++A EFY++ V Y+  +E   
Sbjct: 89  PDR----VPSDESVHENVAVVDEVRDMEVAKIMSLGFGIDKAVEFYDSGVLYDELVE--- 141

Query: 179 SKQKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFPPE 238
                R+   IR   +   + +  ++ +     N+ FS A    NKGK  VD  T++P E
Sbjct: 142 ----RRDRRHIRHTHTRHSVRE--VTEVPKHTGNSFFSAAVGLLNKGKDFVDHLTAYPDE 195

Query: 239 ANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTD-FETKI 297
             DRL  Y + H     +                     +  P +  +QDLL D FE+K+
Sbjct: 196 EGDRLARYRQEHADAAHFG--------------------DFTPGER-EQDLLIDDFESKV 234

Query: 298 DITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNEN 357
            IT +  P ++ +                    +++LLDF E +  +SKS   + + N  
Sbjct: 235 SITDKHNPPLAQTP-------------------DETLLDFGEDD--SSKSGSRTHVNNSP 273

Query: 358 SNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417
           S     +PIS +ELSGYNEF+AKGT LFK GDY  ++ EYEKSLNTLP  HPLRIIA+SN
Sbjct: 274 SIELPIVPISTMELSGYNEFRAKGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSN 333

Query: 418 IIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESF 477
           ++   LKIGEY+K ++ + +ALEL P  ++ W++ I  S+P+R++ DIW K+++R AE+ 
Sbjct: 334 MMLPYLKIGEYTKCLKLAPLALELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQ 393

Query: 478 EHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXX 537
           EH E++  A + YQ L+     ++K+M GKRRCQ  +N                      
Sbjct: 394 EHAENYTGAFDNYQLLVANGITNEKVMDGKRRCQKVLN--------PPSKVERKGTPTPT 445

Query: 538 XQNLTASSSNSPISVDSTSE---------IKKRELENAKLALYDKVFEKISSWKDGKDDD 588
            Q +T + +  P +  +  E          K  + E AK+  YD V  K+++WK  K+ D
Sbjct: 446 PQVVTPARTPDPATSKTVYENAERVKRANAKSEQEEAAKMEFYDVVETKVNNWKGDKEGD 505

Query: 589 IRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAE 648
           IR+LL++L+ ++TW  W  VS  DLVMPKRVKITY+KA+AK HPDKIP  L LE +MIA+
Sbjct: 506 IRYLLSHLTEIVTWVEWNSVSQADLVMPKRVKITYLKAIAKIHPDKIPADLPLEYRMIAD 565

Query: 649 NIFSTLSIAWDKFKLQNDIN 668
            +FS L+ AW+KFKL N+IN
Sbjct: 566 TVFSVLNNAWEKFKLDNNIN 585

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score =  396 bits (1018), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 257/602 (42%), Positives = 334/602 (55%), Gaps = 80/602 (13%)

Query: 119 PDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILK 178
           P E   GS         D +VDEVKDMEIA+LMSLGL I+EAT  Y+N + YE     L 
Sbjct: 113 PQESLRGSTVTTSPEVQDIVVDEVKDMEIAKLMSLGLDIDEATTHYDNGILYE----TLV 168

Query: 179 SKQKERNDLAIRKKESGIKMEK--SGLSNIVG------TDSNNLFSMATDFFNKGKKLVD 230
           SK        IR   S I  ++  SG ++I          SN  F+  T  F+KGK+LVD
Sbjct: 169 SK--------IRTSNSRITAQRNDSGRNDIRAEPMRKPRTSNGSFTF-TGLFDKGKQLVD 219

Query: 231 QWTSFPPEANDRL---NNY-----SKTHDKVEDYDLPQVN------------------DS 264
           QWT +  E +DRL    N+     + T+    DYD    N                  DS
Sbjct: 220 QWTVYH-EEDDRLFRNTNFKVDPSTNTYQPSGDYDTSDENPFNQQSRYDIASSKTTSTDS 278

Query: 265 PNR--------ILFEDNEVVENLPPADN--PDQDLLTDFETKIDI------TKRTAPDVS 308
             R        I  + +E +    P +N   + DLL D    I +      T  T  + +
Sbjct: 279 QTRNYHDKKTSINNKAHERIAKETPINNQPANLDLLNDDFISIKLSSENVSTNLTNLEQA 338

Query: 309 HSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISD 368
            S   TS   I +      P   ++LLDF          +  +T  +  + +   +PIS+
Sbjct: 339 KSKQATSKQAISKPIVNVAPKANNTLLDF----------DSPTTAVHSPAASLPKVPISE 388

Query: 369 IELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEY 428
           IEL GY EFK +GT  FK GDY+ +L+ Y+KSLNTLP+ HPLRIIA SNI+AS  K GEY
Sbjct: 389 IELLGYKEFKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEY 448

Query: 429 SKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALE 488
            KSIE S+ ALE FP  + +W   I +S+P+R++ DIWPKI+++RAE+FEH+ES++ ALE
Sbjct: 449 RKSIEISTSALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENALE 508

Query: 489 TYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNS 548
           TYQ++I+KNFF+DK+M GKRRCQ  IN                        N   +  N 
Sbjct: 509 TYQQMIEKNFFNDKVMSGKRRCQHVINPVKPTKSNSSALPRQTNTKPKKESNQNKAYEN- 567

Query: 549 PISVDSTSEIKK--RELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWK 606
              V+   +  K   E+E+ +LALYD V  +I+ WK  KDDDIRHLL+NL  +LTW NW 
Sbjct: 568 ---VEKLKQKNKLEAEIESQRLALYDSVEAQINKWKANKDDDIRHLLSNLQLILTWGNWN 624

Query: 607 DVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQND 666
            V   DLVMPK+VKITYMKAVA+THPDKIP  L LE KMIAENIFS LS AW+KFK  N+
Sbjct: 625 PVPPSDLVMPKKVKITYMKAVARTHPDKIPSDLELEKKMIAENIFSVLSKAWEKFKKDNN 684

Query: 667 IN 668
           +N
Sbjct: 685 MN 686

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score =  394 bits (1013), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 234/310 (75%), Gaps = 7/310 (2%)

Query: 363 TIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQ 422
            IPIS IELSGY EF+ +GT  FKNGDY++S QEYEKSLNTLP+NHPLRIIA SNIIAS+
Sbjct: 392 VIPISHIELSGYAEFRNRGTQYFKNGDYVSSFQEYEKSLNTLPVNHPLRIIAYSNIIASE 451

Query: 423 LKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLES 482
           LKIGEYSKS++NSS ALE+FP   A+W   I +SDP+R++ DIWPK+ +R+AE+ EH+ES
Sbjct: 452 LKIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLRQAEALEHIES 511

Query: 483 FKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLT 542
           FK AL +YQELI+K F +DKIM GKRRCQ  +N                       +  T
Sbjct: 512 FKAALSSYQELIEKGFANDKIMDGKRRCQKVLNPTPPPVVKTPRISTPKQSPSPVPRKAT 571

Query: 543 ASSSNSPISVDSTSEIKK-----RELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLS 597
           ++S ++    +S   +KK     +E+E  KLALYDKVF K+ +WK+ KD DIRHLLANLS
Sbjct: 572 SNSKDA--VYESVERLKKENATSQEVEKQKLALYDKVFAKVETWKNRKDTDIRHLLANLS 629

Query: 598 SLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIA 657
            +LTWC+WK V+  DLVMPK+VKITYMKAVAKTHPDK+PESL LENKMIAEN+FS LS+A
Sbjct: 630 IVLTWCDWKPVAASDLVMPKKVKITYMKAVAKTHPDKVPESLELENKMIAENVFSVLSVA 689

Query: 658 WDKFKLQNDI 667
           WDKFK++N++
Sbjct: 690 WDKFKIENNM 699

>SAKL0G08822g Chr7 (755393..757141) [1749 bp, 582 aa] {ON} similar
           to gnl|GLV|KLLA0B10197g Kluyveromyces lactis
           KLLA0B10197g and some similarites with YDR320C
           uniprot|Q06677 Saccharomyces cerevisiae YDR320C SWA2
           auxilin- like protein
          Length = 582

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/562 (38%), Positives = 306/562 (54%), Gaps = 85/562 (15%)

Query: 138 LVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIK 197
           +VDEVKDMEIARLMSLG+S+E A ++YE  + Y+  L     K + +   A   ++   K
Sbjct: 75  VVDEVKDMEIARLMSLGVSLERALQYYERGILYDDVLRRRHEKHEAKRQAAAASRDF-TK 133

Query: 198 MEKSGLSNIVGTDSNN-----LFSMATDFFNKGKKLVDQ---------------WTSFPP 237
           +  +G SNI+G+D ++     LFSMAT  FNKGK  +++               + SF  
Sbjct: 134 LFDNGSSNILGSDGSDDKQQDLFSMATGLFNKGKSFMEERLKQRQQHQHQQDPAFRSFAD 193

Query: 238 EANDRLNNYSKTHDKVEDYDLPQVNDS----PNRI-LFEDNEVVENLPPADNPDQDLLTD 292
             + RL + ++   +   Y   QV       P  +   E+  V+E          DLL  
Sbjct: 194 HISSRLESPTRAKYERSQYTDKQVGSERRPEPAPVDEVEEPSVIEG---------DLLGG 244

Query: 293 FETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDST 352
           F            D    SSP                  ++LLDF +           S 
Sbjct: 245 F------------DELSVSSPQ----------------HETLLDFEQAV---------SP 267

Query: 353 LFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRI 412
               +S+    I IS +ELSG+ EFK+KG  LF +G+Y ++L EYEKSLNTLP  HPLRI
Sbjct: 268 PQLRSSSARPPISISAMELSGFGEFKSKGGELFAHGNYSSALLEYEKSLNTLPSGHPLRI 327

Query: 413 IALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIR 472
           I+LSNII +QLK+GE S +++N   AL L    + + +  I  S+P +S+ + W KI +R
Sbjct: 328 ISLSNIITTQLKLGESSSALQNIETALRLI--GEDELQLTIPASNPPKSYREFWGKITMR 385

Query: 473 RAESFEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXX 532
           +AE+ EH+E++  ALE Y+ LI K F   K+M GKRRCQ  ++                 
Sbjct: 386 KAEALEHVENYVSALECYKALIDKGFVTSKVMDGKRRCQKVLSPPKPQSGIPPVARKKPS 445

Query: 533 XXXXXXQNLTASSSNSPISVDSTSEIKK-----RELENAKLALYDKVFEKISSWKDGKDD 587
                   L  SSS  P   D+  +I++      +LEN K  L DKV E+I SW  GK++
Sbjct: 446 PNV-----LDTSSSTLPKRSDNLEKIQRINREAEQLENKKFLLRDKVDEQIKSWSQGKEN 500

Query: 588 DIRHLLANLSSLLTWCN-WKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMI 646
           D+R LLA+L  +LTW N WK V+  DLVMPK+VKITY+KA+AKTHPDK+ +SL +E+KM+
Sbjct: 501 DLRQLLADLPKVLTWSNDWKPVTTSDLVMPKKVKITYLKAIAKTHPDKLNDSLDVEHKML 560

Query: 647 AENIFSTLSIAWDKFKLQNDIN 668
           AE+IFS LS AW+ FK +N+I+
Sbjct: 561 AEDIFSILSKAWEAFKEENNIS 582

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score =  316 bits (809), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 158/311 (50%), Positives = 216/311 (69%), Gaps = 13/311 (4%)

Query: 364 IPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQL 423
           +PIS IELSGY EF+A GT  FK GDY ++L EY+KSLNTLP  HPLR+I+ SNI+A+QL
Sbjct: 536 VPISTIELSGYTEFRANGTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQL 595

Query: 424 KIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESF 483
           K+GEYS+S+++  +ALELFP +  +W   I +SDP++++ +IWPKI++R+AE+ EH+E +
Sbjct: 596 KVGEYSQSVKDCDVALELFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

Query: 484 KKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTA 543
           + A ++YQ L+ KN F+DKIM GKRRCQ  +N                           +
Sbjct: 656 QIAYDSYQLLLHKNVFNDKIMAGKRRCQKVLNPETPKLKSSANTSRISSAKQ-------S 708

Query: 544 SSSNSPISVDSTSE------IKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLS 597
           ++S S I+V+   E       K+RE E  +L L D V  KI  W + K+DDIR+LL+N+ 
Sbjct: 709 TASTSSINVNKNVERLKETRKKEREEEEERLRLLDSVNAKIQKWTNNKEDDIRYLLSNVH 768

Query: 598 SLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIA 657
            +LTW NWK ++  DLVMPK+VK+ YMKAVAKTHPDKI + LS+ENKMIAE+IFS LS+A
Sbjct: 769 IVLTWSNWKAINASDLVMPKKVKVNYMKAVAKTHPDKISKDLSIENKMIAESIFSILSVA 828

Query: 658 WDKFKLQNDIN 668
           W+KFK  N +N
Sbjct: 829 WEKFKTANKMN 839

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 137 ALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKS-KQKERNDLAIRKKESG 195
           ++VDEVKDMEIA+LMSLGLSI++A  +Y      +  L  +++ K K +++ + +  ++ 
Sbjct: 215 SVVDEVKDMEIAKLMSLGLSIDKAHMYYNKGYLSDDVLRKMQAQKHKRQSNYSTKYDDTK 274

Query: 196 IKMEKSGLSNIVGTDSNN-LFSMATDFFNKGKKLVDQWTSFPPE 238
           I+     L+N      NN LFS+A+DF NKGK +VDQ++++  E
Sbjct: 275 IRNSLDKLNNSASPPGNNVLFSIASDFLNKGKGIVDQFSTYHEE 318

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 1  MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVADVARTDKSPNDSLHSISAPP 60
          MSDPFA+LL+S K           TP S+ S SI+ +A  DV  + +     L S+SA  
Sbjct: 1  MSDPFANLLSSFKGD---------TPNST-SASISKNASLDVLASQRRAQSDLSSLSA-K 49

Query: 61 LIPSPKVD 68
          L PS K +
Sbjct: 50 LTPSLKTN 57

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score =  310 bits (793), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 169/383 (44%), Positives = 240/383 (62%), Gaps = 15/383 (3%)

Query: 288 DLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIED-SLLDFSEGNLTNSK 346
           DLL  FE  I I +      S ++ P     I E  + N+  I+D +LLDF   +L+   
Sbjct: 322 DLLDSFEENIVIGE------SFTNIPPR---ITERQKPNDERIQDNTLLDFGNEDLS--- 369

Query: 347 SNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPL 406
           S  + ++ +        I I+ IELSGYNEFK +GT  FK GDY+++ ++YEKSLN+L  
Sbjct: 370 SPANVSISSSGQECIPVISINQIELSGYNEFKDRGTEYFKKGDYVSATEQYEKSLNSLSK 429

Query: 407 NHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIW 466
            HPLRIIA SN++AS LK G+Y+  I  S+ AL+LFP     W N I NS+P +++ +IW
Sbjct: 430 LHPLRIIASSNLLASLLKTGDYTSMITISTSALDLFPKESKLWDNVIQNSEPSKTYKEIW 489

Query: 467 PKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXX 526
            K++ RRAE+FE +E++++A ++YQ LI+ N F++KIM GK RCQ  +N           
Sbjct: 490 SKLVARRAEAFEFIENYQQAYDSYQLLIENNIFNEKIMAGKLRCQKVLNPETHNKPLKKL 549

Query: 527 XXXXXXXXXXXXQNLTASSSNSPISVDSTSEIKKR--ELENAKLALYDKVFEKISSWKDG 584
                       +N+  + S S  ++    E  KR  + E  K ALYD V +K+++W  G
Sbjct: 550 VATTAETKTSQTKNIVNTQSTSSGNLKKIQEQNKRTEKYEEEKEALYDVVEQKVNAWIAG 609

Query: 585 KDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENK 644
           KDDDIRHLL+ L  ++TW  W +V+  DLVMPK+VKITY+KAVAKTHPDK+P +L  E++
Sbjct: 610 KDDDIRHLLSRLQRIITWTQWNEVASSDLVMPKKVKITYLKAVAKTHPDKLPSNLDTESR 669

Query: 645 MIAENIFSTLSIAWDKFKLQNDI 667
           M+AENIFS LS  W+KFK+ N+I
Sbjct: 670 MLAENIFSILSKNWEKFKVDNNI 692

>Kwal_34.15977 s34 (141005..142798) [1794 bp, 597 aa] {ON} YDR320C
           (SWA2) - auxilin-like protein [contig 272] FULL
          Length = 597

 Score =  306 bits (784), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 200/565 (35%), Positives = 301/565 (53%), Gaps = 75/565 (13%)

Query: 128 EDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKERNDL 187
           ++H+      LVDE+KDMEIARLMSLGLS  +AT +YE  + Y+  LE  K +Q+ R + 
Sbjct: 84  QNHMDPEPQPLVDEIKDMEIARLMSLGLSCTKATSYYERGLLYDDLLE-RKRQQRTREEA 142

Query: 188 AIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQ----------WTSFPP 237
             +  + G   + S           +L S+A+ + N+G+  +D             S+  
Sbjct: 143 PQKTSDEGRFTQGS---------EPDLLSVASSWLNRGRTFLDSKLKQIQNDNGTQSYSD 193

Query: 238 EANDRLNNYSKTHDKVE-DYDLPQVNDSPNRILFEDNEVVENLPPADNPDQDLLTDFETK 296
             + R+ + + T  ++    D+P   D    I F+D      L  AD P++         
Sbjct: 194 YISSRMESSAHTGSRLRPTSDIPTNID--RSISFQD------LSLADQPNES-------- 237

Query: 297 IDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLTNSKSNEDSTLFNE 356
             +  + +P  S    P   I  +      E    D L+DF      ++ S  D+     
Sbjct: 238 -SVPAQVSPMNSEILPPLVNIGDDVPVSGPEEASADLLVDF------DAPSGHDAV---- 286

Query: 357 NSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALS 416
           +S   ++I +S +E   Y EFK KGT  F  GDY  + Q +EKS+N+LP +HPLR I+LS
Sbjct: 287 SSPVAASIAMSALEFHSYQEFKEKGTLSFSAGDYHTAFQNFEKSVNSLPHSHPLRAISLS 346

Query: 417 NIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAES 476
           N+I  +LK+GEY K+IE+SS+AL+L   S AK  + I  SDP ++F +IW KI+  +AE+
Sbjct: 347 NMIICRLKLGEYRKAIEDSSVALKLI--SCAKLDDVIPASDPPKTFKEIWCKIVGNKAEA 404

Query: 477 FEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXX 536
           +EH+E + KAL+ YQ LIK+     K+M+G+RRCQ  +                      
Sbjct: 405 YEHIEDYDKALKEYQLLIKRGAASRKVMEGRRRCQKIVEPEKFVQRSKTPL--------- 455

Query: 537 XXQNLTASSSNSPISVDSTSEI-------------KKRELENAKLALYDKVFEKISSWKD 583
              + + S S   ++V +TS++             K++ELE  K  L+DKV +++  W  
Sbjct: 456 ---STSPSVSRKDVAVAATSQVPSEKLERVQNINKKEKELERQKFLLHDKVQDRVREWCQ 512

Query: 584 GKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLEN 643
             +DD+R LL+    ++ W +WK+VS  DLVMPKRVKI Y+KAV KTHPDKI +S  LE 
Sbjct: 513 NSEDDLRELLSRFHLIVDWVDWKNVSTADLVMPKRVKIVYLKAVTKTHPDKIQDSWPLER 572

Query: 644 KMIAENIFSTLSIAWDKFKLQNDIN 668
           KM+AEN+F  LS AW+ FK QN ++
Sbjct: 573 KMVAENVFVILSKAWELFKEQNKLS 597

>KLLA0B10197g Chr2 complement(891842..893707) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 621

 Score =  306 bits (784), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 236/694 (34%), Positives = 346/694 (49%), Gaps = 100/694 (14%)

Query: 1   MSDPFAHLLTSLKNKDSASASKETTPQSSNSPSITGSAVA---DVARTDKS--PNDSLHS 55
           MSDPFA LL+S K  +S++ +  +  ++++   +  S  A    ++R   S  P+ +  S
Sbjct: 1   MSDPFADLLSSFKGVNSSTGNNSSANKNASLNDLLSSHSALTSPLSRKSPSNVPSKTPES 60

Query: 56  ISAPPLIPSPKVDFSAPPLVXXXXXXXXXXXXXXXXXALANTDDDFNQLFGMGTVTTTDT 115
           IS   +  S   DF    L                  + A   DDF+  F     T    
Sbjct: 61  ISITSMTAS--QDFFDDLLAAPSQVTPLRESPSQVAPSTATEKDDFDLAFESFNSTPHVD 118

Query: 116 IQKPDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLE 175
           + +P  D     +         LVDEVKDMEIARLMSLGLS ++A  +Y+  + YE  +E
Sbjct: 119 LVQPQPDPIPEPQ--------PLVDEVKDMEIARLMSLGLSFDKAVHYYDKGIMYEELIE 170

Query: 176 ILKSKQKER----NDLA---IRKKESGIKMEKSGLSNIVGTDSNNLF-SMATDFFNKGKK 227
             K +++ R    ND     +RK+ES               DS+  F S+A++ FN GK+
Sbjct: 171 SQKKRKQSRSNVNNDFGQQQLRKQES--------------RDSSPAFISVASNLFNMGKE 216

Query: 228 LVD---QWTSFPPEAND-RLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVENLPPAD 283
            ++   + T  P  AN  + + +S       DY  P  +  P+ + F+          + 
Sbjct: 217 FIEDKLKPTLQPQYANSSQRSQFSDDIPLRRDYTRP--HSRPHSMQFQSERT------SP 268

Query: 284 NPDQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDSLLDFSEGNLT 343
            P  +L +  +  I+      P VS  +  T+ ++ +E           +L+DF     T
Sbjct: 269 QPSPELPSIHQLSINNASSAPPPVSVENQDTASVINQE-----------TLVDFGAAPQT 317

Query: 344 NSKSNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNT 403
           ++                    ISD EL+ +NEFK  G   F +GDY N+L E+EKS NT
Sbjct: 318 SASPQHR---------------ISDFELTSFNEFKNNGVKYFSSGDYHNALLEFEKSFNT 362

Query: 404 LPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALEL---FPSSKAKWKNKISNSDPER 460
           LP  HPLRII+LSNI++ QLK+GE SK++E+  +AL+L    P++     + I +S PER
Sbjct: 363 LPFKHPLRIISLSNIVSCQLKLGENSKALESVKLALDLSDLAPNAS----DIIEHSVPER 418

Query: 461 SFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXX 520
           +F  +  KI ++ AE  EHLE+++KAL  Y  LI     + K+M GKRRC+  +N     
Sbjct: 419 TFKQMINKIQLKHAEIQEHLENYEKALSLYANLISNGITEQKVMDGKRRCEKIVNPEKFK 478

Query: 521 XXXXXXXXXXXXXXXXXXQNLTASSSNSPISVDSTS-------EIKKRELENAKLALYDK 573
                                    S + IS D+ +         K+ E E  +L L DK
Sbjct: 479 PAKEKISSPT-----------IPVRSKTSISADTVAVNRVKEENKKQEEEEEERLRLRDK 527

Query: 574 VFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPD 633
           V EKIS W    ++D+R+LLANL  LL W +WK+VS QDLVM K+VKI Y+KA+AKTHPD
Sbjct: 528 VDEKISEWTKNNENDLRYLLANLEPLLWWASWKEVSPQDLVMTKKVKICYLKAIAKTHPD 587

Query: 634 KIPESLSLENKMIAENIFSTLSIAWDKFKLQNDI 667
           KIP   SLE  MIAEN+++ L+ AW+ FK QN+I
Sbjct: 588 KIPADASLETIMIAENVYTILNKAWEYFKSQNNI 621

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score =  291 bits (746), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 191/595 (32%), Positives = 307/595 (51%), Gaps = 63/595 (10%)

Query: 99  DDFNQLFGMGTVTTTDTIQKPDEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIE 158
           D+F+  F M        +  PD D    K          +VDEVKDMEIARLMSLGL  +
Sbjct: 67  DEFDLAFDMLNGPVASRLAAPDVDLVEPK-------PQPVVDEVKDMEIARLMSLGLDWD 119

Query: 159 EATEFYENDVTYERYLEILKSKQKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMA 218
           +A E+YE  + YE+ ++    +QK R     R       +  S  S+ +  + ++LFS+A
Sbjct: 120 KAAEYYERGILYEQVVD----RQKRRTARTERP------LRTSPQSSQLREEESDLFSVA 169

Query: 219 TDFFNKGKKLVD-QWTSFPPEANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDNEVVE 277
           +++ NKG+  +D +      E +DR            DY   +   + +    +++    
Sbjct: 170 SNWLNKGRTFLDSKLKQVQTEYSDR---------SFSDYISSRSGSNASPPWLKESGSYH 220

Query: 278 NLPPADNPDQDLLTDF-----ETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIED 332
               +D   Q + T F     E +     R    V  + SP   +     +  + P+  +
Sbjct: 221 LQVSSDRGKQKVTTQFKDLKIEEETHFGPRANSPVPSTKSPAVSV-----ASASHPVYSE 275

Query: 333 SLLDFSEGNLTNSKSNEDSTL--FNENSNTDSTIP------ISDIELSGYNEFKAKGTSL 384
           +  D SE     S   ++  L  F   +   S +P      ++++E   + EFK KG + 
Sbjct: 276 TPGDKSEAPPNPSPVQDNDLLIDFEAPALKTSNVPATYSPNLTELERHSFEEFKEKGANS 335

Query: 385 FKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPS 444
           F+ GDY  + Q YEKSLN+LPL HPLR+++ SNII  +LK+GEY +++ ++S AL+L P 
Sbjct: 336 FRTGDYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIP- 394

Query: 445 SKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIM 504
            +    + I N +P +++ + W KIM  +A +FE +E+++KALETYQ+LI+      K++
Sbjct: 395 -QGSMNSNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEAGVTSSKVL 453

Query: 505 QGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNSP--ISVDSTSE----- 557
           + +R+CQ  I                          +T   S  P  +++++ SE     
Sbjct: 454 EARRQCQKAIALEKKPVSVARKSETSIPKAA-----VTKKPSGRPAKVTLENPSEKLARV 508

Query: 558 ----IKKRELENAKLALYDKVFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDL 613
                K+++LE  +  L+D+V   I  W +G DD++R LLA   +++ W NWK+VS  DL
Sbjct: 509 QDINKKEKDLEAQRFLLHDEVSSLIQEWCEGHDDNLRELLARFHTIVDWVNWKEVSTADL 568

Query: 614 VMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668
           V+PK+ K+ Y+KAVAKTHPDKI +S  L+ KMIAEN+F  LS AW+ FK +N ++
Sbjct: 569 VVPKKAKVIYLKAVAKTHPDKIQDSWPLKRKMIAENVFIVLSKAWETFKEKNQLS 623

>AGR352C Chr7 complement(1383723..1385669) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR320C
           (SWA2)
          Length = 648

 Score =  263 bits (672), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 184/575 (32%), Positives = 283/575 (49%), Gaps = 89/575 (15%)

Query: 138 LVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKSKQKE-------------R 184
           + DE +D E+A+LMSLGL I  A ++Y     YE+    L+ ++ E             R
Sbjct: 119 IADEEQDFELAKLMSLGLDIGAANDYYHRGGRYEQ----LRMRRAESDGTRMHRGSNLGR 174

Query: 185 NDLAIRKKE--SGIKMEKSG------------------LSNIVGTDSNNLFSMATDFFNK 224
           N    R ++   G  + +SG                   S++    SN L S A++ FN+
Sbjct: 175 NSDFCRSRDFGRGSDLGRSGDFERGSDLGRAESSETPQWSSLRSGHSNRLVSAASNLFNR 234

Query: 225 GKKLV-DQWTSFP----------PEANDRLNNYSKTHDKVEDYDLPQVNDSPNRILFEDN 273
           G+  + DQ  +             ++N+R +N    H +  DY + Q ND  +       
Sbjct: 235 GRDFIEDQLATHARTSASSRSTLSDSNERFSN----HTQESDYSVNQTNDQAH------- 283

Query: 274 EVVENLPPADNPDQDLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDS 333
            ++   P A   + DLL  F     +  ++  +V    +  +G+  EE           S
Sbjct: 284 -LIHTQPTA--AEVDLLEGFADTEVVQHQSTLEVPRMQA--AGVKSEE-----------S 327

Query: 334 LLDFSEGNLTNSKSNEDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINS 393
           L+DFS    + S +  +             + I+ +ELSGY +F       +K GDY  +
Sbjct: 328 LIDFSSEGPSKSAAQLN------------YVSITPLELSGYYDFNKTAAESYKKGDYHAA 375

Query: 394 LQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKI 453
            Q+Y KSLNTLPL HPLRIIALSNII +QLKIGE+++S++N + A+EL       +  +I
Sbjct: 376 FQDYLKSLNTLPLAHPLRIIALSNIITTQLKIGEHTESMKNINSAVELL--QDVPFDAQI 433

Query: 454 SNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGKRRCQDF 513
            ++ P R++ + W KI+ ++AE  E  ++++ AL  YQ+LI + +    I+ GK RCQ  
Sbjct: 434 QDTSPPRTYKEFWQKILAKKAEVLESQDNYEAALSVYQQLISRGYTPKLILNGKARCQKA 493

Query: 514 INXXXXXXXXXXXXXXXXXXXXXXXQNLTASSSNSPISVDSTSEIKKRELENAKLALYDK 573
            N                       Q  TA      +           + EN +  L+DK
Sbjct: 494 CNSQKGNVSSNPTATTQGDRKNPRKQTATAKGKTEEVKRLKAQNHAIEKQENERFGLHDK 553

Query: 574 VFEKISSWKDGKDDDIRHLLANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPD 633
           V  +I +W  GK  D+RHLL  L +LL W N   +   DLVMPKRVK++Y+KAV+KTHPD
Sbjct: 554 VESRIRTWTAGKSTDLRHLLLGLPALLPWLNSDQMIASDLVMPKRVKLSYLKAVSKTHPD 613

Query: 634 KIPESLSLENKMIAENIFSTLSIAWDKFKLQNDIN 668
           K+P++L LE KM+AE++F TL+ AW  FK +N ++
Sbjct: 614 KLPQTLELEEKMVAEHVFITLTKAWGVFKEENSLS 648

>Ecym_8181 Chr8 (377372..379357) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AGR352C
          Length = 661

 Score =  262 bits (670), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/315 (46%), Positives = 195/315 (61%), Gaps = 19/315 (6%)

Query: 364 IPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQL 423
           +PIS IE+SGY EF   G   F+NGDY N+ Q+Y KSLNTLP+ HPLRI+A SNII +QL
Sbjct: 356 VPISQIEMSGYQEFNINGKQYFRNGDYHNAHQQYIKSLNTLPVGHPLRIVAYSNIITTQL 415

Query: 424 KIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESF 483
           KIGE+++S++N   A +L   S       I  ++P +++ + W KI+ ++AE  E+LE +
Sbjct: 416 KIGEHTESLKNIEKACDLLDGSSL--DGIIQGTNPPKTYKEFWNKIISKKAEVLEYLEHY 473

Query: 484 KKALETYQELIKKNFFDDKIMQGKRRCQDFINXXXXXXXXXXXXXXXXXXXXXXXQNLTA 543
            +AL  Y+ LI K  FD KI++GK RCQ                           ++   
Sbjct: 474 DEALAVYRCLISKGVFDKKIIEGKTRCQ-------KHSKITSEPATEDSALAPVQKDKVP 526

Query: 544 SSSNSPI------SVDSTSEIKKR----ELENAKLALYDKVFEKISSWKDGKDDDIRHLL 593
            S+NS I      S  +   IKKR    ELE  K  L+DKV  KI SW DGK+ D+RHLL
Sbjct: 527 KSNNSSIPERRIRSQKAEELIKKRQEMKELEKQKFRLHDKVHSKIQSWIDGKETDLRHLL 586

Query: 594 ANLSSLLTWCNWKDVSMQDLVMPKRVKITYMKAVAKTHPDKIPESLSLENKMIAENIFST 653
           + LS +LTW NW  +   DLV+PK+VKI YMKA++K HPDK+P +L LE+KM+AE+IFS 
Sbjct: 587 SRLSLVLTWTNWNHIGANDLVIPKKVKIIYMKAISKVHPDKVPSTLDLESKMLAEDIFSV 646

Query: 654 LSIAWDKFKLQNDIN 668
           L  AW+ FKL NDIN
Sbjct: 647 LGNAWNVFKLNNDIN 661

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 55/113 (48%), Gaps = 28/113 (24%)

Query: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNH-PLRIIALSNIIASQLKIGEYSKSIEN 434
           + K KG   FK  DY N+++ Y  +L+   LN  P   I  SNI A  + +G+  K IE+
Sbjct: 124 QLKDKGNKYFKAKDYTNAIKYYNLALD---LNKDP---IFYSNISACYVSLGQLDKVIES 177

Query: 435 SSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           S+ ALEL P+                     + K ++RRA + E LE++  AL
Sbjct: 178 STKALELNPN---------------------YSKALLRRASANESLENYSDAL 209

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 51/115 (44%), Gaps = 34/115 (29%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRI----IALSNIIASQLKIGEYSKSI 432
            K +G   FK  DY N+L+ Y         N+ L +    +  SNI A  + +G+  K +
Sbjct: 104 LKDRGNEFFKKKDYDNALKYY---------NYALVVKKDPVFYSNISACYVSLGQLDKVV 154

Query: 433 ENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           ENS+ ALEL P                      + K ++RRA + E LE++  A+
Sbjct: 155 ENSTKALELKPD---------------------YSKALLRRASANESLENYADAM 188

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 45/82 (54%), Gaps = 5/82 (6%)

Query: 364 IPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQ 422
           IP+ D E+    E FK +G       DY  ++++Y +++ TLP N    +I  +N  A+ 
Sbjct: 88  IPVEDAEIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTN----VIYYANRAAAY 143

Query: 423 LKIGEYSKSIENSSMALELFPS 444
             + EY  +I+++  A+E+ P+
Sbjct: 144 SSVKEYDNAIKDAEKAIEIDPA 165

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           + E+K  G + FK+G+Y+ +++ Y+K +   P N P   I  SN   S +K+ +Y++++E
Sbjct: 3   FEEYKTTGNTYFKDGNYLKAVEYYKKCIEVEPEN-P---IGYSNSAMSLIKLTKYTEALE 58

Query: 434 NSSMALE 440
           +    L+
Sbjct: 59  SCGTGLK 65

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   FK  DY N+L+ Y+ +L TL  +     +  SNI A  + + +  K +ENS+
Sbjct: 109 LKDKGNEFFKQKDYDNALKYYDYAL-TLKKDP----VFYSNISACYVSMNQLDKVVENST 163

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K ++RRA + E LE++  A+
Sbjct: 164 KALELKPD---------------------YSKALLRRASANESLENYPDAM 193

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 40.4 bits (93), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG +LFK  D+ N+++ Y     T  L+     +  SNI A    +  Y K IE ++
Sbjct: 98  LKEKGNALFKKKDFENAIKYY-----TFALSLKEDPVYYSNISACYSSLLNYEKVIEMAT 152

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            AL L P                      + K+++RRA ++E L +F  A+
Sbjct: 153 KALALRPD---------------------YSKVLVRRANAYEKLGNFGDAM 182

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 37.4 bits (85), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSK 430
           +S + + K +G SLFK G Y  ++  Y++ +   P N     +  SN   + +K+GEY++
Sbjct: 1   MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNP----VGYSNKAMALIKLGEYTQ 56

Query: 431 SIENSSMAL 439
           +I+     L
Sbjct: 57  AIQMCQQGL 65

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 39.7 bits (91), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 26/112 (23%)

Query: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENS 435
           E K KG   FK  DY N+L+ Y+ +L  +    P   +  SN+ A  + + E  K IE S
Sbjct: 110 ELKDKGNEYFKEKDYENALKFYDFAL--ILKKDP---VFYSNMSACYVSLNELDKVIEMS 164

Query: 436 SMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           + ALEL P                      + K ++RRA + E LE++  A+
Sbjct: 165 TKALELKPD---------------------YSKALLRRATANEQLENYSDAM 195

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   FK   Y ++L+ Y  +L+      P   +  SNI A  + +G   K +E+S+
Sbjct: 102 LKDKGNQFFKEQKYEDALKYYNYALDLK--QDP---VFYSNISACYVSLGNLEKVVESST 156

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K ++RRA + E+LE+F +A+
Sbjct: 157 KALELKPD---------------------YSKALLRRASANENLENFAEAM 186

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 38.9 bits (89), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 52/116 (44%), Gaps = 34/116 (29%)

Query: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRI----IALSNIIASQLKIGEYSKS 431
           E K KG   FK+ D  N+++ YE         + LR+    +  SNI A    + +  K 
Sbjct: 160 ELKNKGNQYFKSKDNENAIKYYE---------YALRLDQDPVFYSNISACYFAMNQLDKV 210

Query: 432 IENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           IE+S+ ALEL P                      + K ++RRA ++E L + K+AL
Sbjct: 211 IESSNKALELKPD---------------------YSKALLRRANAYEALGNNKEAL 245

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 38.9 bits (89), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 54/115 (46%), Gaps = 34/115 (29%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRI----IALSNIIASQLKIGEYSKSI 432
            K KG +LFK   + ++++ Y         NH +++    +  SNI A  + +G+  K +
Sbjct: 96  LKDKGNALFKEKRFEDAIEFY---------NHAIKLHEDPVFHSNISACYVSLGDLDKVV 146

Query: 433 ENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           E+S+ ALEL P                      + K ++RRA ++E++  ++ A+
Sbjct: 147 ESSTRALELKPD---------------------YSKALLRRASAYENMGRYQDAM 180

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 36.2 bits (82), Expect = 0.058,   Method: Composition-based stats.
 Identities = 17/70 (24%), Positives = 39/70 (55%), Gaps = 4/70 (5%)

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSK 430
           ++ + + K +G +LFK G Y+ ++  Y++ +   P N     +  SN   + +K+GE+++
Sbjct: 5   MTSFEKDKQQGNALFKQGLYLEAVDSYDRLIAAQPQNP----VGYSNKAMALIKLGEHAQ 60

Query: 431 SIENSSMALE 440
           +I+     L+
Sbjct: 61  AIQACQQGLQ 70

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 26/113 (23%)

Query: 375 NEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIEN 434
           +E K +G + FK  DY N++  Y+ +L     N P   +  SN+ A  + +    ++IE 
Sbjct: 87  SELKKRGNAYFKVKDYENAINYYKFALQLK--NDP---VFYSNMAACYISLEHNKEAIEA 141

Query: 435 SSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            S ALEL P                      + K++++RA  +E++  F  AL
Sbjct: 142 CSKALELNPD---------------------YSKVLLKRAAVYENIGKFADAL 173

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.4 bits (80), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 51/119 (42%), Gaps = 25/119 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           + E KAKG   FKNG Y  ++  Y + ++  P N     I  SN   + LK   + ++I 
Sbjct: 3   FEELKAKGNISFKNGSYSEAISWYNRCISIDPSNP----IGYSNKAMALLKADRFDEAIT 58

Query: 434 NSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
                L+L           IS  DPE   N I  K+  R       L+S K +L  YQ+
Sbjct: 59  TCEKGLQL-----------ISKEDPE---NLIKQKLEYR-------LQSAKSSLRDYQK 96

>Ecym_6178 Chr6 (328935..329987) [1053 bp, 350 aa] {ON} similar to
           Ashbya gossypii AFR001W
          Length = 350

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 46/98 (46%), Gaps = 9/98 (9%)

Query: 288 DLLTDFETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDS--LLDFSEGNLTNS 345
           DL + F+ +  I       + HS+SP  G   E   + N   +E +  LLD S+ N  N 
Sbjct: 63  DLTSSFDVENAIRLSGVKILIHSASPMHGNTQEIYDKVN---VEGTRNLLDISKKNGINI 119

Query: 346 --KSNEDSTLFNEN--SNTDSTIPISDIELSGYNEFKA 379
              ++    +FN     N D T PI DI + GYNE KA
Sbjct: 120 FIYTSSAGVIFNGQDIRNADETWPIPDIPMDGYNETKA 157

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   F+N  Y ++++ Y  +L     + P   +  SN+ A  + +G+  K +E S+
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--DDP---VFYSNLSACYVSVGDLKKVVEMST 156

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K+++RRA + E L +F  A+
Sbjct: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186

>KLTH0H02068g Chr8 complement(188834..189946) [1113 bp, 370 aa] {ON}
           similar to uniprot|P53691 Saccharomyces cerevisiae
           YLR216C CPR6 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 370

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 66/153 (43%), Gaps = 38/153 (24%)

Query: 361 DSTIPISDIE--LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHP--------- 409
           DS + + +++  L   +  K  GTSLFK   +  +L +YEKS + L    P         
Sbjct: 203 DSKVDLENVDSVLKAVSAVKDIGTSLFKAQKFQPALTKYEKSSSMLKQYFPQDLPAEDIS 262

Query: 410 ----LRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDI 465
               LRI    NI    +K G+Y K++ +++   E+   + A  K+K             
Sbjct: 263 RVDQLRISIFLNIALCAIKTGDYQKALTSTT---EVVHDAAADDKSK------------- 306

Query: 466 WPKIMIRRAESFEHLESFKKAL------ETYQE 492
             K + RR  ++ HL+  + A+       TYQ+
Sbjct: 307 -AKALYRRGLAYYHLKDPEMAITDLEFATTYQQ 338

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 33.9 bits (76), Expect = 0.33,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 37/69 (53%), Gaps = 4/69 (5%)

Query: 378 KAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSM 437
           K +G  L+K G Y +++  Y++ +   P N     +  SN   + +K+GE++++IE    
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNP----VGHSNKAMALIKLGEHAQAIEACQQ 63

Query: 438 ALELFPSSK 446
            L+L  S +
Sbjct: 64  GLQLAASPQ 72

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG  LFK      +++ Y+ +L       P   +  +NI A  + + ++ K +EN +
Sbjct: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDP---VFYANISACYVSLNDFEKVLENCN 163

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K+++RRA ++E++E+F  A+
Sbjct: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   GTS  K G Y  +L  +EK+ +  P+N    ++ +     S  K+G   K+++
Sbjct: 608 YNAYYGLGTSAMKLGQYEEALLYFEKARSINPVN----VVLICCCGGSLEKLGYKEKALQ 663

Query: 434 NSSMALELFP-SSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
              +A  L P SS +K+K                        +    +  +  AL+T++E
Sbjct: 664 YYELACHLQPTSSLSKYK----------------------MGQLLYSMTRYNVALQTFEE 701

Query: 493 LIK 495
           L+K
Sbjct: 702 LVK 704

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 48/111 (43%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   F+N  Y ++++ Y  +L       P   +  SN+ A  + +G+  K +E S+
Sbjct: 102 LKDKGNQFFRNKKYDDAIKYYNWALELK--EDP---VFYSNLSACYVSVGDLKKVVEMST 156

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K+++RRA + E L  F  A+
Sbjct: 157 KALELKPD---------------------YSKVLLRRASANEGLGKFADAM 186

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG  LFK   + ++++ Y  +L     + P   I  SNI A    + +Y K IE ++
Sbjct: 113 LKDKGNELFKTSKFEDAIKYYHYALKLK--DDP---IYYSNISACYASLLQYEKVIEYAT 167

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            AL+L P+                     + K+++RRA ++E + +F  A+
Sbjct: 168 KALKLRPT---------------------FSKVLMRRALAYEAMGNFGDAM 197

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   GTS  K G Y  +L  +EK+ +  P+N    ++ +     S  K+G   K+++
Sbjct: 601 YNAYYGLGTSSMKLGQYEEALLYFEKARSINPVN----VVLICCCGGSLEKLGYKEKALQ 656

Query: 434 NSSMALELFP-SSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
              +A  L P SS +K+K                        +    +  +  AL+T++E
Sbjct: 657 YYELACHLQPTSSLSKYK----------------------MGQLLYSMTRYSVALQTFEE 694

Query: 493 LIK 495
           L+K
Sbjct: 695 LVK 697

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.1 bits (74), Expect = 0.67,   Method: Composition-based stats.
 Identities = 20/72 (27%), Positives = 34/72 (47%), Gaps = 4/72 (5%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           +N+ K +G + F+ GDY  +   Y++ +   P N     I  SN   S +K G +  ++E
Sbjct: 3   FNDLKQEGNTFFQKGDYAQANGYYDQCIKLEPTNP----IGYSNKAMSLIKQGNHGLAVE 58

Query: 434 NSSMALELFPSS 445
                L+   SS
Sbjct: 59  TCQEGLKYTSSS 70

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 33.1 bits (74), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 4/72 (5%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           + ++K +G   FK G Y  + + Y+K ++  P N P   I  SN   + +K+G Y++ +E
Sbjct: 3   FEQYKEEGNRNFKEGSYKVAAELYQKCVDIEPEN-P---IGYSNKAMALIKLGRYTEVVE 58

Query: 434 NSSMALELFPSS 445
                L   P++
Sbjct: 59  LCRKGLTFTPNT 70

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   GTS  K G Y  +L  +EK+ +  P+N    ++ +     S  K+G   K+++
Sbjct: 619 YNAYYGLGTSSMKLGQYEEALLYFEKARSINPVN----VVLICCCGGSLEKLGYKEKALQ 674

Query: 434 NSSMALELFP-SSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
              +A  L P SS +K+K                        +    +  +  AL+T++E
Sbjct: 675 YYELACHLQPTSSLSKYK----------------------MGQLLYSMTRYNVALQTFEE 712

Query: 493 LIK 495
           L+K
Sbjct: 713 LVK 715

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.0 bits (79), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   F+N  Y ++++ Y  +L       P   +  SN+ A  + +G+  K +E S+
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK--EDP---VFYSNLSACYVSVGDLKKVVEMST 156

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALEL P                      + K+++RRA + E L +F  A+
Sbjct: 157 KALELKPD---------------------YSKVLLRRASANEGLGNFADAM 186

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 27/127 (21%)

Query: 370 ELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYS 429
           +L  YN +   G    K G+Y  +L  +EK+ +  P N     I +     +  K+G   
Sbjct: 654 DLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSN----AILICCCGVTMEKLGNQE 709

Query: 430 KSIENSSMALELFP-SSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALE 488
           K++    +A ++ P SS AK+K                      RA     +  + +AL+
Sbjct: 710 KALNYYELACQIQPTSSLAKFK----------------------RAHLLYSMAKYTQALD 747

Query: 489 TYQELIK 495
            ++ELIK
Sbjct: 748 AFEELIK 754

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 11/121 (9%)

Query: 329 LIEDSLLDFSEGNLT---NSKSN-EDSTLFNENSNTDSTIPISDIELSGYNE-FKAKGTS 383
           ++E+S  +F   NLT   NS S   +ST  ++  N +  IP  D E+    E  K +G  
Sbjct: 54  ILENS--EFKGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNK 111

Query: 384 LFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSMALELFP 443
              N DY  ++ +Y +++  LP N     I  +N  A+   +  Y +++E++  A+ + P
Sbjct: 112 AMANKDYELAINKYTEAIKVLPTN----AIYYANRAAAHSSLKGYDEAVEDAESAISIDP 167

Query: 444 S 444
           +
Sbjct: 168 T 168

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   GTS  K G Y  +L  +EK+ +  P+N    ++ +     S  K+G   K ++
Sbjct: 613 YNAYYGLGTSSMKLGQYEEALLYFEKARSINPVN----VVLICCCGGSLEKLGYKEKVLQ 668

Query: 434 NSSMALELFP-SSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
              +A +L P SS +K+K                        +    +  +  AL+T++E
Sbjct: 669 YYELACQLQPTSSLSKYK----------------------MGQLLYSMTRYNVALQTFEE 706

Query: 493 LIK 495
           L+K
Sbjct: 707 LVK 709

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 33.5 bits (75), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%), Gaps = 4/64 (6%)

Query: 376 EFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENS 435
           + K KG + FKNGDY  ++  YEK+   L  ++P   I  SN+  + +K+  + +++   
Sbjct: 43  DLKVKGNTFFKNGDYETAILYYEKAC-ALDSSNP---IYFSNMATALIKLERWQEAVNAC 98

Query: 436 SMAL 439
              L
Sbjct: 99  DKGL 102

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 25/122 (20%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   G    K G Y   L  +EK+ +  P+N    +I +     +  K+    ++++
Sbjct: 478 YNAYYGLGMCSLKLGQYEECLLHFEKARSINPVN----VILICCCGVALEKLSHQERALQ 533

Query: 434 NSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQEL 493
           N  +A EL P S                        + +RA+    +  +  ALE++++L
Sbjct: 534 NYDLACELQPMSSLA---------------------LFKRAQLLLAMGKYNYALESFEKL 572

Query: 494 IK 495
           +K
Sbjct: 573 VK 574

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 32.7 bits (73), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 36/69 (52%), Gaps = 4/69 (5%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           ++  KAKG   FK  DY  ++  Y+K++   P N     I  SN     +K+ ++S++++
Sbjct: 4   FDTLKAKGNVFFKKCDYETAVLYYQKAITADPSNP----IGYSNNAMGLIKLEKWSEAVD 59

Query: 434 NSSMALELF 442
             +  L++ 
Sbjct: 60  ACNKGLKMI 68

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   FK  D+ N+L+ Y  +L TL    P   +  SNI A  + +G+  K +E+S+
Sbjct: 108 LKDKGNDYFKKQDFENALKYYNYAL-TLK-QDP---VFYSNISACYVSLGQLEKVVESST 162

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            AL+L                        + K ++RRA ++E L ++  A+
Sbjct: 163 EALKL---------------------KHDYSKALLRRASAYESLANYVDAM 192

>Suva_12.114 Chr12 (164933..166042) [1110 bp, 370 aa] {ON} YJR032W
           (REAL)
          Length = 370

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 70/171 (40%), Gaps = 40/171 (23%)

Query: 349 EDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNH 408
           +D T FNE+   ++    S I        K  GT LFK  DY N+  +Y KSLN +    
Sbjct: 223 DDDTHFNEDDFGNALKAASTI--------KESGTLLFKKKDYENAFFKYRKSLNYINEYM 274

Query: 409 P--------------LRIIALSNIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKIS 454
           P              L++    N+  +   +  Y  +I  ++  LE+         + + 
Sbjct: 275 PEPDLDKEKNEQFTDLKMKVYLNLSLALFNLERYDSAITYATYLLEM---------DNVP 325

Query: 455 NSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQ 505
           N D  +++         RR  S+   +   +AL  Y+ L K+   DDK+++
Sbjct: 326 NKDRAKAY--------YRRGNSYLRKKRLDEALRDYR-LCKEMNPDDKVIE 367

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 359 NTDSTIPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417
           N +  IP  D E     E  K +G     N DY  ++ +Y +++  LP N     I  +N
Sbjct: 86  NVEINIPEDDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTN----AIYYAN 141

Query: 418 IIASQLKIGEYSKSIENSSMALELFPS 444
             A+   + EY ++++++  A+ + PS
Sbjct: 142 RAAAHSSLKEYDQAVKDAESAISIDPS 168

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 50/123 (40%), Gaps = 27/123 (21%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   G    K G Y  +L  +EK+ N  P+N  + +I    +   +L   E  K+++
Sbjct: 550 YNAYYGLGMCYMKLGQYDKALLFFEKARNINPVN--VILICCCGVALEKLSYQE--KALQ 605

Query: 434 NSSMALELFPSSK-AKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQE 492
               A EL PSS  AK+K                      +A     +  +  ALE ++E
Sbjct: 606 YYEQACELQPSSSLAKFK----------------------KAHLLYSMARYSAALENFEE 643

Query: 493 LIK 495
           L K
Sbjct: 644 LAK 646

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 49/111 (44%), Gaps = 26/111 (23%)

Query: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436
            K KG   F+N  Y ++++ Y  +L       P   +  SN+ A  + +G+  K +E S+
Sbjct: 102 LKDKGNQYFRNKKYDDAIKYYNWALELK--EDP---VFYSNLSACYVSVGDLKKVVEMST 156

Query: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
            ALE+ P                      + K+++RRA + E L +F  A+
Sbjct: 157 KALEIKPD---------------------YSKVLLRRASANEGLGNFADAM 186

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIE 433
           YN +   G S  K G Y  +L  +EK+ +  P+N  + +I    +   +L+  E  K++ 
Sbjct: 603 YNAYYGLGMSCMKLGQYDEALLHFEKARSINPIN--VILICCCGVALEKLQYQE--KALS 658

Query: 434 NSSMALELFPSS 445
              +A EL PSS
Sbjct: 659 YYELACELQPSS 670

>Smik_10.306 Chr10 (476484..477668) [1185 bp, 394 aa] {ON} YJR032W
           (REAL)
          Length = 394

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 57/141 (40%), Gaps = 31/141 (21%)

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHP--------------LRIIALS 416
           L   N  K  GT LFK  DY N+L +Y KSLN +    P              L++    
Sbjct: 238 LEAANIIKESGTLLFKKKDYSNALFKYRKSLNYINEYMPEPDVDKERNDQFICLKMKVFL 297

Query: 417 NIIASQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAES 476
           N+      + +Y  SI  ++  LE+         + + + D  +++         RR  S
Sbjct: 298 NLSLVLFNLEKYDDSITYATYLLEM---------DNVPDKDQAKAY--------YRRGNS 340

Query: 477 FEHLESFKKALETYQELIKKN 497
           +   +   +AL+ Y+   +KN
Sbjct: 341 YFRKKRLDEALQNYEFCKEKN 361

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 374 YNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLN 407
           ++ FK +G   FK G+Y ++++ YEK +   P N
Sbjct: 3   FDHFKTEGNQYFKEGNYASAIKSYEKCIEINPEN 36

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 20/134 (14%)

Query: 378 KAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSM 437
           KA+G   +K   +  +++ Y K+ +     H   +  L+N  A++ + G+Y ++I+  + 
Sbjct: 271 KAEGNKFYKARKFDEAIEHYNKAWDL----HK-DVTYLNNRSAAEYEKGDYEQAIKTLTE 325

Query: 438 ALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQELIKKN 497
           A+E     +A +K              +  K   R   ++  LE FKKA+E YQ+ + ++
Sbjct: 326 AVEQGREMRADYK--------------LISKSFARIGNAYLKLEDFKKAIEFYQKSLTEH 371

Query: 498 FFDDKIMQGKRRCQ 511
              D I+   R C+
Sbjct: 372 RTPD-ILTKLRNCE 384

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 31.2 bits (69), Expect = 2.7,   Method: Composition-based stats.
 Identities = 23/94 (24%), Positives = 46/94 (48%), Gaps = 11/94 (11%)

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSK 430
           ++ + + K  G +LFK G Y  ++  Y++ +   P N     +  SN   + +K+ EY+ 
Sbjct: 5   VTQFEKEKELGNALFKQGLYREAVDSYDQLITAQPQNP----VGYSNKAMALIKLAEYTH 60

Query: 431 SIENSSMALE--LFPS-----SKAKWKNKISNSD 457
           +I+     L   L P      SK +++ K+S ++
Sbjct: 61  AIQTCQEGLRYALGPEHAAIRSKLQYRLKLSQTE 94

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 57/124 (45%), Gaps = 19/124 (15%)

Query: 368 DIELSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGE 427
           D++     + KA+G  L+K   +  ++ +YE++ N         I  L+N  A++ + G+
Sbjct: 252 DLDRENAEKAKAEGNQLYKQRKFDEAIAKYEEAWNLQK-----DITYLNNRAAAEYEKGD 306

Query: 428 YSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           Y+ +I+  + A+E     +A +K              +  K   R   ++  L+  KKA+
Sbjct: 307 YNSAIKTLNEAVEQGRELRADYK--------------VIAKSFARLGNAYYKLDEVKKAV 352

Query: 488 ETYQ 491
           E Y+
Sbjct: 353 EYYE 356

>CAGL0C03553g Chr3 complement(354713..356035) [1323 bp, 440 aa] {ON}
           similar to uniprot|P07390 Saccharomyces cerevisiae
           YNR045w PET494 translational activator
          Length = 440

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 53/121 (43%), Gaps = 28/121 (23%)

Query: 174 LEILKSKQKERN--DLAIRKKESGIKME------------------KSGLSNIVGTDSN- 212
           +EIL+ + +ER   DL +R+ E+ IK E                  K  + N+V      
Sbjct: 132 IEILRKELEERKKLDLQLRQMEANIKEEAVDSPLQTYTASEVTLRDKGKVKNLVSQRVKM 191

Query: 213 NLFSMATDFFNKGKKLVDQWTSFPPEANDRLNNYSKTH-------DKVEDYDLPQVNDSP 265
           +LF M   F++    L+ Q     PE ++  + +S+ +       +KV+++ LP     P
Sbjct: 192 SLFQMVYSFYSYKSALLSQNKDIEPEMDEFYHFWSEKYGQVNCDMEKVKEFKLPDWQKYP 251

Query: 266 N 266
           N
Sbjct: 252 N 252

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 359 NTDSTIPISDIELSGYNE-FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSN 417
           N +  IP  D E     E  K +G     N DY  ++ +Y +++  LP N     I  +N
Sbjct: 86  NVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTN----AIYYAN 141

Query: 418 IIASQLKIGEYSKSIENSSMALELFPS 444
             A+   + EY ++++++  ++ + PS
Sbjct: 142 RAAAHSSLREYDEAVKDAESSISIDPS 168

>TBLA0E01990 Chr5 (483675..484799) [1125 bp, 374 aa] {ON} Anc_7.313
           YLR216C
          Length = 374

 Score = 32.0 bits (71), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 31/163 (19%)

Query: 361 DSTIPISDIE--LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHP--------L 410
           DS + +SD+   +    + K  GT  FK  +Y  +LQ+Y K    L    P         
Sbjct: 206 DSKVNMSDVNSVIKAAEDVKVIGTEQFKKANYPIALQKYTKCEKLLKEYFPDDLPDEDSA 265

Query: 411 RIIALSNIIA-----SQLKIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDI 465
           R+  L N IA       LK+ +Y+++I  +S    L+  S A  K+K             
Sbjct: 266 RLRQLRNAIALNITLCCLKVKDYTRAIYTASEV--LYEESGATDKDKT------------ 311

Query: 466 WPKIMIRRAESFEHLESFKKALETYQELIKKNFFDDKIMQGKR 508
             K   RR  +++      +AL+ +Q  +  N  D  ++   R
Sbjct: 312 --KAYYRRGLAYKGRNDTDEALKDFQRAMVLNPNDTTVVAAMR 352

>Suva_5.276 Chr5 (436636..437358) [723 bp, 240 aa] {ON} YER148W
           (REAL)
          Length = 240

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 8/56 (14%)

Query: 266 NRILFEDN--EVVENLPPADNPD-QDLLTDFETKIDITKRTAPDVSHSSSPTSGIL 318
           N+I+F+ N  +V EN     NPD   L T F+++ DI KR AP+    +S TSGI+
Sbjct: 14  NKIVFDPNTRQVWEN----QNPDGTKLATTFQSEEDI-KRAAPESEKDTSATSGIV 64

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 19/114 (16%)

Query: 378 KAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSM 437
           KA+G  L+K   +  ++++Y ++  T    H   I  L+N  A++ + G+Y  +IE  + 
Sbjct: 259 KAEGNKLYKQRKFDEAIEKYNEAWET----HN-DITYLNNRAAAEYEKGDYEAAIETLTK 313

Query: 438 ALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKALETYQ 491
           A+E     +A +K              +  K   R   S+  L   KKA++ Y+
Sbjct: 314 AVEQGRELRADYK--------------VISKSFARMGNSYHKLGDLKKAIDYYE 353

>Skud_10.251 Chr10 (447070..448251) [1182 bp, 393 aa] {ON} YJR032W
           (REAL)
          Length = 393

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 59/144 (40%), Gaps = 32/144 (22%)

Query: 378 KAKGTSLFKNGDYINSLQEYEKSLNTLPLNHP--------------LRIIALSNIIASQL 423
           K  GT LFK  DY N+  +Y KSLN +    P              L++    N+     
Sbjct: 244 KDSGTLLFKKNDYSNAFFKYRKSLNYINEYTPEPDVDKERNYQFTSLKMKVYLNLSLVLF 303

Query: 424 KIGEYSKSIENSSMALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESF 483
            + +Y  SI  ++  LE+         + + + D  +++         RR  S+   +  
Sbjct: 304 NVEKYDDSITYATYLLEM---------DNVPDKDQAKAY--------YRRGNSYLKKKRL 346

Query: 484 KKALETYQELIKKNFFDDKIMQGK 507
            +AL+ Y+ L K    DDK++  K
Sbjct: 347 DEALQNYK-LCKDKNPDDKVIGQK 369

>Ecym_3351 Chr3 complement(665793..666677) [885 bp, 294 aa] {ON}
           similar to Ashbya gossypii AGR383W
          Length = 294

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 34/163 (20%)

Query: 293 FETKIDITKRTAPDVSHSSSPTSGILIEENSRRNEPLIEDS----LLDFSEGNLTNSKSN 348
           + T +D T++T    SH+S   S IL + +  +N  L+  S    L+ F    +T  K  
Sbjct: 75  YVTTLDFTRKTIAAGSHNSQNKSSILPKLSMHQN--LLAGSFSRALVGFITMPITIIKVR 132

Query: 349 EDSTLFNENSNTDSTIPISDIELSGYNEFKAKGTSLFKNGDYINSLQE----------YE 398
            +ST++  +S   +   I          +K +G + F  G Y  +L++          YE
Sbjct: 133 YESTVYQYSSLMGAVKSI----------YKTEGLNGFFRGFYATALRDAPYAGIYVLLYE 182

Query: 399 KSLNTLPLNHPLRIIAL--SNIIASQLKIGEYSKSIENSSMAL 439
           K+  TLP   P  I+ +  SNI+ +      YS +I N + A+
Sbjct: 183 KAKETLPRILPSAILEVDHSNILKT------YSSAIINVTGAV 219

>SAKL0D05148g Chr4 (407168..409429) [2262 bp, 753 aa] {ON} similar
           to uniprot|P36124 Saccharomyces cerevisiae YKR029C SET3
          Length = 753

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 25/117 (21%), Positives = 48/117 (41%), Gaps = 12/117 (10%)

Query: 120 DEDYYGSKEDHLYNGDDALVDEVKDMEIARLMSLGLSIEEATEFYENDVTYERYLEILKS 179
           D+D +  + DH Y    A+   ++D            IE A + Y  +  Y R +++ ++
Sbjct: 184 DDDGFTIQCDHCYRWQHAICYGIRD------------IETAPDNYLCNACYPRKVDVKRA 231

Query: 180 KQKERNDLAIRKKESGIKMEKSGLSNIVGTDSNNLFSMATDFFNKGKKLVDQWTSFP 236
           K+K++  L  R  +   K E    +N  G +S        D   + +  +    S+P
Sbjct: 232 KRKQQERLQPRGTKKRRKSEDFTEANTSGYESQTTSESQNDTVKRRETFMSAKESYP 288

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/69 (21%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 371 LSGYNEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSK 430
           +  + EFK KG + +K  ++ +++  Y+K++   P N     +  SN   + +K+  Y+ 
Sbjct: 1   MPSFEEFKIKGNTAYKQNNFTDAVNFYKKAITYDPTNP----VGYSNCAMALIKLNNYAD 56

Query: 431 SIENSSMAL 439
           + +     L
Sbjct: 57  ASQMCQRGL 65

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 31.6 bits (70), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 47/110 (42%), Gaps = 26/110 (23%)

Query: 378 KAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSSM 437
           K KG   FKN  + ++L+ Y     +L +      +  SN  A  + +G+  K +E+++ 
Sbjct: 100 KDKGNEFFKNKQFEDALKYY-----SLAIEVKEDPVFYSNRSACYVSLGQQEKVVEDTTA 154

Query: 438 ALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487
           AL+L P                      + K ++RRA + E L  F  A+
Sbjct: 155 ALKLKPD---------------------YSKCLLRRASANESLGKFADAM 183

>AFR001W Chr6 (437333..438385) [1053 bp, 350 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL001C (ERG26)
          Length = 350

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 13/79 (16%)

Query: 309 HSSSPTSGILIEENSRRNEPLI----EDSLLDFSE--GNLTNSKSNEDSTLFNEN--SNT 360
           HS+SP  G     NS+    ++      +LLD ++  G      ++    +FN     N 
Sbjct: 83  HSASPMHG-----NSQEIYEMVNVEGTKNLLDVAKKCGITAFIYTSSAGVIFNGQDIHNA 137

Query: 361 DSTIPISDIELSGYNEFKA 379
           D T PI DI + GYNE KA
Sbjct: 138 DETWPIPDIPMDGYNETKA 156

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 30.0 bits (66), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 20/100 (20%), Positives = 44/100 (44%), Gaps = 13/100 (13%)

Query: 375 NEFKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIEN 434
           +  ++KG  L+  G+Y  ++  Y+ +     L  P   + L+N+  + LK+  +  ++  
Sbjct: 9   DHLRSKGNDLYSKGEYETAVLYYKNA----SLAEPSNPVHLANMSMALLKLERWEDALSA 64

Query: 435 SSMALELFPSS---------KAKWKNKISNSDPERSFNDI 465
              ALE+             K +W+ K+++     +  DI
Sbjct: 65  CDRALEIMKKGPVTDDKILQKVQWRKKLAHEHLAGTERDI 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.356 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 75,820,078
Number of extensions: 3686336
Number of successful extensions: 17929
Number of sequences better than 10.0: 448
Number of HSP's gapped: 18621
Number of HSP's successfully gapped: 461
Length of query: 668
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 552
Effective length of database: 40,180,143
Effective search space: 22179438936
Effective search space used: 22179438936
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)