Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR318W (MCM21)5.349ON36836817530.0
Smik_4.5775.349ON36836815420.0
Skud_4.5845.349ON36836814780.0
Suva_2.4875.349ON36836814660.0
KAFR0C018705.349ON3413306811e-86
TDEL0E027805.349ON3473376785e-86
KNAG0C055205.349ON3853536623e-83
CAGL0H07139g5.349ON3582856301e-78
Kpol_1051.55.349ON3703546014e-74
ZYRO0D10120g5.349ON3293345923e-73
TPHA0D020705.349ON3733605804e-71
SAKL0G08888g5.349ON3793485651e-68
KLTH0H14806g5.349ON3462785063e-60
TBLA0H019805.349ON3592354716e-55
NCAS0F028505.349ON2812964202e-48
Ecym_81845.349ON2482154052e-46
AGR349W5.349ON2422184024e-46
Kwal_34.159865.349ON2312093814e-43
NDAI0I015505.349ON2762863751e-41
KLLA0B10142g5.349ON2931801611e-11
CAGL0G06182g2.113ON68177780.43
TDEL0D035203.273ON104966731.9
NCAS0F019502.406ON1327163722.3
YPL255W (BBP1)6.291ON385241694.6
KNAG0G026908.702ON76997677.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR318W
         (368 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 a...   679   0.0  
Smik_4.577 Chr4 (1030208..1030259,1030337..1030526,1030557..1031...   598   0.0  
Skud_4.584 Chr4 (1040035..1040086,1040162..1040345,1040376..1041...   573   0.0  
Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341) [...   569   0.0  
KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026...   266   1e-86
TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044...   265   5e-86
KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa] ...   259   3e-83
CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {...   247   1e-78
Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON} (10484.....   236   4e-74
ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 a...   232   3e-73
TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.3...   228   4e-71
SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [114...   222   1e-68
KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, ...   199   3e-60
TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080...   186   6e-55
NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.34...   166   2e-48
Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON} ...   160   2e-46
AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic h...   159   4e-46
Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {O...   151   4e-43
NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.34...   149   1e-41
KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 a...    67   1e-11
CAGL0G06182g Chr7 (589050..591095) [2046 bp, 681 aa] {ON} simila...    35   0.43 
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    33   1.9  
NCAS0F01950 Chr6 (391016..394999) [3984 bp, 1327 aa] {ON} Anc_2....    32   2.3  
YPL255W Chr16 (67725..68882) [1158 bp, 385 aa] {ON}  BBP1Protein...    31   4.6  
KNAG0G02690 Chr7 complement(603041..605350) [2310 bp, 769 aa] {O...    30   7.8  

>YDR318W Chr4 (1103758..1103809,1103893..1104947) [1107 bp, 368 aa]
           {ON}  MCM21Protein involved in minichromosome
           maintenance; component of the COMA complex (Ctf19p,
           Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits
           that are in contact with centromeric DNA and the
           subunits bound to microtubules
          Length = 368

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/368 (92%), Positives = 342/368 (92%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MSRIDDLQQD              REKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN
Sbjct: 1   MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120
           NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120

Query: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180
           HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL
Sbjct: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180

Query: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240
           VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300
           PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD
Sbjct: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300

Query: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIAXXXXXXXXXXXXN 360
           LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIA            N
Sbjct: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>Smik_4.577 Chr4
           (1030208..1030259,1030337..1030526,1030557..1031421)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/368 (80%), Positives = 323/368 (87%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS+IDDLQQD              RE+LK  IK+KRKNE+S+NPIVQEFEDLF+QFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKTSIKNKRKNEDSSNPIVQEFEDLFEQFPQLN 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120
           NFLFNEHPELEE DD+ +S A   IPAT IPYEPKKRAKL N+E LPEQEWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELEEMDDRGVSIASVVIPATLIPYEPKKRAKLNNDENLPEQEWVLKTQPMVQ 120

Query: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180
           HQMFDP VADLLDTDILTSPSKRKRKLKI+DI++ D+ +LED IV+ENVYR+FGITFFPL
Sbjct: 121 HQMFDPEVADLLDTDILTSPSKRKRKLKIEDINSIDKGKLEDSIVVENVYRIFGITFFPL 180

Query: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240
           VDPIDLKIKD S EIFVDREMLGIRLEVFSERTS+FEKPHY+LLKKRIKSNSWFLFKHT+
Sbjct: 181 VDPIDLKIKDDSDEIFVDREMLGIRLEVFSERTSKFEKPHYILLKKRIKSNSWFLFKHTV 240

Query: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300
           PSFIDVQGIFDDTNGGLV+S+DDAYLFAKRVFLQLVE+QKR+QIFKDLEAKKIIHDL+LD
Sbjct: 241 PSFIDVQGIFDDTNGGLVVSYDDAYLFAKRVFLQLVEIQKRQQIFKDLEAKKIIHDLNLD 300

Query: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIAXXXXXXXXXXXXN 360
           LESSM SFFVKD+KVELFVKQNEIVSCSILDDIHDFS NNK+KWEIA            N
Sbjct: 301 LESSMASFFVKDVKVELFVKQNEIVSCSILDDIHDFSHNNKNKWEIALLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>Skud_4.584 Chr4
           (1040035..1040086,1040162..1040345,1040376..1041246)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  573 bits (1478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/368 (77%), Positives = 315/368 (85%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS+IDDLQQD              RE+LK  IK+KRKN++S NPI+QEFE+LFDQFPQLN
Sbjct: 1   MSKIDDLQQDIESLLSEIKSLEKSREELKLNIKNKRKNQDSTNPIIQEFEELFDQFPQLN 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120
           NFLF+EHPEL+E DDKD S     IPATP  +EPKKRAKL+N+E + EQEWVL+TQPMVQ
Sbjct: 61  NFLFDEHPELDERDDKDTSSKSVVIPATPTLHEPKKRAKLDNDENVSEQEWVLRTQPMVQ 120

Query: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180
           HQMFD  VADLLDTDILTSPSKRKRKLKI DI TSDR++LED I++ENVYRMFGITFFPL
Sbjct: 121 HQMFDSAVADLLDTDILTSPSKRKRKLKIADIDTSDRNDLEDSIIMENVYRMFGITFFPL 180

Query: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240
           VDP DLKIKD S EIFVDREMLGIRLEVFSER S+FEKPHY+LLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPADLKIKDVSDEIFVDREMLGIRLEVFSERKSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300
           PSFIDVQGIF++TNGGLVISHD+ YLFAKRVFLQLVE+QKR+Q FKDLEAKKIIHDLDLD
Sbjct: 241 PSFIDVQGIFNETNGGLVISHDNVYLFAKRVFLQLVEIQKRQQKFKDLEAKKIIHDLDLD 300

Query: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIAXXXXXXXXXXXXN 360
           L+SSMVSFFVKD+KVELFVKQNEIVSCSILD+IHDFS+ NKSKWEI             N
Sbjct: 301 LQSSMVSFFVKDVKVELFVKQNEIVSCSILDEIHDFSRKNKSKWEIVLLGSLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSF+TIF+
Sbjct: 361 HSFSTIFR 368

>Suva_2.487 Chr2 (861131..861182,861257..861446,861477..862341)
           [1107 bp, 368 aa] {ON} YDR318W (REAL)
          Length = 368

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/368 (76%), Positives = 317/368 (86%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS+IDDLQQD              RE+LK K++DKRKN+ S NPI+QEFEDLFDQFPQLN
Sbjct: 1   MSKIDDLQQDVESLLSEIKSLEKSREELKTKLRDKRKNQSSTNPIIQEFEDLFDQFPQLN 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120
           NFLFNEHPEL++ DDKDIS      PAT IPYEPKK+AKLEN+E LPE EWVLKTQPMVQ
Sbjct: 61  NFLFNEHPELDDMDDKDISMVLKSTPATSIPYEPKKKAKLENDENLPEHEWVLKTQPMVQ 120

Query: 121 HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL 180
           H+MFD  VADLLDT+ILTSPSKRKRKL +++I+TSD+S LED I+LEN+YRMFGITFFPL
Sbjct: 121 HKMFDSDVADLLDTEILTSPSKRKRKLNLEEINTSDKSMLEDSIILENIYRMFGITFFPL 180

Query: 181 VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI 240
           VDPIDLK+KD+S EI VDREMLGIRLEVF+ERTS+FEKPHY+LLKKRIKSNSWFLFKHTI
Sbjct: 181 VDPIDLKMKDSSDEIVVDREMLGIRLEVFNERTSKFEKPHYILLKKRIKSNSWFLFKHTI 240

Query: 241 PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLD 300
           PS+IDVQ IF+DTNGGLVIS DDAYLFAKRVF+QLVE+QKR+Q FKDLEAKKIIH+LDLD
Sbjct: 241 PSYIDVQAIFNDTNGGLVISPDDAYLFAKRVFVQLVEIQKRQQSFKDLEAKKIIHNLDLD 300

Query: 301 LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIAXXXXXXXXXXXXN 360
           L+SSMVSFFVKD+KVELF+KQNEIVSCSILD+IHDF+Q NK+KWE+             N
Sbjct: 301 LQSSMVSFFVKDVKVELFLKQNEIVSCSILDEIHDFNQKNKNKWELLLLGPLDDLELKLN 360

Query: 361 HSFATIFK 368
           HSFATIFK
Sbjct: 361 HSFATIFK 368

>KAFR0C01870 Chr3 complement(372621..373594,373748..373799) [1026
           bp, 341 aa] {ON} Anc_5.349 YDR318W
          Length = 341

 Score =  266 bits (681), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 141/330 (42%), Positives = 220/330 (66%), Gaps = 19/330 (5%)

Query: 26  EKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLNNFLFNEHPE------LEETDDKDIS 79
           E+L+  I   R+ ++ AN +++EFE+LF QFPQL + L+ E+        LE   D+++ 
Sbjct: 5   EELEQDIASLRREKQPANTVMREFEELFQQFPQLRDLLYKEYKGPGDETLLEPLQDQNL- 63

Query: 80  RAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQHQMFDPGVADLLDTDILTS 139
               +   TP     +KR K ++ + LPE EWVL+ Q  ++H +FD  V D+LDT+IL+S
Sbjct: 64  ---VEKFQTP----SRKRPKTKSSDNLPEDEWVLQNQVPLEHNLFDKSVGDILDTEILSS 116

Query: 140 PSKRKRKLKIDDISTSDR---SELEDYIVLENVYRMFGITFFPLVDPIDLKIKDASGEIF 196
           PSKR+++L  DD S+        L D I++EN++R+FGITFFP+VDP DL++   + E+ 
Sbjct: 117 PSKRRQRLNGDDRSSIGNLPLDNLHDQIMVENIFRLFGITFFPVVDPSDLQMNIETQEMD 176

Query: 197 VDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTIPSFIDVQGIFDDTNGG 256
             REMLGIRL++F E + +++KP Y+LLKK+IKS++W +FKHTIPS+I V+ IF++ + G
Sbjct: 177 TMREMLGIRLDIFDELSKKYDKPMYILLKKKIKSDTWDIFKHTIPSYIGVEKIFEEVSAG 236

Query: 257 LVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDLESSMVSFFVKDIKVE 316
           L IS++D YLF+K ++LQL++   R+   K  E K +I +L + L S+ VSF +   ++E
Sbjct: 237 LAISYEDIYLFSKEIYLQLLKESARKGKLKKFEEKGLISNLRISLSSTKVSFSIGTFEIE 296

Query: 317 LFVKQNEIVSCSILDDIHDFSQNNKSKWEI 346
           L+++ N I+SCS +  I D S   +SKWE+
Sbjct: 297 LYLQDNIIISCSFVKGIRDASV--RSKWEV 324

>TDEL0E02780 Chr5 complement(534940..535931,535996..536047) [1044
           bp, 347 aa] {ON} Anc_5.349 YDR318W
          Length = 347

 Score =  265 bits (678), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 214/337 (63%), Gaps = 20/337 (5%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS ++DLQQD              R+ LK +++    ++ + +P+V+ F+ +F QFPQL 
Sbjct: 1   MSELEDLQQDIDALTREIGDLVKERDGLKDELRRNDADKLANHPVVKNFQSVFHQFPQLY 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQ--PM 118
           + L  E     E   +D           PI  + K+   + +    P+++   +    P+
Sbjct: 61  DVLSEETTARHEESTQD-----------PISLKRKRNTDVNS----PKKDKSFRGDHPPV 105

Query: 119 VQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFF 178
            QHQMFD  +A  +DT+ILTSPSK +R++K    +  D     + ++LENVYRMFGIT+F
Sbjct: 106 FQHQMFDESIAQFIDTNILTSPSKARRRMKD---TKYDEDAPRNQVLLENVYRMFGITYF 162

Query: 179 PLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKH 238
           P+VDP DLK+   + +  ++REM+GIRLEVF+E  ++FEKP+Y+LLKK+IKS+SW LFKH
Sbjct: 163 PVVDPTDLKVNKETNKTEINREMIGIRLEVFNESIARFEKPYYILLKKKIKSDSWLLFKH 222

Query: 239 TIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLD 298
           T+P FIDV  +F+ TNGG +ISH++ YLFAK V+ QL+E+  R Q  +DL +  +I +LD
Sbjct: 223 TVPIFIDVHALFNKTNGGAIISHENIYLFAKTVYRQLIELTARMQNLEDLMSSGVIDNLD 282

Query: 299 LDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHD 335
           LDLE++ VSF   +++  L + +++IVSCS++ +  D
Sbjct: 283 LDLEAAAVSFSKNEVQFRLMLHKDQIVSCSLVGEALD 319

>KNAG0C05520 Chr3 complement(1072299..1073456) [1158 bp, 385 aa]
           {ON} Anc_5.349 YDR318W
          Length = 385

 Score =  259 bits (662), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 213/353 (60%), Gaps = 27/353 (7%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKR----KNEESANPIVQEFEDLFDQF 56
           M  ++DL+QD                 +K +I+DKR    + +++ N ++QEFE +F++F
Sbjct: 1   MRELEDLEQDIDALEKEIESLKKRTADVKGEIRDKRLGGSRTKDTTNVVIQEFESVFEKF 60

Query: 57  PQLNNFLFNEH-PELEETDDKDIS--------RAQ------ADIPATPIPYEPKKRAKLE 101
           PQL + L+N++ P+  + DD D +        RA           ATP+     K  +  
Sbjct: 61  PQLYDILYNDYRPDASDNDDNDTNSVDSAGSNRANQTNNRSVSATATPVKTGKDKAHQQG 120

Query: 102 N--EEILPEQEWVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSE 159
           N  +E LPE EWVLK Q  ++HQMFD  V DLLDTDIL+SPSKRKR         +D S 
Sbjct: 121 NRSDEDLPEDEWVLKNQVPIEHQMFDQSVGDLLDTDILSSPSKRKRNPAQ---HGADTSR 177

Query: 160 LEDYIVLENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKP 219
           L + I+LEN YR+FGIT+FP+VDP DL++   + ++ + REMLG+R +VF+++ S+FEKP
Sbjct: 178 LHEKILLENAYRLFGITYFPVVDPADLQLNAETQKMVITREMLGVRFDVFNDQDSKFEKP 237

Query: 220 HYVLLKKRIKSNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQ 279
            YVLLKK +K+  W +FKHTIP  IDV  +F    GGL  S++D YLF+K V+++LV+  
Sbjct: 238 FYVLLKKNLKAKVWEIFKHTIPGNIDVHSLFHTITGGLATSNNDIYLFSKEVYVRLVQSS 297

Query: 280 KRRQIFKDLEAKKIIHDLDLDLESSMVSFFVKD---IKVELFVKQNEIVSCSI 329
            R + F  L+ + +I DL  DL S+ VSF       I V+L ++ NE+VS  +
Sbjct: 298 LRLKHFNSLQERGLIEDLRGDLRSTNVSFMTGPRFMIDVKLTIQNNEVVSVYV 350

>CAGL0H07139g Chr8 complement(703350..704426) [1077 bp, 358 aa] {ON}
           some similarities with uniprot|Q06675 Saccharomyces
           cerevisiae YDR318w MCM21
          Length = 358

 Score =  247 bits (630), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 193/285 (67%), Gaps = 11/285 (3%)

Query: 48  EFEDLFDQFPQLNNFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEI-- 105
           +F D+F++ P L + L     +   TD  D +     IP TP   + K R+ + NE++  
Sbjct: 49  DFNDIFEKNPGLRDLLLGYEIDKSATDVDDTNI----IPVTP---QKKSRSSVVNEKLHS 101

Query: 106 LPEQEWVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIV 165
           LPE EWVLKTQP+V+H++FD  V D++DTDIL SPSKRK+K++  + +++ +   E  I 
Sbjct: 102 LPEHEWVLKTQPLVEHRLFDESVRDVIDTDILISPSKRKQKIQQLNPNSTGKVSKEP-IQ 160

Query: 166 LENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLK 225
            EN+YR+FGI++FPLVDP DL     + ++ V R+MLGIR ++F+E +  FEKPHY+LLK
Sbjct: 161 YENIYRLFGISYFPLVDPSDLIFDSKTEKMIVTRDMLGIRFDIFNESSKSFEKPHYILLK 220

Query: 226 KRIKSNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIF 285
           K  KS+ W LFK+T+P++IDV+GIF +  GGL+ ++DD YLFAK ++L LVE+  R ++F
Sbjct: 221 KSAKSDDWKLFKYTVPNYIDVEGIFAEVTGGLIRTYDDVYLFAKCIYLLLVEIVIRSELF 280

Query: 286 KDLEAKKIIHDLDLDLESSMVSFFVKD-IKVELFVKQNEIVSCSI 329
             LE   II DLD+DL+S ++   ++   K+E  + Q  I++C+I
Sbjct: 281 LQLEKDGIIDDLDMDLQSLVIKCTLQGTTKIEFHIHQYSIIACTI 325

>Kpol_1051.5 s1051 (10484..11596) [1113 bp, 370 aa] {ON}
           (10484..11596) [1113 nt, 371 aa]
          Length = 370

 Score =  236 bits (601), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 210/354 (59%), Gaps = 13/354 (3%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS + +L+QD              R+ +K K+ +    E +  PI ++FEDLF   PQL 
Sbjct: 1   MSDLLELEQDVTALRREIESLTKRRDAVKDKLANNEIEEYTQKPISKDFEDLFQSHPQLY 60

Query: 61  NFLFNEHPELEETDDKDIS-RAQADIPATPIPYEPKKRAKLENEEI-LPEQEWVLKTQPM 118
           + L ++  + +         R +     + I     KR K   ++  + E EW+LK+QP+
Sbjct: 61  DLLSSDKDKNKSKKKPSSEERDEGKHMTSEIS---NKRVKPNEQDTDISEDEWILKSQPL 117

Query: 119 VQHQMFDPGVADLLDTDILTSPSKRKRKL-KIDDISTSDRSE----LEDYIVLENVYRMF 173
           VQH+MF+ G++D+++TDILTSPSKRK KL  IDD S + +      L   I +EN++R+F
Sbjct: 118 VQHKMFNSGISDMINTDILTSPSKRKLKLGNIDDDSETSKGNKQKNLNKKIRIENLFRLF 177

Query: 174 GITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSW 233
           GITFFPLVDP DLK+      + + REMLGIRLE+++E  S FEKPHY+LLKK++K +SW
Sbjct: 178 GITFFPLVDPTDLKMNKELKTMEIKREMLGIRLEIYNEHNSTFEKPHYILLKKKLKIDSW 237

Query: 234 FLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKI 293
            +FKHTIPS+ID++  +   N G++ ++D+  +FAK V+++L+    R Q  + L   + 
Sbjct: 238 MIFKHTIPSYIDIESKWFGINNGMLNTYDEINVFAKEVYIELIHGNIREQKIQKLTELEY 297

Query: 294 IHDLDLDLESSMVSFFVKD-IKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEI 346
           I D   D+ SS V   + D  ++ELF+K   IVSC I  D        K+KW+I
Sbjct: 298 IRDCQTDVNSSRVILTLIDQYEIELFLKNETIVSCKIPTD--RMEPMLKNKWQI 349

>ZYRO0D10120g Chr4 (852141..852192,852258..853195) [990 bp, 329 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 329

 Score =  232 bits (592), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 136/334 (40%), Positives = 210/334 (62%), Gaps = 31/334 (9%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           M  +++L+QD              R++LKA+  +K  +E S +P+V+EFE +F +FP+L 
Sbjct: 1   MQSVEELEQDIESLTREITSLCQKRDELKAQKFEKECSELSNHPVVKEFESVFTKFPKLY 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ 120
             L  E+ ++ +++D D S    D P+T +     KR KLE  +              VQ
Sbjct: 61  EVLAREN-QIVDSNDNDTS----DEPST-VDSSFVKRRKLEFSD------------GSVQ 102

Query: 121 HQMFDPGVADLL-DTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFP 179
           ++MFD  +ADLL DT   TSP KR+ KL+       +   LE  + +EN YR+FGITFFP
Sbjct: 103 NKMFDKSIADLLGDTSSSTSPGKRRSKLQ-------NFKGLESQVSIENAYRLFGITFFP 155

Query: 180 LVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHT 239
           LVDP D+  +       ++R+MLGIRLEVF+E   QFEKPHY+LLK+ +K NSW LFKHT
Sbjct: 156 LVDPSDINFQRND----INRKMLGIRLEVFNEGLRQFEKPHYILLKQNLKLNSWSLFKHT 211

Query: 240 IPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDL 299
           IP+FID++ IF   + G++ ++D  YLFAK+V++QL+ V +R QI ++L+  ++I +L++
Sbjct: 212 IPAFIDLESIFQKIDNGIITTYDQVYLFAKQVYIQLLCVSQRVQIIEELQDIRLISNLEI 271

Query: 300 DLESSMVSFFVKDIK-VELFVKQNEIVSCSILDD 332
           DL+ + VSF ++ +K V LF++ ++++SC   DD
Sbjct: 272 DLQIAAVSFDIQGMKRVRLFLQDDQVISCDTFDD 305

>TPHA0D02070 Chr4 (426798..427919) [1122 bp, 373 aa] {ON} Anc_5.349
           YDR318W
          Length = 373

 Score =  228 bits (580), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 123/360 (34%), Positives = 222/360 (61%), Gaps = 18/360 (5%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           MS +D+L+QD              ++ L+ ++ +   N++   P++QEF  LF+QFP L 
Sbjct: 1   MSTLDNLRQDIDALRKELEYLNTKKKALENEVNNAIVNDKEEEPLLQEFNVLFNQFPDLF 60

Query: 61  NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAK-LENEEILPEQEWVLKTQPMV 119
             L  E  +  E   K     + ++  T      +K+++ L +++ +PE EW+L  QP++
Sbjct: 61  ELLSKEKIKRSEMLGK---HHRDEVFGTEEEANKRKQSEHLNDDDNMPEHEWILNKQPII 117

Query: 120 QHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRS----------ELEDYIVLENV 169
           +H++F   +++ ++TDILTSPSKRK+ ++  +I+ +D +          ELE  I+ EN 
Sbjct: 118 EHKIFASELSENINTDILTSPSKRKKVIEGIEITGNDANMGYKNPNLNEELERKIIKENT 177

Query: 170 YRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIK 229
           +R+FGI++FP+VDP DL    ++ E+   REM+GIRLEVF +    FEKPHY+LLKK+ K
Sbjct: 178 FRLFGISYFPVVDPCDLVHDKSNNEVNNKREMIGIRLEVFDDTLGVFEKPHYILLKKKTK 237

Query: 230 SNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLE 289
           SN+W LFK+TIP++ID+  IF   N G++++++D Y+FAK+V++QL+ +Q R++    L+
Sbjct: 238 SNNWGLFKYTIPNYIDIYLIFQRINNGILLTYEDIYIFAKQVYIQLLLIQNRKKNLMQLQ 297

Query: 290 AKKIIHDLDLDLESSMVSFFVKD--IKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIA 347
              I+ D+ +DL   ++   + +   K+ L+++++++ S SI  +  D   +++ +W++ 
Sbjct: 298 EANIVSDILIDLNLKLIKMNIINTTTKLTLYLEKDKVTSVSIYSETLDI--HSQKRWKLT 355

>SAKL0G08888g Chr7 complement(760335..761422,761488..761539) [1140
           bp, 379 aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 379

 Score =  222 bits (565), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/348 (38%), Positives = 204/348 (58%), Gaps = 27/348 (7%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIK------DKRKNEESANPIVQ----EFE 50
           MS++ + QQD              +++L   I+      ++ ++E    P+++    E+ 
Sbjct: 1   MSKLQEHQQDIDALNREIASLAQQQDELHLHIQKYEDQLERLRHESEKVPVIELTTDEYG 60

Query: 51  DLFDQFPQLNNFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEI---LP 107
            +F+ FP L+  L  +  + E     D +       +T I   P+KR  + N+ +   +P
Sbjct: 61  PIFEAFPHLHKLLSEKLFQQESNRGHDNTALSTPKKSTTI--SPRKR--VVNQVLPPSMP 116

Query: 108 EQEWVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKL-KIDDISTSDRSELEDYIVL 166
           E EWVL+ QP V+H+MFD  +ADL+DT+ILTSPSKRK KL K+ +    ++  L DY+ L
Sbjct: 117 EHEWVLRMQPAVEHKMFDSDIADLIDTEILTSPSKRKEKLSKVHN----NKQNLIDYVRL 172

Query: 167 ENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKK 226
           ENVYRM GIT FP+VDP DLK+   + E  + REM+G+RLEVF+E  S FEKP+YVLLKK
Sbjct: 173 ENVYRMTGITVFPVVDPSDLKVNKETKEYEILREMMGVRLEVFNEVLSTFEKPYYVLLKK 232

Query: 227 RIKSNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIF- 285
             K +SW +FKHTIP++ID+Q +F+ TNGG++  +   YLFAK+V+  L++   + Q+F 
Sbjct: 233 SSKRDSWDIFKHTIPNYIDIQLLFEKTNGGIITDYSGTYLFAKKVYQLLLQTSLKAQVFE 292

Query: 286 ----KDLEAKKIIHDLDLDLESSMVSFFVKDIKVELFVKQNEIVSCSI 329
               +D    +I  DL +++ S  VSF     K  L +  N +   SI
Sbjct: 293 VLAREDSRISQIESDLAVNVVSFKVSFKNLSFKTVLQMDWNNVHGASI 340

>KLTH0H14806g Chr8 (1285442..1285493,1285556..1286544) [1041 bp, 346
           aa] {ON} similar to uniprot|Q06675 Saccharomyces
           cerevisiae YDR318W MCM21 Protein involved in
           minichromosome maintenance component of the COMA complex
           that bridges kinetochore subunits that are in contact
           with centromeric DNA and the subunits bound to
           microtubules
          Length = 346

 Score =  199 bits (506), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 111/278 (39%), Positives = 172/278 (61%), Gaps = 17/278 (6%)

Query: 63  LFNEHPELEETDDKDISRAQADIPATPIPYEPKKR------AKLEN-EEILPEQEWVLKT 115
           LF ++PEL+ T  + I +     P TP    PKKR      A+L N    +PE EWVLKT
Sbjct: 49  LFQKNPELKHTLSQKIFKETDSFPQTPY-SSPKKRPLKSSAAQLSNLSPDIPESEWVLKT 107

Query: 116 QPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGI 175
           Q  V+H+ FD  VADL++TDILTSPSKRKR  +     +    EL   + +EN+YRM GI
Sbjct: 108 QVPVEHKFFDSAVADLIETDILTSPSKRKRAAQ-----SRAHEELVQKVQIENIYRMLGI 162

Query: 176 TFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFL 235
           + FP+VDP DL+  +   EI + R+MLG+RLE+F+E    FE P+Y+L K+  K++ W +
Sbjct: 163 STFPVVDPSDLEGTE-EDEINIKRKMLGLRLELFNELERSFEPPYYILFKQNPKNSYWNI 221

Query: 236 FKHTIPSFIDVQGIFDDT-NGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKII 294
           F+HT+PS++ V+ +F    + GL+ +  + Y FAK+V+  L+ +  + QIF+  E K+ I
Sbjct: 222 FRHTVPSYVGVEQMFQQVRSNGLLANQSEIYTFAKKVYKSLLSISVKTQIFRRTEKKEAI 281

Query: 295 HDLDLDLESSMVSFFVKDIK--VELFVKQNEIVSCSIL 330
             L++D   + VSF ++ +   V+L +   ++++CS +
Sbjct: 282 SQLEIDPSCTSVSFHIEKLGCFVKLKLDATDVIACSCI 319

>TBLA0H01980 Chr8 complement(466993..468020,468148..468199) [1080
           bp, 359 aa] {ON} Anc_5.349 YDR318W
          Length = 359

 Score =  186 bits (471), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 91/235 (38%), Positives = 154/235 (65%), Gaps = 4/235 (1%)

Query: 116 QPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGI 175
           Q  ++H++FD  ++ LL  ++++ PS+R++++K++  +   R  L+++++LE VYRM GI
Sbjct: 102 QLTLEHKLFDDEISRLLSPEVVSLPSQRRKRMKLERPNLHIREILKNFVILEIVYRMVGI 161

Query: 176 TFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFL 235
           TFFP+VDP DL+  D    + + REMLGIRLE++++  S FEKPHY+LLK+  KS  W +
Sbjct: 162 TFFPVVDPTDLEFLDTKKLLSIRREMLGIRLEIYNDLISSFEKPHYILLKQSEKSKIWSI 221

Query: 236 FKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIH 295
           FK+TIP++ID+  +F   N G++ +  D +LFAK V+  L  + K+ Q FK LE  K+  
Sbjct: 222 FKYTIPNYIDIHSLFLKINNGIITTDSDIFLFAKDVYSALSSISKKIQYFKKLENLKVFE 281

Query: 296 DLDLDLESSMVSFFVKDI-KVELFVKQNEIVSCSILDDIHDFSQNNKS---KWEI 346
           +L++DL    +SF  K I  + + +K+ +I++C+I       ++  ++   KWEI
Sbjct: 282 NLNIDLIGIQISFLFKSIYNIRISLKEWDIITCTIESTESYINKETRTFYRKWEI 336

>NCAS0F02850 Chr6 (571260..572105) [846 bp, 281 aa] {ON} Anc_5.349
           YDR318W
          Length = 281

 Score =  166 bits (420), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 167/296 (56%), Gaps = 40/296 (13%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN 60
           M+ I DL+QD              R++LK+K K K ++  +++PIV E  DL  QFPQLN
Sbjct: 1   MTEIVDLEQDIAALKSEVQALTKKRDELKSKPKLKPRSSSTSDPIVNEITDLITQFPQLN 60

Query: 61  NFLFNEHPELEETDDKDISRAQAD---------IPATPIPYEPKKRAKLENE-EILPEQE 110
             L ++ P + E+     +  ++D         I A    ++  K++KL NE + LPE E
Sbjct: 61  EILLSK-PSVTESSRSTSNEEESDKKRKLDNEKIQA----FQDAKKSKLNNENDDLPEHE 115

Query: 111 WVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELE-DYIVLENV 169
           WVLK Q  V+H+MFD  VAD+L+T++L+SPSKR+  LK       +   L+ +Y +LENV
Sbjct: 116 WVLKNQRPVEHKMFDTSVADVLNTEMLSSPSKRRLILKNGQDEMEENKHLQKEYRLLENV 175

Query: 170 YRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIK 229
           +R+ GI+FF  VDP DL           + +M+GIRL+ F    +Q  K +Y++LKK  K
Sbjct: 176 FRIVGISFFDAVDPNDL-----------ESDMIGIRLDPF----NQPSKVYYIILKKEAK 220

Query: 230 SNS---WFLFKHTIPSFIDVQGIFDDTNGGL------VISHDDAYLFAKRVFLQLV 276
           +N    W + KHTIP +I+V   F ++          + +HDD YL AK V+++L+
Sbjct: 221 NNREGLWTIIKHTIPKYINVTNTFGESKRETWRTMIKIENHDDIYLLAKEVYVKLL 276

>Ecym_8184 Chr8 complement(382634..383380) [747 bp, 248 aa] {ON}
           similar to Ashbya gossypii AGR349W
          Length = 248

 Score =  160 bits (405), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 84/215 (39%), Positives = 132/215 (61%), Gaps = 5/215 (2%)

Query: 119 VQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFF 178
           V+H+MFDP +A   DT+I+ SPSKR + +K    S    +ELE ++ +EN YRM GITFF
Sbjct: 5   VEHRMFDPTIASFFDTEIVRSPSKRNKLMKSSATSIRPDNELEKFVEIENCYRMSGITFF 64

Query: 179 PLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNS-WFLFK 237
           PLVDP  L          +  E+LGIRLEVF+E T ++E P+Y++LK+R K+N  W L+K
Sbjct: 65  PLVDPGKLASNTHHDSTSLVAELLGIRLEVFNETTLKYEPPYYIILKRRPKANQIWDLYK 124

Query: 238 HTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDL 297
           HTIP  ID++ I+  T  G++    + Y+FAK+ +++L+ +  R Q   +L+  ++  ++
Sbjct: 125 HTIPKVIDIEQIWSTTGHGIISMDKEVYIFAKKCYMELLAIHYRLQFICNLDP-QLFENI 183

Query: 298 DLDLESSMVSFFVKDIKVELFVKQ---NEIVSCSI 329
            +D  + M+SF +   ++   V Q     I+ C I
Sbjct: 184 KVDSYAVMLSFQLTGEEIITVVAQLRDRSIIDCDI 218

>AGR349W Chr7 (1379849..1380577) [729 bp, 242 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR318W (MCM21)
          Length = 242

 Score =  159 bits (402), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 89/218 (40%), Positives = 131/218 (60%), Gaps = 8/218 (3%)

Query: 123 MFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPLVD 182
           MFDP +A  LDT++L SPSKR + L      +  R EL ++I +EN YRM GITFFPLVD
Sbjct: 1   MFDPALAPFLDTELLRSPSKRGKILSTRPEQSKQR-ELRNFIEVENCYRMCGITFFPLVD 59

Query: 183 PIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIK-SNSWFLFKHTIP 241
           P  L  +D   E  V+ EMLGIRLEVF+E T +F+ P+YVLL++  K +  W LFKHT+P
Sbjct: 60  PGRLGGQDKDNEGIVN-EMLGIRLEVFNENTRRFDYPYYVLLRRDAKVATRWQLFKHTLP 118

Query: 242 SFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDL 301
             +D + I+  T  G + S  D YLFAK+ + +L+++  R Q    L+   +  ++  D 
Sbjct: 119 KMLDAERIWSTTLNGAICSDSDVYLFAKKCYARLIDMHFRLQFIARLDP-YLFENIRTDS 177

Query: 302 ESSMVSFFVKD----IKVELFVKQNEIVSCSILDDIHD 335
            ++M+SF +      + V + ++  E+ SC +    HD
Sbjct: 178 YAAMLSFLISGGAQPLAVTVLLEGREVRSCQLDQQQHD 215

>Kwal_34.15986 s34 complement(145905..146600) [696 bp, 231 aa] {ON}
           YDR318W (MCM21) - involved in minichromosome maintenance
           [contig 272] FULL
          Length = 231

 Score =  151 bits (381), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 80/209 (38%), Positives = 124/209 (59%), Gaps = 9/209 (4%)

Query: 123 MFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPLVD 182
           MFD  VADL +TDILTSPSKRK+      +++    EL   + +EN+YR  G++ FP+VD
Sbjct: 1   MFDSTVADLFNTDILTSPSKRKKV-----VNSRKHQELIKKLDIENLYRTIGLSTFPVVD 55

Query: 183 PIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTIPS 242
           P D++ +D  GE    R M+G+RLE+F+E    FE PHYVL K+ +K+  W +F+HTIPS
Sbjct: 56  PSDVE-QDEDGETIFRRSMIGLRLEIFNELDKTFEPPHYVLFKQNLKTGHWNIFRHTIPS 114

Query: 243 FIDVQGIFDDTNG-GLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLDLDL 301
           ++ V+ +F+ T     +      Y F K+V+  L+ +  ++Q FK L    I+  L +D 
Sbjct: 115 YVGVERLFEQTKTINPLADIGKIYTFGKKVYTSLLSISTKQQTFKSLAESGIVSQLVIDP 174

Query: 302 ESSMVSF--FVKDIKVELFVKQNEIVSCS 328
             +  SF      + V+L + + +I +CS
Sbjct: 175 SCTSASFQMMQGSVSVKLKLSETDITACS 203

>NDAI0I01550 Chr9 (368193..369023) [831 bp, 276 aa] {ON} Anc_5.349
           YDR318W
          Length = 276

 Score =  149 bits (375), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 150/286 (52%), Gaps = 24/286 (8%)

Query: 1   MSRIDDLQQDXXXXXXXXXXXXXXREKLKAKIKDKRKNEESANPIV-QEFEDLFDQFPQL 59
           MS I DL+QD              R+ LK   KD +K+   A     ++ + L DQFPQL
Sbjct: 1   MSDITDLEQDIAALKVELEGLRAKRDALKDPGKDIQKDTSIAETNADRQLQSLLDQFPQL 60

Query: 60  NNFLFNEH------PELEETDDKD---ISRAQADIPATPIPYEPKKRAKLENEEILPEQE 110
           ++ L +++      P L    + D   +SR +     +P      K  +L     LPE E
Sbjct: 61  HDILLSDNAIDKSSPVLHNNGEDDTSLLSRKRKSEHGSP----NTKHKRLSLSANLPEHE 116

Query: 111 WVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVY 170
           WVLK QP ++H+MFD  VAD+L TDIL+SPSKR  + K        R+     I+LE+ Y
Sbjct: 117 WVLKMQPPIEHKMFDTSVADVLGTDILSSPSKRIIETKERQSDNLQRT----LILLEDFY 172

Query: 171 RMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKS 230
           +  G+ F  L DP DL++ +    + +  +MLG+R E+ S   +Q    +Y+LLKK   S
Sbjct: 173 KKLGVNFLQLFDPNDLEMNEKMEALQMKGDMLGVRFELPSSEGAQ---KYYLLLKKETAS 229

Query: 231 NSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLV 276
           + W  +KH++P+ IDV   F +       SH+D YL AK ++LQL+
Sbjct: 230 DYWIPYKHSLPNIIDVNEYFVNVAAE---SHEDIYLIAKDIYLQLL 272

>KLLA0B10142g Chr2 (887476..887527,887649..888478) [882 bp, 293 aa]
           {ON} similar to uniprot|Q06675 Saccharomyces cerevisiae
           YDR318W MCM21 Protein involved in minichromosome
           maintenance component of the COMA complex that bridges
           kinetochore subunits that are in contact with
           centromeric DNA and the subunits bound to microtubules
          Length = 293

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/180 (28%), Positives = 88/180 (48%), Gaps = 29/180 (16%)

Query: 160 LEDYIVLENVYRMFGITFFPLVDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKP 219
           + D++  EN  R+ G++ FP+               + + E +GIRLE+F E + +++ P
Sbjct: 107 ITDFVQWENSVRLIGVSLFPVN--------------YDNIEFMGIRLELFDELSLKYDPP 152

Query: 220 HYVLLKKRIKS-NSWFLFKHTIPSFIDV----QGIFDDTNGGLVISHDDAYLFAKRVFLQ 274
            YV+LK  +K    W LFKH +P +I++    Q I  DT+     S  +   FA   +  
Sbjct: 153 FYVILKPSVKRLGIWELFKHNLPKYINIHQHWQLITKDTD----TSDSNIMKFANLCYKD 208

Query: 275 LVEVQKRRQIFKDLEAKKI----IHDLDLDLESSMVSFFVKD--IKVELFVKQNEIVSCS 328
           L++V  R Q F+ LE   +       L +D     VSF +    IK+++    +EI+ C+
Sbjct: 209 LLKVHSRVQFFRKLEGNYVNDKQYSLLHIDNMGLNVSFRLGADIIKIKVDDGDDEIIDCT 268

>CAGL0G06182g Chr7 (589050..591095) [2046 bp, 681 aa] {ON} similar
           to uniprot|P38835 Saccharomyces cerevisiae YHR131c
          Length = 681

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 227 RIKSNSWFLFKHTIPSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFK 286
           R +S+S    + T+P  +  Q I  +++ G ++S+ +   F K  F  + + ++ +Q FK
Sbjct: 333 RTRSSSSATVQSTVPKRVASQPISRNSSSGRIVSNGNNSSFGK--FFDMFKSKRSKQDFK 390

Query: 287 DLEAKKIIHDLDLDLES 303
            L++  +   L + LES
Sbjct: 391 SLQSANVT-GLKVTLES 406

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 36/66 (54%), Gaps = 6/66 (9%)

Query: 79  SRAQADIPATPIPYEPKKRAKL-ENEEILPEQEWVLKTQPMVQHQMFDPGVADLLDTDIL 137
           +R Q DIP  P+P  P+    L E E+   E+E ++   P  QH   D  V D  + +IL
Sbjct: 731 NRTQEDIPP-PMP--PRHEQLLKEGEKQKREEELLIAFSPPKQHG--DQNVGDRPNPEIL 785

Query: 138 TSPSKR 143
           TSPS+R
Sbjct: 786 TSPSRR 791

>NCAS0F01950 Chr6 (391016..394999) [3984 bp, 1327 aa] {ON} Anc_2.406
           YMR129W
          Length = 1327

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 73/163 (44%), Gaps = 33/163 (20%)

Query: 34  DKRKNEESANPIVQ-EFEDLFDQFPQLNNFLFNEHPELEETDDKDISRAQADIPATPIPY 92
           +  +N+ + NP  + ++E +FDQ   L+N LF E   L+ ++D            T +  
Sbjct: 660 NGARNQYNFNPTSEGDYEIVFDQ---LSNNLFREPISLQPSEDYTFR--------TSMRV 708

Query: 93  EPKKRAKLEN--EEILPEQEWVLKTQPMVQHQMFDPGVADLLDTDILTSPSKRKRKLKID 150
           +P    KL N  E  L +Q  +    P+V    F       L  DIL + S RK + K+D
Sbjct: 709 KPSASVKLRNQIELCLGDQTDI----PIV----FKGEAPFTLSYDILETSSNRKTEFKLD 760

Query: 151 DISTSDRSELEDYIVLENVYRMFGITFFPLVDPIDLKIKDASG 193
           +I ++      +Y +  + + + G     LV      +KDASG
Sbjct: 761 NIMSN------EYKIKTSSFNVGGDYILSLVS-----VKDASG 792

>YPL255W Chr16 (67725..68882) [1158 bp, 385 aa] {ON}  BBP1Protein
           required for the spindle pole body (SPB) duplication,
           localized at the central plaque periphery; forms a
           complex with a nuclear envelope protein Mps2p and SPB
           components Spc29p and Kar1p; required for mitotic
           functions of Cdc5p
          Length = 385

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 103/241 (42%), Gaps = 27/241 (11%)

Query: 117 PMVQHQMFDPGVADLLDTDILTSPSKRKRKLKIDDIST------SDRSELEDYIVLE--- 167
           P +  Q  DP ++ L + D +    +   KL + DI        + R E+++Y V +   
Sbjct: 153 PFIPPQEDDPLLSKLFNKDGVNEVRRSPYKLSVKDIPGKFPSPLTKRDEIDNYYVRDEDA 212

Query: 168 -NVYRMFGITFFPLVDPIDLK---IKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVL 223
            +  R +   +F L   +DL    ++D   ++   RE      + + +    +E+    L
Sbjct: 213 CHKNREYKKAYFDLFAQMDLNSRDLEDLCEDVREQREQFHRNEQTYKQ---AYEEMRAEL 269

Query: 224 LKKRIKSNSWFLFKHTIPS-FIDVQGIFDDTNGGLVISHDDAYLFAK-RVF----LQLVE 277
           + +  KS + F   +++   +  ++ + D T     ISH+     ++ R++    L+  E
Sbjct: 270 VNELKKSKTLFENYYSLGQKYKSLKKVLDQT-----ISHEAELATSRERLYQEEDLKNFE 324

Query: 278 VQKRRQIFKDLEAKKIIHDLDLDLESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFS 337
           +Q  +Q   DLE K     ++ D++       + D+ ++L ++ NE    S   +I    
Sbjct: 325 IQTLKQRLSDLELKYTNLQIEKDMQRDNYESEIHDLLLQLSLRNNERKDTSAGSNIFSTG 384

Query: 338 Q 338
           Q
Sbjct: 385 Q 385

>KNAG0G02690 Chr7 complement(603041..605350) [2310 bp, 769 aa] {ON}
           Anc_8.702 YPL176C
          Length = 769

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 2/97 (2%)

Query: 58  QLNNFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQP 117
           + N+    E  ELE     +   +  DI    +  E + +       +  EQE  L    
Sbjct: 470 EFNHIGATEQMELESLSITENVYSFIDISQLGLGKEIEVQCSPLLHSVFAEQETTLNVNT 529

Query: 118 MVQHQMFD--PGVADLLDTDILTSPSKRKRKLKIDDI 152
            + +Q  D  P +A+ +   +L SP  R+RK  ID +
Sbjct: 530 TMVNQYGDWTPFMANGVPVSVLASPGTRRRKFPIDTV 566

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,697,171
Number of extensions: 1910312
Number of successful extensions: 7018
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7232
Number of HSP's successfully gapped: 59
Length of query: 368
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 257
Effective length of database: 40,753,473
Effective search space: 10473642561
Effective search space used: 10473642561
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)