Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR145W (TAF12)8.323ON53953921010.0
Smik_4.3898.323ON52552618170.0
Skud_4.4048.323ON53552918090.0
TDEL0F044908.323ON51050411931e-159
KAFR0B057208.323ON48448511301e-150
KLTH0G12298g8.323ON5004979311e-119
Kwal_56.239168.323ON4994908941e-114
Suva_2.3068.323ON5412328651e-109
ZYRO0F10384g8.323ON5581907602e-93
Kpol_543.638.323ON5851937431e-90
NCAS0B035708.323ON5191907251e-88
NDAI0J010208.323ON6381876973e-83
SAKL0H15554g8.323ON5361966885e-83
AGL195C8.323ON5541886774e-81
CAGL0E01397g8.323ON5751966784e-81
TPHA0A015608.323ON5401876694e-80
Ecym_42548.323ON5291956581e-78
KLLA0D16368g8.323ON5111946431e-76
KNAG0I008908.323ON5081716309e-75
TBLA0A039408.323ON7521986423e-74
TBLA0H012808.323ON4051123244e-32
Kpol_1016.55.435ON81284790.61
Kpol_1025.112.413ON87588761.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR145W
         (539 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   813   0.0  
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   704   0.0  
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   701   0.0  
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   464   e-159
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   439   e-150
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   363   e-119
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   348   e-114
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   337   e-109
ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   297   2e-93
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   290   1e-90
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   283   1e-88
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   273   3e-83
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   269   5e-83
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   265   4e-81
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   265   4e-81
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   262   4e-80
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   258   1e-78
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   252   1e-76
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   247   9e-75
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   251   3e-74
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   129   4e-32
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....    35   0.61 
Kpol_1025.11 s1025 complement(31479..34081,34759..34783) [2628 b...    34   1.3  

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/539 (77%), Positives = 417/539 (77%)

Query: 1   MSSNPEXXXXXXXXXXXXXXXXXXXXXQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP 60
           MSSNPE                     QQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP
Sbjct: 1   MSSNPENSGVNANNNTGTGNADAITGAQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP 60

Query: 61  RGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXXXXXXXXXXXXIPTENVPNSSXXXXX 120
           RGKELMFQAAKIKQVYDALTLNRRR                    IPTENVPNSS     
Sbjct: 61  RGKELMFQAAKIKQVYDALTLNRRRQQAAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQ 120

Query: 121 XXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI 180
               TRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI
Sbjct: 121 QQQQTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI 180

Query: 181 NKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQ 240
           NKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQ
Sbjct: 181 NKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQ 240

Query: 241 ESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKISSSNSTEIPSVTGPD 300
           EST                                        KISSSNSTEIPSVTGPD
Sbjct: 241 ESTQQQRVQQQRVQQQQQQQQQQQQQQQQQQQQQQQRQGQNQRKISSSNSTEIPSVTGPD 300

Query: 301 ALKSXXXXXNTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEP 360
           ALKS     NTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEP
Sbjct: 301 ALKSQQQQQNTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEP 360

Query: 361 AIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKL 420
           AIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKL
Sbjct: 361 AIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKL 420

Query: 421 RELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQL 480
           RELVKTVGIDEGDGETVI              FVTNVTAFSCRLAKHRKSDNLEARDIQL
Sbjct: 421 RELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNLEARDIQL 480

Query: 481 HLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDXXXXXXXXXXXXXSLNTKK 539
           HLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSD             SLNTKK
Sbjct: 481 HLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNGNNVASLNTKK 539

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/526 (70%), Positives = 383/526 (72%), Gaps = 26/526 (4%)

Query: 1   MSSNPEXXXXXXXXXXXXXXXXXXXXXQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP 60
           MSSN E                     QQNMVLQPRQLQEM AKF  LLTEARNVGETTP
Sbjct: 1   MSSNTENTAGIGGNNTSTGNASAATAAQQNMVLQPRQLQEMTAKFTALLTEARNVGETTP 60

Query: 61  RGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXXXXXXXXXXXXIP----TENVPNSSX 116
           RGKELMFQAAKIKQVYDALTLN+RR                     P    TE   NSS 
Sbjct: 61  RGKELMFQAAKIKQVYDALTLNKRRQQAAQAYRNASMGNTNSNSNNPVTMSTEKTSNSSQ 120

Query: 117 XXXXXXXX--TRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNID 174
                     TRNNSNKFS+MIKQVLTPEENQEYEKLWQNFQ RHTSIKEKET+LKQNID
Sbjct: 121 QHQQQHQQQQTRNNSNKFSSMIKQVLTPEENQEYEKLWQNFQARHTSIKEKETFLKQNID 180

Query: 175 RLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPA 234
           RLEQEINKQT+EG KQQLQEKK ELLNDWKVLKIEYTKLFN+YQNSKKTFYVECARHNPA
Sbjct: 181 RLEQEINKQTEEGAKQQLQEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPA 240

Query: 235 LHKFLQESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKISSSNSTEIP 294
           LHKFLQEST                                          +S+NSTEI 
Sbjct: 241 LHKFLQESTQQQRVQQQRVQQQQHQGQTP--------------------TNTSTNSTEIS 280

Query: 295 SVTGPDALKSXXXXXNTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSKSAI 354
           S T  DA K      NT+  TN PRGN N  QTEQSKAKVTNVNATASM+NN+SSSKSAI
Sbjct: 281 STTALDASKPQQQQQNTLPGTNTPRGNGNAPQTEQSKAKVTNVNATASMMNNVSSSKSAI 340

Query: 355 FKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRV 414
           FKQTEPAIPISENIS K PAPVAYRSNRPTITGGSAMNASALNTPA TKLPPYEMDTQRV
Sbjct: 341 FKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQRV 400

Query: 415 MSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLE 474
           MSKRKLRELVKTVGIDEGDGETVI              FVTNVTAFSCRLAKHR+SDNLE
Sbjct: 401 MSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNLE 460

Query: 475 ARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSD 520
           ARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ+YNQKLQSITSD
Sbjct: 461 ARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQSITSD 506

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/529 (68%), Positives = 385/529 (72%), Gaps = 22/529 (4%)

Query: 1   MSSNPEXXXXXXXXXXXXXXXXXXXXXQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP 60
           MSSNPE                     QQN+ LQPRQLQEM AKFR LL EARNVGETTP
Sbjct: 1   MSSNPENIGSNANNNANSGNAGVAAAAQQNLTLQPRQLQEMTAKFRALLIEARNVGETTP 60

Query: 61  RGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXXXXXXX----XXXXXIPTENVPN-SS 115
           RGKELMFQAAKIKQVYDALTLN+RR                        +PT+  PN S 
Sbjct: 61  RGKELMFQAAKIKQVYDALTLNKRRQQAAQAYKNASMGNANPNPSNLASLPTDKAPNPSQ 120

Query: 116 XXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDR 175
                     RNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKE+E +LKQN+DR
Sbjct: 121 QQQQQQQQQARNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDR 180

Query: 176 LEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPAL 235
           LEQEINKQTDEG KQQL+EKK ELLNDWKVLKIEYTKLFN+YQNSKKTFYVECARHNPAL
Sbjct: 181 LEQEINKQTDEGTKQQLEEKKNELLNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPAL 240

Query: 236 HKFLQESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKISSSNSTEIPS 295
           HKFLQEST                                        K S++NSTE PS
Sbjct: 241 HKFLQESTQQQRVQQQRAQQQQQQQQLHIQGQNQV-------------KTSTTNSTETPS 287

Query: 296 VTGPDALKSXXXXX----NTITATNNPRGNVNTSQTEQSKAKVTNVNATASMLNNISSSK 351
               DA K+         N +  TN P+GN+N  QTEQSKAKVTNVNATASM++N+S++K
Sbjct: 288 TAALDASKAQEQQQQQHQNPLPVTNTPKGNINAPQTEQSKAKVTNVNATASMMSNVSANK 347

Query: 352 SAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDT 411
           SAIFKQTEPAIPISENISTK PAPVAYRSNRPT+TGGSAMNASALNTP TTKLPPYEMDT
Sbjct: 348 SAIFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNASALNTPVTTKLPPYEMDT 407

Query: 412 QRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSD 471
           QRVMSKRKLRELVKTVGIDEGDGETVI              FVTNVTAF+CRLAKHRKSD
Sbjct: 408 QRVMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDFVTNVTAFACRLAKHRKSD 467

Query: 472 NLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSD 520
           NLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ+YNQKLQ+ITSD
Sbjct: 468 NLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNITSD 516

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  464 bits (1193), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 249/504 (49%), Positives = 314/504 (62%), Gaps = 41/504 (8%)

Query: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXX 88
           Q +  Q RQL E+  KFR L+ EA++VGE TPRGKEL+ +A+KIK +YD    NR+R   
Sbjct: 18  QGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYD--NYNRQRQQA 75

Query: 89  XXXXXXXXXXXXXXXXXIPTEN------VPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTP 142
                              + +      V  +          +R++ ++ +N+IKQVLTP
Sbjct: 76  AQAFVQGRNGGTPGANPASSGSTGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTP 135

Query: 143 EENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLND 202
           E+NQ++E L QNFQ R  SI++K T+LKQ+I+RL QE++KQTD   K+QL+EKK EL N+
Sbjct: 136 EQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANN 195

Query: 203 WKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQESTXXXXXXXXXXXXXXXXXXX 262
            K+L +EY  L   +QN KK FYVECARHNPAL + LQ ST                   
Sbjct: 196 LKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRSTQQQRMAQQQQVQPSEG--- 252

Query: 263 XXXXXXXXXXXXXXXXXXXXXKISSSNSTEIPSVTGPDALKSXXXXXNTITATNNPRGNV 322
                                  S +     P   G  A K+       IT    P+ N 
Sbjct: 253 -----------------------SPAGEAGSPGAAGNSA-KAQQGTPANITTQKLPQQNQ 288

Query: 323 NTSQTEQS------KAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPV 376
             SQ+  S      +++VTNVNA ASM  N  ++KSAIFKQ++P +PISE ++ KTP+PV
Sbjct: 289 VRSQSTSSNTGSRAQSQVTNVNAAASMAYNNGANKSAIFKQSDPLVPISETVTAKTPSPV 348

Query: 377 AYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGET 436
            Y++NRPT+TGG+AMNA+ALNTP  TKLPPYE+DT+RVMSKRKLRELVKTVGIDEGDGET
Sbjct: 349 TYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGET 408

Query: 437 VIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSAD 496
           VI              FV+NVT F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSAD
Sbjct: 409 VIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSAD 468

Query: 497 EIRSTRKWNPSQNYNQKLQSITSD 520
           EIRSTRKWNP  +YNQK+Q+I SD
Sbjct: 469 EIRSTRKWNPKPSYNQKMQAINSD 492

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  439 bits (1130), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 239/485 (49%), Positives = 310/485 (63%), Gaps = 46/485 (9%)

Query: 36  RQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXX 95
           +QL E++A+F++L+ EA+ VGETTP GKEL+ QA+K+K +YD    N+++          
Sbjct: 26  KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYD--NYNKQKQEAMAQAQAR 83

Query: 96  XXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNF 155
                       +      +            +S +F+ +I+Q LTPE+NQ+Y+KL QNF
Sbjct: 84  NNNANTANVNSSSSANSTEANTSGRS-----GSSAQFATLIRQALTPEQNQQYDKLVQNF 138

Query: 156 QVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFN 215
           Q R  +IK+K T+LKQNIDRL QEI KQTD   K+QL EK+IEL+ + K + +EYT L  
Sbjct: 139 QTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTNLKAISVEYTNLQQ 198

Query: 216 NYQNSKKTFYVECARHNPALHKFLQESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 275
            Y N KK FY+ECA+ NP L + LQ+ST                                
Sbjct: 199 QYNNGKKAFYIECAKKNPDLQRLLQKSTQRVQQ--------------------------- 231

Query: 276 XXXXXXXXKISSSNSTEIPSVTGPDALKSXXXXXNTITATNNPRGNVNTSQTEQSKAKVT 335
                   + +S N+ + P V   +A            + ++   N+  S+  +S++++T
Sbjct: 232 --------QAASPNAQQQPPVK-TEAQPQPQPQQQATPSQSSSNANLAASKP-RSQSQIT 281

Query: 336 NVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASA 395
           NVNA AS  +  SS+KS IFKQ++PA+PISE+IS+KTP PV YR NRPTI+GGSAMNA+A
Sbjct: 282 NVNAAASNSS--SSNKSVIFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAA 339

Query: 396 LNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVT 455
           LNTP  TKLPPYE+DT+RVMSKRKLRELVKT+GIDEGDGETVI              FVT
Sbjct: 340 LNTPIMTKLPPYELDTERVMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVT 399

Query: 456 NVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQ 515
           NVT+F+C+LAKHRKSDNLE +DIQLHLERNWNIRIPGYSADEIRSTRKWNP+Q+YNQKLQ
Sbjct: 400 NVTSFACKLAKHRKSDNLETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQ 459

Query: 516 SITSD 520
           SI  D
Sbjct: 460 SINID 464

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  363 bits (931), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/497 (43%), Positives = 280/497 (56%), Gaps = 61/497 (12%)

Query: 33  LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXX 92
           L P  LQ+MA KF     EA+ VG  TP+G+EL+ QA++IK +YDA    R++       
Sbjct: 25  LTPESLQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAYR-QRQQSAQGFEQ 83

Query: 93  XXXXXXXXXXXXXIPT-ENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKL 151
                         PT    PN +             +N  S+ I+ +LTP++N+ Y +L
Sbjct: 84  GGATSNTGDNTAGTPTNARSPNGTP------------NNNMSSNIQNLLTPQQNEAYGRL 131

Query: 152 WQNFQVRHTSIKEKETYLKQNIDRLEQEINK-QTDEGPKQQLQEKKIELLNDWKVLKIEY 210
            Q        IK + TYLK+ I+ L+ EI K Q D    +QL+  K E+LN  +     Y
Sbjct: 132 IQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASY 191

Query: 211 TKLFNNYQNSKKTFYVECARHNPALHKFLQESTXXXXXXXXXXXXXXXXXXXXXXXXXXX 270
             L    +  KK FY+ECA  NP L +FLQ ST                           
Sbjct: 192 LALNQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANS-------------------- 231

Query: 271 XXXXXXXXXXXXXKISSSNSTEIPSVTGPDALKSXXXXXNTI------TAT-NNPRGNVN 323
                          +S N++ +P+ TG +   S              TAT + PR  VN
Sbjct: 232 --------------TASQNASPLPAATGANQASSPIQQTGAPSQVQQQTATPSQPRSGVN 277

Query: 324 TSQTEQSKAKVTNVNATASMLNN-ISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNR 382
           +    +S  +VT+VNA A + NN  S+++ AIFKQ  P++P+SE I+ + P PV +RSNR
Sbjct: 278 S----RSPTQVTSVNAAAHLANNATSAARQAIFKQPNPSVPVSETITQRMPTPVVHRSNR 333

Query: 383 PTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXX 442
           PTITGGSAMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+VGIDEGDGET I    
Sbjct: 334 PTITGGSAMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDV 393

Query: 443 XXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTR 502
                     F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTR
Sbjct: 394 EELLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTR 453

Query: 503 KWNPSQNYNQKLQSITS 519
           KWNP+ +YNQKLQ I S
Sbjct: 454 KWNPTTSYNQKLQGINS 470

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  348 bits (894), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/490 (41%), Positives = 271/490 (55%), Gaps = 51/490 (10%)

Query: 35  PRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXX 94
           P  +Q+MA KF     EA+ +G  TP+G+EL+ QA+ IK VYDA    ++          
Sbjct: 27  PESMQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAYRQRQQAAQGFDQNAP 86

Query: 95  XXXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQN 154
                        T   PN +             +N  S+ I+ +LTP++N+ Y +L Q+
Sbjct: 87  GASSAGSTSGSPATARAPNGTA------------TNTISSNIQNLLTPQQNEAYGRLIQS 134

Query: 155 FQVRHTSIKEKETYLKQNIDRLEQEINK-QTDEGPKQQLQEKKIELLNDWKVLKIEYTKL 213
                  IK + TYLK+ I+ L+ EI K + D    +QL+  K E+LN  K     Y  L
Sbjct: 135 SNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASYVAL 194

Query: 214 FNNYQNSKKTFYVECARHNPALHKFLQESTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 273
               +  KK FY+ECA  NP L +FLQ ST                              
Sbjct: 195 NQKLREDKKKFYIECAATNPNLKRFLQASTQQQRANSA---------------------- 232

Query: 274 XXXXXXXXXXKISSSNSTEIPSVTGPDALKSXXXXXNTITA---TNNPRGNVNTSQTEQS 330
                       +S N++ +P+ +  +   S       +      N   G   ++ + +S
Sbjct: 233 ------------TSQNASPLPTNSNGNQTSSPAQQQAAVQVPPPQNGTPGQTRSAASSRS 280

Query: 331 KAKVTNVNATASMLNN-ISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGS 389
             +VT+VNA A + NN  S+++ AIFKQ  P++P+SE I+ K P  +  RSNRPTITGGS
Sbjct: 281 PTQVTSVNAAAHLANNATSAARRAIFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGS 340

Query: 390 AMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXX 449
           AMNA+AL TP  TKLPPYE+D +RVMSKRKLRELVK+VGIDEGDGET I           
Sbjct: 341 AMNAAALTTPVMTKLPPYEVDNERVMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDL 400

Query: 450 XXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQN 509
              F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ +
Sbjct: 401 ADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTAS 460

Query: 510 YNQKLQSITS 519
           YNQKLQ I S
Sbjct: 461 YNQKLQGINS 470

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  337 bits (865), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 188/232 (81%), Gaps = 2/232 (0%)

Query: 310 NTITATNNPRGNVNTSQTEQSKAK--VTNVNATASMLNNISSSKSAIFKQTEPAIPISEN 367
           N I + N PR NV   QT+QSK K  VTNVNATASM++N SSSKSAIFKQTEPAIPISEN
Sbjct: 310 NVIPSANTPRANVKAPQTDQSKTKSQVTNVNATASMMSNASSSKSAIFKQTEPAIPISEN 369

Query: 368 ISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTV 427
           ISTK PAPV YRSNRPTITGGSAMNA+ALNTP TTKLPPYEMDTQRVMSKRKLRELVKTV
Sbjct: 370 ISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQRVMSKRKLRELVKTV 429

Query: 428 GIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWN 487
           GIDEGDGETVI              FVTNVTAF+CRLAKHRKSDNLEARDIQLHLERNWN
Sbjct: 430 GIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNLEARDIQLHLERNWN 489

Query: 488 IRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDXXXXXXXXXXXXXSLNTKK 539
           IRIPGYSADEIRSTRKWNPSQ+YNQKLQ+I SD             +LN KK
Sbjct: 490 IRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNNNSSVPNLNPKK 541

 Score =  275 bits (702), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 148/247 (59%), Positives = 165/247 (66%), Gaps = 8/247 (3%)

Query: 1   MSSNPEXXXXXXXXXXXXXXXXXXXXXQQNMVLQPRQLQEMAAKFRTLLTEARNVGETTP 60
           MSSNPE                     QQNM+LQ +QL EM  KF+ L++EARNVGETTP
Sbjct: 1   MSSNPENTGNNANNNANASNTGVAAAPQQNMMLQQKQLLEMTVKFKALVSEARNVGETTP 60

Query: 61  RGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXXXXXXXXXXX----XIPTENVPNSSX 116
           RGKELMFQAAKIK VYDA   NRRR                        +PTE  P  S 
Sbjct: 61  RGKELMFQAAKIKSVYDAF--NRRRQQAAQAYKNASVGNTTPNAGNPVSLPTEKPP--SL 116

Query: 117 XXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRL 176
                    R+NSNKFSNMIKQVLT EENQ+YEKLWQNFQVR TS+KEK+T+LKQNIDRL
Sbjct: 117 SQQQQQQQARSNSNKFSNMIKQVLTSEENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRL 176

Query: 177 EQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALH 236
            QE+NKQTDE  K+QL++KK ELLN+ KVL IEY  L   +QNSKKTFYVECARHNPAL 
Sbjct: 177 VQEVNKQTDEATKKQLEDKKNELLNNRKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQ 236

Query: 237 KFLQEST 243
           KFLQEST
Sbjct: 237 KFLQEST 243

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  297 bits (760), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 144/190 (75%), Positives = 166/190 (87%)

Query: 331 KAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSA 390
           K++VTNVNATASM NN +++KSAIFKQ++P +PISEN++ K P+PVAY+SNRPT+TGG+A
Sbjct: 346 KSQVTNVNATASMANNNAANKSAIFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAA 405

Query: 391 MNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXX 450
           MNAS LNTPA TKLPPYE+DT+RVMSKRKLRELVKTVGID+GDGETVI            
Sbjct: 406 MNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDGETVIDGDVEELLLDLA 465

Query: 451 XXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNY 510
             FVTNVT F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ+Y
Sbjct: 466 DDFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSY 525

Query: 511 NQKLQSITSD 520
           NQK+QSI +D
Sbjct: 526 NQKMQSINTD 535

 Score =  164 bits (416), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/221 (41%), Positives = 130/221 (58%), Gaps = 6/221 (2%)

Query: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQV---YDALTLNRRR 85
           Q  +LQ RQL E+  KF+ L+TE++NVGE T RGKEL+ QA+KIK V   Y        +
Sbjct: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQ 89

Query: 86  XXXXXXXXXXXXXXXXXXXXIPTENVP---NSSXXXXXXXXXTRNNSNKFSNMIKQVLTP 142
                                    VP    S+         +    ++ +N+IKQVLTP
Sbjct: 90  AYEQARNGAAAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTP 149

Query: 143 EENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLND 202
           E+NQ+Y+ L Q FQ R  +I++K  +L+Q+++ L QEINK+T+   K+QL++KK+ELL +
Sbjct: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209

Query: 203 WKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
            K L +EY+ L   + N KK FYVECARHNPAL + LQ+ST
Sbjct: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  290 bits (743), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 135/193 (69%), Positives = 160/193 (82%)

Query: 325 SQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPT 384
           S T  ++++VTNVNATAS  N    SKSAIFKQ++P++PISE+I+ K P  V+Y SNRP+
Sbjct: 368 SATSANRSQVTNVNATASSANKNIQSKSAIFKQSDPSVPISESITVKAPEAVSYISNRPS 427

Query: 385 ITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXX 444
           +TGG+AMNAS LNTP  TKLPPYE+DT+RVMSKRKLREL+K+VGIDEGDGETVI      
Sbjct: 428 LTGGTAMNASVLNTPTITKLPPYEIDTERVMSKRKLRELIKSVGIDEGDGETVIDGDVEE 487

Query: 445 XXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKW 504
                   FVTNVT+F+CRLAKHRKSD+LEARDIQLHLERNWNIRIPGYS DEIRSTRKW
Sbjct: 488 LLLDLADDFVTNVTSFACRLAKHRKSDSLEARDIQLHLERNWNIRIPGYSGDEIRSTRKW 547

Query: 505 NPSQNYNQKLQSI 517
            P+Q+Y+QK+QSI
Sbjct: 548 IPTQSYSQKMQSI 560

 Score =  161 bits (407), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 123/211 (58%), Gaps = 14/211 (6%)

Query: 44  KFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXX-----XXXXXXXXXXX 98
           KF+ L+ EA+ VG+ T RGKEL+ QA+ +K VYD    N++R                  
Sbjct: 33  KFKELVNEAKRVGQNTQRGKELLIQASNLKAVYD--NYNKQRQALINQQQQQQAGSSQTP 90

Query: 99  XXXXXXXIPTENVPNSSXXXXXXXXXTR-------NNSNKFSNMIKQVLTPEENQEYEKL 151
                      +    +         TR       +  ++ +++IKQVLTPEENQ+Y+KL
Sbjct: 91  AGTTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKL 150

Query: 152 WQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYT 211
            QNFQ R +SIK++ T+LKQ+IDRL QEIN+QTDE  K+QL+  + ELL + + L  EY+
Sbjct: 151 LQNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKKQLEVNRAELLTNLRTLNTEYS 210

Query: 212 KLFNNYQNSKKTFYVECARHNPALHKFLQES 242
            L+ + +N KK FYVECAR NP L + LQ+S
Sbjct: 211 NLYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  283 bits (725), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 137/190 (72%), Positives = 159/190 (83%)

Query: 331 KAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSA 390
           K++VTNVNA ASM ++ +SSK  IFKQ++P +P+S+ ISTK P  V YRSNRPT+TGGSA
Sbjct: 312 KSQVTNVNAAASMSDSSNSSKQTIFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSA 371

Query: 391 MNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXX 450
           M+ASALNTP  TKLPPYE+DT+RVMSKRKLRELVK++GIDEGDGETVI            
Sbjct: 372 MSASALNTPVMTKLPPYELDTERVMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMA 431

Query: 451 XXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNY 510
             F+TNVT+F+CRLAKHRKSDNLEARDIQLHLERNW+IRIPGYSADEIRS RKWNP+Q Y
Sbjct: 432 DDFITNVTSFACRLAKHRKSDNLEARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTY 491

Query: 511 NQKLQSITSD 520
           NQKLQ I +D
Sbjct: 492 NQKLQQINND 501

 Score =  164 bits (416), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 136/217 (62%), Gaps = 2/217 (0%)

Query: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXX 88
           +N++LQP Q++E+ AKF+ L+ EA+ VGE T RGKEL+ QA+K+K +YD     R++   
Sbjct: 17  RNIILQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQ 76

Query: 89  XXXXXXXXXXXXXXXXXIPTEN-VPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQE 147
                            + T N   + S         + ++S + +N+++QVLT E+N  
Sbjct: 77  QQQAVNNKVQNPSNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQNAN 136

Query: 148 YEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDE-GPKQQLQEKKIELLNDWKVL 206
           ++KL Q F+ R +++K+K T+LKQNI+RL QEINKQ D    ++QL+EK+ ELL + K +
Sbjct: 137 FDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRNLKAI 196

Query: 207 KIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
            +E+  L+  YQN KK FY+ECA+ NP L K LQ+ST
Sbjct: 197 TMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  273 bits (697), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 130/187 (69%), Positives = 148/187 (79%)

Query: 334 VTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNA 393
           VTNVNA AS  +   S+KS +FK  EP + IS+ ISTK P  V YRSNRP++TGGSAMNA
Sbjct: 419 VTNVNAAASASSVHPSNKSIMFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNA 478

Query: 394 SALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXF 453
           SAL TP  TKLPPYE+DT+RVMSKRKLRELVK++G+DEGDGETVI              F
Sbjct: 479 SALTTPVATKLPPYEIDTERVMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDF 538

Query: 454 VTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQK 513
           VTNVT+F+CRLAKHR SD+LE RDIQLHLE+NWNIRIPGYSADEIRS RKW+P QNYNQK
Sbjct: 539 VTNVTSFACRLAKHRNSDSLEPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQK 598

Query: 514 LQSITSD 520
           LQ I +D
Sbjct: 599 LQHINND 605

 Score =  138 bits (348), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 122/234 (52%), Gaps = 29/234 (12%)

Query: 31  MVLQPRQLQEMAAKFRTLLTEARNVG-ETTPRGKELMFQAAKIKQVYDAL-----TLNRR 84
           + LQP Q+ E++ KF+ L+ EA+ +G + + RGKEL+ QA+KIK +YD            
Sbjct: 34  ITLQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQAAAAA 93

Query: 85  RXXXXXXXXXXXXXXXXXXXXIPTENV---------------PNSSXXXXXXXXXTRN-- 127
                                +PT                  PNS          + N  
Sbjct: 94  AAAQARVQAQVQVQSSDVNKELPTSTANNNNIGATPSANTPTPNSIPISNSNTPSSLNAN 153

Query: 128 NSNKFS-----NMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINK 182
           N N+ S     +++KQVLTPE+NQEY+KL   FQ R  +IKEK +++KQNI+RL QE+NK
Sbjct: 154 NGNRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNK 213

Query: 183 -QTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPAL 235
              D   K QL+ KK EL N  + + +E+  L   +Q  +KTFYVECA++NPAL
Sbjct: 214 PNLDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPAL 267

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  269 bits (688), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 131/196 (66%), Positives = 157/196 (80%), Gaps = 1/196 (0%)

Query: 323 NTSQTEQSKAKVTNVNATASMLNNISSS-KSAIFKQTEPAIPISENISTKTPAPVAYRSN 381
           N++ T +S  +VT+VNA A + NN +++ + AIFKQ  P++P+SEN++ K P  VAYRSN
Sbjct: 296 NSTSTSRSPTQVTSVNAAALLANNNTAAARQAIFKQPNPSLPVSENVTPKNPTAVAYRSN 355

Query: 382 RPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXX 441
           RPTITGGSAMNA+ALNTP  TKLPPYE+D++RVMSKRKLRELVK+VG+DEGDGET I   
Sbjct: 356 RPTITGGSAMNAAALNTPVMTKLPPYEVDSERVMSKRKLRELVKSVGVDEGDGETTIDGD 415

Query: 442 XXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRST 501
                      F++NVT F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGYSADEIRST
Sbjct: 416 VEELLLDLADDFISNVTGFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYSADEIRST 475

Query: 502 RKWNPSQNYNQKLQSI 517
           RKWN + NY QKLQ I
Sbjct: 476 RKWNSTTNYTQKLQGI 491

 Score = 95.5 bits (236), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/207 (31%), Positives = 108/207 (52%), Gaps = 9/207 (4%)

Query: 38  LQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXXXX 97
           +Q++A +F  L  EA  +G  T  G+EL+ QAAKIK +YDA   N+++            
Sbjct: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAY--NKQKQQAAQAFGQTNN 87

Query: 98  XXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNFQV 157
                    P +   N+            N++N  S+ I+ +LTPE+++ Y KL + F  
Sbjct: 88  RPPAPAAGNPPQVAQNT------QQRQNSNSANNPSSNIRTLLTPEQSEAYNKLTKTFGD 141

Query: 158 RHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFNN 216
              +I+ +  YL++NI+ L+ EI N++++    ++L+  K EL+   + L   +  L   
Sbjct: 142 SAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASFQALPQK 201

Query: 217 YQNSKKTFYVECARHNPALHKFLQEST 243
           +  +KK FY+ECA  NP L +FLQ ST
Sbjct: 202 FHEAKKKFYIECAASNPNLKRFLQAST 228

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  265 bits (677), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 148/188 (78%), Gaps = 1/188 (0%)

Query: 332 AKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAM 391
           A+VT VNA A+  NN  +++  IFKQ  P+IPI ENI+  T   V+YRSNRPTIT GSAM
Sbjct: 337 AQVTPVNAAANQ-NNSGTARPVIFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAM 395

Query: 392 NASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXX 451
           NASAL  P  TKLPPYE+D++RVMSKRKLRELVKTVGID+GDGET +             
Sbjct: 396 NASALTMPVMTKLPPYEVDSERVMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLAD 455

Query: 452 XFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYN 511
            F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIRIPGY+ADEIRST+KWNP+  Y+
Sbjct: 456 DFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYS 515

Query: 512 QKLQSITS 519
           QKLQ I+S
Sbjct: 516 QKLQGISS 523

 Score =  101 bits (252), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 108/212 (50%), Gaps = 17/212 (8%)

Query: 33  LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXX 92
           L P  ++++A KFRTL++EA+ VG  TP G EL+ +A+ IK +Y+  T +R++       
Sbjct: 75  LTPSSMRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYE--TYHRQQAQQAFQV 132

Query: 93  XXXXXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLW 152
                              P             R  S+  SN IK +LTP++ + YEKL 
Sbjct: 133 RNPAPAGQLAAAGTGQATAP-------------RPTSSVASN-IKMLLTPQQREAYEKLT 178

Query: 153 QNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQEKKIELLNDWKVLKIEYT 211
           Q F     +I  +  +LK+NI+ L+ EI N+Q +    +QL+ KK ELL     L  ++ 
Sbjct: 179 QTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQFQ 238

Query: 212 KLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
            L   +Q  KK FY+ECA  N  L KFLQ ++
Sbjct: 239 ALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  265 bits (678), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 127/196 (64%), Positives = 148/196 (75%)

Query: 325 SQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPT 384
            QT   ++ VT VNA AS   + + +KS+IFK ++P +PI++ +S K P P+A+RSNRPT
Sbjct: 357 GQTASQQSPVTGVNAAASSAGSSTVTKSSIFKPSDPTVPIADTVSVKPPEPIAFRSNRPT 416

Query: 385 ITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXX 444
           I+ GSAMNA+ALNTP  T LPPYE+DT RVMSKRKLRELVK++GIDEGDGETVI      
Sbjct: 417 ISDGSAMNAAALNTPVMTTLPPYEIDTDRVMSKRKLRELVKSIGIDEGDGETVIDGDVEE 476

Query: 445 XXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKW 504
                   FVTNVT F+CRLAKHRKSDNLE  DIQLHLERNWNIRIPGYSADEIRS  KW
Sbjct: 477 LLLDLADDFVTNVTGFACRLAKHRKSDNLEPTDIQLHLERNWNIRIPGYSADEIRSVHKW 536

Query: 505 NPSQNYNQKLQSITSD 520
           N S  Y QKL SI +D
Sbjct: 537 NASPAYAQKLTSINAD 552

 Score =  187 bits (474), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 138/216 (63%), Gaps = 4/216 (1%)

Query: 32  VLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXX 91
            +Q +Q+QE+ A+F+ L+TEA+ VGETTPRGKEL+ QAAK+K VY+  T  ++       
Sbjct: 29  AIQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENYTRRQQALARAQQ 88

Query: 92  XXXXXX----XXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQE 147
                               T    NSS         + N+S + +N+IKQVLTPE+NQ+
Sbjct: 89  LQQQGSNTNAAASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLANIIKQVLTPEQNQQ 148

Query: 148 YEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLK 207
           YE+L QNFQVR ++IK+K T++KQNIDRL  EINKQTDE  K+QL EKK ELL + K ++
Sbjct: 149 YEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAIR 208

Query: 208 IEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
           +E+  L    QN KK FY+ECAR NPAL + LQ ST
Sbjct: 209 LEHQALQQELQNGKKNFYLECARQNPALQRLLQRST 244

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  262 bits (669), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 149/187 (79%)

Query: 334 VTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNA 393
           +TNVNA AS     + +KS IFKQ++P +PIS+N++ +    + Y+SNRP++TGG+AM+A
Sbjct: 334 ITNVNAAASANVKNNQAKSVIFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSA 393

Query: 394 SALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXF 453
           +ALN P  T LPPYE+DT+RVM+KRKLREL+K VGIDEGDGETVI              F
Sbjct: 394 AALNVPPLTTLPPYEIDTERVMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDF 453

Query: 454 VTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQK 513
           VTNVT+F+CRLAKHRKS+NLE+RDIQLHLERNWNIRIPGYS DEIRSTRKW P+Q ++QK
Sbjct: 454 VTNVTSFACRLAKHRKSENLESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQK 513

Query: 514 LQSITSD 520
           LQSI +D
Sbjct: 514 LQSINND 520

 Score =  108 bits (269), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 79/112 (70%), Gaps = 3/112 (2%)

Query: 131 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI---NKQTDEG 187
           + +N+IKQ+LT E+NQ+Y+ L +NF  + TSIK+K  +LKQNID+L QEI   +   D  
Sbjct: 147 QIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNNDVN 206

Query: 188 PKQQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFL 239
            K+ L+ K+ EL+ + K L +E++K+   ++N KKTFYVECA+ NPAL K L
Sbjct: 207 VKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 38/53 (71%)

Query: 28 QQNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALT 80
          Q  + LQ +QL E+  KF+ L+ EA+ VGE TPRGKEL+ QA+K+K +Y+  T
Sbjct: 20 QAKLALQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFT 72

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  258 bits (658), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 124/195 (63%), Positives = 149/195 (76%), Gaps = 1/195 (0%)

Query: 325 SQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPT 384
           S   +S  +VT VNA A+  N+  +++  IFKQ  P+IPI E++S  +   V+YRSNRPT
Sbjct: 301 SGISRSPTQVTPVNAAANQ-NSNGAARPVIFKQPNPSIPIPESVSPISTTSVSYRSNRPT 359

Query: 385 ITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXX 444
           ITGGSAMNA+AL TP  TKLPPYE+D++RVMSKRKLRELVK+VGID+GDGET I      
Sbjct: 360 ITGGSAMNAAALTTPVMTKLPPYEVDSERVMSKRKLRELVKSVGIDDGDGETTIDGDVEE 419

Query: 445 XXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKW 504
                   F+TNVT+F+CRLAKHRKSDNL+ RDIQLHLERNWNIR PGYSADEIRST+KW
Sbjct: 420 LLLDLADDFITNVTSFACRLAKHRKSDNLDVRDIQLHLERNWNIRTPGYSADEIRSTKKW 479

Query: 505 NPSQNYNQKLQSITS 519
           N +  Y QK+Q ITS
Sbjct: 480 NSTPAYGQKMQVITS 494

 Score = 77.0 bits (188), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 65/109 (59%), Gaps = 1/109 (0%)

Query: 136 IKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQE 194
           IK +L P++ + YE+L Q F     +IK +  +LK+NI+ L+ EI N+Q++    +QL+ 
Sbjct: 133 IKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVRQLES 192

Query: 195 KKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
           KK ELL     L  ++  L   +Q  KK FY+ECA  N  L KFLQ ++
Sbjct: 193 KKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATS 241

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 32/45 (71%)

Query: 33 LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYD 77
          L P  LQ++A KF TL+ EA+ VG  TP G EL+ +A+K+K +Y+
Sbjct: 15 LTPPSLQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYE 59

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  252 bits (643), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 120/194 (61%), Positives = 146/194 (75%), Gaps = 1/194 (0%)

Query: 324 TSQTEQSKAKVTNVNATASMLNNISSSKSAIFKQTEPAIPISENISTKTPAPVAYRSNRP 383
           T+  + S  +VT VNA A+     S+++  IFKQ  P+IPISEN++      V+YRSNRP
Sbjct: 306 TASDKSSPMQVTTVNAAANQTAQ-SNTRPPIFKQPNPSIPISENVTASPTVSVSYRSNRP 364

Query: 384 TITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXX 443
           TITGGS MNA AL TP  TKLPPYE+DT+RVMSKRKLRELVKTVGIDEGDGET I     
Sbjct: 365 TITGGSGMNAPALTTPVMTKLPPYEVDTERVMSKRKLRELVKTVGIDEGDGETTIDGDVE 424

Query: 444 XXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRK 503
                    F+TNVT F+C+LAKHRKSD+L+ RDIQ+HLERNWNIRIPG++ DEIRST+K
Sbjct: 425 ELLLDLADDFITNVTNFACKLAKHRKSDSLDVRDIQMHLERNWNIRIPGFANDEIRSTKK 484

Query: 504 WNPSQNYNQKLQSI 517
           WNP+ +YNQ + +I
Sbjct: 485 WNPTPSYNQMVNAI 498

 Score =  100 bits (250), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 110/208 (52%), Gaps = 4/208 (1%)

Query: 33  LQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXX 92
           L P  +Q++A + ++L+ EA+ +G  T  GKEL+ QAA+IK +Y+A +  ++R       
Sbjct: 13  LTPASMQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYS--KQRQQQAQAQ 70

Query: 93  XXXXXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLW 152
                        + + +              T  +SN  +N IK +LTP++ + Y +L 
Sbjct: 71  AGAQGAVNNNATNVKSMDQQQQQQQQQQQQQATA-SSNNVTNNIKVLLTPQQREAYNRLV 129

Query: 153 QNFQVRHTSIKEKETYLKQNIDRLEQEI-NKQTDEGPKQQLQEKKIELLNDWKVLKIEYT 211
           Q ++    +IK +  +LK+NI  L+QEI N++ +    QQL+  + ELL   + L  +Y+
Sbjct: 130 QKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQYS 189

Query: 212 KLFNNYQNSKKTFYVECARHNPALHKFL 239
            L   YQ  ++ FY+EC++ N  L ++L
Sbjct: 190 TLQQKYQEDRRKFYIECSQTNADLRRYL 217

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  247 bits (630), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 111/171 (64%), Positives = 133/171 (77%)

Query: 350 SKSAIFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEM 409
           +K  IFK++EP++PI E+I T  PA VAY+ NRPTITGGS MNA ALNTP   K+P YE 
Sbjct: 319 AKHKIFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEA 378

Query: 410 DTQRVMSKRKLRELVKTVGIDEGDGETVIXXXXXXXXXXXXXXFVTNVTAFSCRLAKHRK 469
           DT RV+SKRKLRELV+TVG+DEGDGETV+              FV++VTAF+CRLAKHR 
Sbjct: 379 DTDRVLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRG 438

Query: 470 SDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSD 520
           SD+LEARD+QLHLERNWNIR+PGY+ DEIRSTRKWN +  Y+QKL +I  D
Sbjct: 439 SDSLEARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQD 489

 Score =  144 bits (364), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 115/207 (55%), Gaps = 9/207 (4%)

Query: 36  RQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXXXXX 95
           +QL E+A +F+  + EA+ VGETT  GK+L+ +AAKIK VYD++                
Sbjct: 28  QQLVELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSVRGASAGAAAQSQQRTA 87

Query: 96  XXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLWQNF 155
                       T NV  +              + + +  ++Q LTPE+ Q+Y+K+  NF
Sbjct: 88  DGA---------TGNVATAPAAAGGGGGAGNTAATQLAMAMRQALTPEQVQQYDKIATNF 138

Query: 156 QVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTKLFN 215
           Q +  SI++K  YLKQNID+L  EINKQ D   KQQL EK+ ELL   + L +E+  L  
Sbjct: 139 QNKAKSIRDKHNYLKQNIDKLTAEINKQQDRSAKQQLAEKRNELLRSVRQLTVEHNSLKV 198

Query: 216 NYQNSKKTFYVECARHNPALHKFLQES 242
           N+Q S+K FYVECA+ NP L + LQ +
Sbjct: 199 NFQLSRKNFYVECAKLNPKLQQILQRT 225

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  251 bits (642), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 149/198 (75%), Gaps = 11/198 (5%)

Query: 325 SQTEQSKAKVTNVNATASMLNNISSSKSA-----IFKQTEPAIPISENISTKTPAPVAYR 379
           SQ  Q  A +TNVNA AS     +SSKS      IFKQTEP +PISE+++TK P  + YR
Sbjct: 538 SQNRQQSA-ITNVNAAAS-----TSSKSLTKTMNIFKQTEPLLPISEHLTTKIPEAIPYR 591

Query: 380 SNRPTITGGSAMNASALNTPATTKLPPYEMDTQRVMSKRKLRELVKTVGIDEGDGETVIX 439
           +NRPT+TGG+AMN S LNTP  TKLPPYE+DTQRVM KRKL+E+V++VG+D+GDGETVI 
Sbjct: 592 NNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQRVMLKRKLKEVVRSVGVDDGDGETVIG 651

Query: 440 XXXXXXXXXXXXXFVTNVTAFSCRLAKHRKSDNLEARDIQLHLERNWNIRIPGYSADEIR 499
                        FVT+VT F+C++AKHRKSD+L+  DIQLHLE+NWNIRIP YS D IR
Sbjct: 652 GDVEEALLDLADNFVTSVTTFACKIAKHRKSDSLDVGDIQLHLEKNWNIRIPSYSMDVIR 711

Query: 500 STRKWNPSQNYNQKLQSI 517
           S+RKWNP+ +YNQKL S+
Sbjct: 712 SSRKWNPTASYNQKLNSL 729

 Score =  115 bits (289), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 52/114 (45%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 131 KFSNMIKQVLTPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEG-PK 189
           + +N IKQ+LTPE+N++Y++L  NFQ+R T+IKEK  +LKQ+I R   E+NK       +
Sbjct: 229 QLANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDR 288

Query: 190 QQLQEKKIELLNDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243
            +L++KK+EL+++ K + I+YT L+  +QN KK+FY+ CAR NP L + LQ+++
Sbjct: 289 VKLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 41/57 (71%)

Query: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRR 85
           Q+ +LQ +QL E+ AKF+ L+ EA+ VGE T RGKEL+ QA KIKQ+YD     R++
Sbjct: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNFNKQRQQ 108

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  129 bits (324), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 57/112 (50%), Positives = 80/112 (71%), Gaps = 1/112 (0%)

Query: 407 YEMDTQRVMSKRKLRELVKTVGIDEGDGETV-IXXXXXXXXXXXXXXFVTNVTAFSCRLA 465
           YE++++RV+SKRKLRELV++V IDE D + + I              FV+N+T+FSCRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 466 KHRKSDNLEARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSI 517
           +HR S+ +  RDIQLH+ERNWNIR+PG++ADEI+S +KW  S  Y   L S+
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSV 385

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/210 (33%), Positives = 113/210 (53%), Gaps = 6/210 (2%)

Query: 34  QPRQLQEMAAKFRTLLTEAR-NVGETTPRGKELMFQAAKIKQVYDALTLNRRRXXXXXXX 92
           Q +QL E+A  F+ L+ +A+ N G+TT +GKEL+ +A K+K+++  L+   +        
Sbjct: 11  QQKQLNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLS--NKYKNDSSSN 68

Query: 93  XXXXXXXXXXXXXIPTENVPNSSXXXXXXXXXTRNNSNKFSNMIKQVLTPEENQEYEKLW 152
                              P++S          R+NSN  S MIK  LTPE+N+ YE L 
Sbjct: 69  DSTLSRSNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSN-LSMMIKNALTPEQNESYETLL 127

Query: 153 QNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELLNDWKVLKIEYTK 212
           ++FQ+R   IK + + +K+ ID + + +N +T+   ++ L  K+ E L   K L  +YT+
Sbjct: 128 KDFQIRAAKIKREHSDVKEKIDNISKLLNSKTN--NQEALTAKRNEYLFQLKKLSKDYTE 185

Query: 213 LFNNYQNSKKTFYVECARHNPALHKFLQES 242
           L   +QN KK FY++ A+ N  L K LQES
Sbjct: 186 LHQQFQNEKKNFYLKSAKQNSELQKVLQES 215

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 45/84 (53%), Gaps = 5/84 (5%)

Query: 356 KQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMN--ASALNTPATTKLP-PYEMDTQ 412
           +QT  A+PIS+N+    P P   R NR  +    ++N  A  + +   ++LP P E    
Sbjct: 329 EQTTEAVPISKNVEIYEPQPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANN 388

Query: 413 RVMSKRKLRELVKTVGIDEGDGET 436
             ++++K +E++K+ G  E + ET
Sbjct: 389 --ITRKKDKEVIKSQGKGEINIET 410

>Kpol_1025.11 s1025 complement(31479..34081,34759..34783) [2628 bp,
           875 aa] {ON} complement(31479..34081,34759..34783) [2628
           nt, 876 aa]
          Length = 875

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 4/88 (4%)

Query: 146 QEYEKLWQNFQVRHTSIKEKETYLKQNIDRLE-QEINKQTDEGPKQQLQEKKIELLNDW- 203
           Q Y+  + +F+V  + +K+ + Y KQ  D L   E+ ++  +   +  +EKKIE L    
Sbjct: 573 QYYQSFFNDFKVEPSDVKKHDLYFKQ--DSLPFAELTRRLIDFMHKNGEEKKIEELESIV 630

Query: 204 KVLKIEYTKLFNNYQNSKKTFYVECARH 231
           +  K  Y  +F N+     T  V+C  H
Sbjct: 631 EEFKENYGTMFTNFDKFIVTIIVQCLAH 658

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.123    0.338 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,609,521
Number of extensions: 1686037
Number of successful extensions: 9877
Number of sequences better than 10.0: 231
Number of HSP's gapped: 10381
Number of HSP's successfully gapped: 289
Length of query: 539
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 425
Effective length of database: 40,409,475
Effective search space: 17174026875
Effective search space used: 17174026875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)