Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR126W (SWF1)8.286ON33633615160.0
Suva_2.2898.286ON33533612831e-178
Smik_4.3728.286ON33533612551e-174
Skud_4.3878.286ON33633612441e-172
Kpol_1033.168.286ON3213167273e-94
NDAI0J010008.286ON3393207293e-94
TDEL0F041308.286ON3283197128e-92
NCAS0B035908.286ON3293177092e-91
KAFR0B053708.286ON3293167065e-91
ZYRO0D06600g8.286ON3303177066e-91
TBLA0D040408.286ON3293196996e-90
TPHA0C010708.286ON3333226962e-89
CAGL0B01991g8.286ON3303216153e-77
KNAG0H031108.286ON3313155683e-70
Ecym_42828.286ON3403195451e-66
AGR065W8.286ON3263195371e-65
Kwal_56.236978.286ON3383275345e-65
SAKL0H16434g8.286ON5552625488e-65
KLTH0G13112g8.286ON3493325331e-64
KLLA0F19690g8.286ON3243175283e-64
TBLA0H009208.389ON3601662212e-19
TPHA0C023608.389ON4041312133e-18
Suva_10.3428.389ON356542114e-18
Skud_12.3218.389ON3561132071e-17
ZYRO0C04092g8.389ON3661272062e-17
Smik_12.3068.389ON359952062e-17
YLR246W (ERF2)8.389ON359952053e-17
NDAI0G022508.389ON389892035e-17
KLLA0D18370g8.389ON3551712009e-17
AGL125C8.389ON3671221973e-16
NCAS0C029208.389ON3741821973e-16
TDEL0F051308.389ON359841955e-16
Kwal_23.33028.389ON3531251939e-16
KAFR0H019808.389ON361541921e-15
Ecym_41788.389ON3681341912e-15
SAKL0H13860g8.389ON3521231902e-15
CAGL0G08217g8.389ON326541822e-14
KLTH0F08668g8.389ON358501805e-14
KLLA0C06204g6.28ON377621752e-13
Kwal_56.224596.28ON3831441743e-13
KNAG0F029306.28ON386671717e-13
KNAG0A027108.389ON354501663e-12
KAFR0A051306.28ON396911654e-12
Smik_15.1676.28ON378481629e-12
Kwal_55.221263.12ON3601381621e-11
NCAS0E013003.12ON3271421611e-11
TPHA0P015603.12ON331511611e-11
NDAI0G013403.12ON3351421601e-11
ZYRO0C07546g6.28ON377751583e-11
TDEL0G044106.28ON381621583e-11
YOL003C (PFA4)6.28ON378481574e-11
NCAS0D021406.28ON376621566e-11
CAGL0E02497g6.28ON376501557e-11
Ecym_20143.12ON3391171549e-11
TDEL0A003103.12ON3291201531e-10
Kpol_1014.293.12ON3261561531e-10
Skud_15.1596.28ON379481541e-10
TPHA0J003906.28ON380491541e-10
Suva_15.1726.28ON398591541e-10
SAKL0C13596g3.12ON3331211531e-10
NDAI0C026506.28ON389621541e-10
KNAG0K025703.12ON3281341512e-10
KLLA0E02069g3.12ON3251251502e-10
KLTH0F19580g3.12ON3421251503e-10
TBLA0H001503.12ON345511494e-10
Ecym_30326.28ON3771421504e-10
SAKL0E01518g6.28ON379481486e-10
Kpol_1037.236.28ON378571477e-10
KLTH0C10978g6.28ON377621479e-10
Smik_14.63.12ON334641442e-09
ADL197C3.12ON3901331415e-09
KAFR0A085903.12ON331481405e-09
Suva_14.153.12ON330641389e-09
ACL003C6.28ON375371372e-08
ZYRO0C03410g3.12ON3271431352e-08
KAFR0I011105.579ON370481344e-08
Skud_14.153.12ON3361381334e-08
YNL326C (PFA3)3.12ON336641335e-08
CAGL0D02508g3.12ON332491318e-08
TBLA0B004806.28ON377391246e-07
TBLA0E028305.579ON386481184e-06
Kwal_47.183665.579ON3561431174e-06
Kpol_1004.575.579ON362511175e-06
KNAG0C028305.579ON354491157e-06
KLTH0G04972g5.579ON3671041122e-05
SAKL0G06160g5.579ON3641051112e-05
Smik_4.7375.579ON378491095e-05
Ecym_41145.579ON3721071087e-05
Suva_2.6345.579ON388501042e-04
YDR459C (PFA5)5.579ON374491042e-04
Skud_4.7345.579ON380501032e-04
CAGL0K06347g5.579ON352481033e-04
NCAS0F013905.579ON374641015e-04
Smik_4.5155.626ON764551016e-04
ABR203W5.579ON35949997e-04
TDEL0A044405.579ON36551980.001
KLLA0D06149g5.579ON34949980.001
NDAI0H018905.579ON40669930.004
YDR264C (AKR1)5.626ON76462930.005
CAGL0M08712g5.626ON763179930.006
KAFR0H005705.626ON75750910.009
Skud_4.5275.626ON76455910.010
Kpol_526.325.626ON77765880.021
ZYRO0C11132g5.626ON75965880.023
Suva_2.4325.626ON76358870.033
ZYRO0D13860g5.579ON36569840.051
SAKL0G07326g5.626ON73762850.059
KLTH0E02420g5.626ON73443830.081
YOR034C (AKR2)5.626ON74956830.10
TPHA0C003705.626ON75943830.10
KNAG0C062305.626ON75292820.11
KNAG0B031405.626ON682168820.13
NDAI0H008505.626ON78642820.14
TDEL0A049205.626ON75048810.14
TBLA0J008305.626ON739139800.18
Suva_8.875.626ON73056790.29
Smik_15.2135.626ON74456780.39
Ecym_13305.626ON73954760.61
NCAS0C052805.626ON75749741.1
KLLA0E16721g5.626ON75241703.1
KAFR0C059605.626ON727128703.8
SAKL0C05918g1.199ON87542703.9
Kpol_495.28.157ON151171694.7
AER388C5.626ON72439685.4
Skud_15.1995.626ON74156669.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR126W
         (336 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   588   0.0  
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   498   e-178
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   488   e-174
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   483   e-172
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   284   3e-94
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   285   3e-94
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   278   8e-92
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     277   2e-91
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   276   5e-91
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   276   6e-91
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   273   6e-90
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   272   2e-89
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   241   3e-77
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   223   3e-70
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   214   1e-66
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   211   1e-65
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   210   5e-65
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   215   8e-65
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   209   1e-64
KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   207   3e-64
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    90   2e-19
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    87   3e-18
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    86   4e-18
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    84   1e-17
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    84   2e-17
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    84   2e-17
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    84   3e-17
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     83   5e-17
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    82   9e-17
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    80   3e-16
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     80   3e-16
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    80   5e-16
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    79   9e-16
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    79   1e-15
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    78   2e-15
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    78   2e-15
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    75   2e-14
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    74   5e-14
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    72   2e-13
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    72   3e-13
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    70   7e-13
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    69   3e-12
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    68   4e-12
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    67   9e-12
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    67   1e-11
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    67   1e-11
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    67   1e-11
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      66   1e-11
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    65   3e-11
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    65   3e-11
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    65   4e-11
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    65   6e-11
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    64   7e-11
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    64   9e-11
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    64   1e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    64   1e-10
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    64   1e-10
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    64   1e-10
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    64   1e-10
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    64   1e-10
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      64   1e-10
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    63   2e-10
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    62   2e-10
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    62   3e-10
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    62   4e-10
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    62   4e-10
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    62   6e-10
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    61   7e-10
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    61   9e-10
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    60   2e-09
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    59   5e-09
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    59   5e-09
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    58   9e-09
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    57   2e-08
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    57   2e-08
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    56   4e-08
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    56   4e-08
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    56   5e-08
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    55   8e-08
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    52   6e-07
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    50   4e-06
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    50   4e-06
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    50   5e-06
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    49   7e-06
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    48   2e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    47   2e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    47   5e-05
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    46   7e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    45   2e-04
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    45   2e-04
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    44   2e-04
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    44   3e-04
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    44   5e-04
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    44   6e-04
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    43   7e-04
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    42   0.001
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    42   0.001
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    40   0.004
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    40   0.005
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    40   0.006
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    40   0.009
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    40   0.010
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    39   0.021
ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {...    39   0.023
Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON...    38   0.033
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    37   0.051
SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {...    37   0.059
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    37   0.081
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    37   0.10 
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    37   0.10 
KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa] ...    36   0.11 
KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.6...    36   0.13 
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    36   0.14 
TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {O...    36   0.14 
TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {...    35   0.18 
Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}...    35   0.29 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    35   0.39 
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    34   0.61 
NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa] ...    33   1.1  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    32   3.1  
KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa] ...    32   3.8  
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    32   3.9  
Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 151...    31   4.7  
AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}...    31   5.4  
Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {...    30   9.7  

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/336 (85%), Positives = 288/336 (85%)

Query: 1   MSWNXXXXXXXXXXXXXXXSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60
           MSWN               SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS
Sbjct: 1   MSWNLLFVLLIGFVVLILLSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60

Query: 61  IYLYLVYTYHMRVESTIKNELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGST 120
           IYLYLVYTYHMRVESTIKNELF                     AMVSRAEDSKDHKSGST
Sbjct: 61  IYLYLVYTYHMRVESTIKNELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGST 120

Query: 121 XXXXXXXXXXXXAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180
                       AIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY
Sbjct: 121 EEYPYDYLLYYPAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180

Query: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG
Sbjct: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300
           MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300

Query: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336
           DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI
Sbjct: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 245/336 (72%), Positives = 257/336 (76%), Gaps = 1/336 (0%)

Query: 1   MSWNXXXXXXXXXXXXXXXSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60
           MSWN               SPVFKSTWPFSTFYR VFQPF+ DD KYRWK HLVPLFYTS
Sbjct: 1   MSWNALVVPLVGIVLLVLLSPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTS 60

Query: 61  IYLYLVYTYHMRVESTIKNELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGST 120
           IYLYLV+TYH RVE  IKNELF                     AMV++AEDS +HK GST
Sbjct: 61  IYLYLVFTYHTRVEPLIKNELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGST 120

Query: 121 XXXXXXXXXXXXAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180
                        +KCSTCR +K ARSKHCSICNRCVLVADHHCIW+NNCIGKGNYLQFY
Sbjct: 121 EKYPYDYLLYYPGVKCSTCRTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFY 180

Query: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFL SNIFSM YAFLRL++IS NST+ LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG
Sbjct: 181 LFLFSNIFSMSYAFLRLYFISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300
           MTTNEQDKWYTIQEYMREGKLVRSLDDD  SWF K TE K D  +PLQDQHVTFYSTNAY
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDSRSWFLKFTE-KGDTGQPLQDQHVTFYSTNAY 299

Query: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336
           DH  Y L HY TIKDASEI NIYDKGTFLANL DLI
Sbjct: 300 DHHRYRLKHYTTIKDASEITNIYDKGTFLANLVDLI 335

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  488 bits (1255), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 239/336 (71%), Positives = 256/336 (76%), Gaps = 2/336 (0%)

Query: 1   MSWNXXXXXXXXXXXXXXXSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60
           MSWN               SPVFKSTWPFSTFYRNVFQPF+ DDQKYRWK HLVP+FYT 
Sbjct: 1   MSWNVLFVLLVGVVVLILLSPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTL 60

Query: 61  IYLYLVYTYHMRVESTIKNELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGST 120
           IYLYLVYTYH RVE  +++ELF                      MV++AEDS  HK GST
Sbjct: 61  IYLYLVYTYHTRVEWLVRSELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGST 120

Query: 121 XXXXXXXXXXXXAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180
                        +KCSTC I+KPARSKHCSICNRC+LVADHHCIW+NNCIGKGNYLQFY
Sbjct: 121 EKYPYDYLLYYPVVKCSTCHIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFY 180

Query: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFLISNIFS+ YAFLRLW ISLNS + LPRAVLTLTILCGCFTIIC IFTYLQL IV+EG
Sbjct: 181 LFLISNIFSLLYAFLRLWCISLNSKTALPRAVLTLTILCGCFTIICIIFTYLQLTIVREG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300
           MTTNEQDKWYTIQEYMREGKLVRSL+D+C SWF K TE  DD  +  QDQH TFYSTNAY
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLNDNCQSWFLKLTE--DDTTKLTQDQHATFYSTNAY 298

Query: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336
           DHK YNL HYITIKDASEI NIYDKGTFLAN TDLI
Sbjct: 299 DHKQYNLAHYITIKDASEISNIYDKGTFLANFTDLI 334

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/336 (70%), Positives = 256/336 (76%), Gaps = 1/336 (0%)

Query: 1   MSWNXXXXXXXXXXXXXXXSPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTS 60
           M WN               SPVFKSTWPFST YR VFQPF+ DDQKYRWK HLVPLFYTS
Sbjct: 1   MLWNVLFVLLVSIVVLILFSPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTS 60

Query: 61  IYLYLVYTYHMRVESTIKNELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGST 120
           IYLYLVYTYH +VE  IKN+LF                     AMV++AEDS  H+ GST
Sbjct: 61  IYLYLVYTYHAKVEPLIKNDLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGST 120

Query: 121 XXXXXXXXXXXXAIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFY 180
                        ++CSTCRI KPARS+HCSICNRC+LVADHHCIW+NNCIGKGNY+QFY
Sbjct: 121 EKYPYDYLIYYPDVQCSTCRITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFY 180

Query: 181 LFLISNIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEG 240
           LFLISNI SM YAFLRL  ISL S++ LPRAVLTL+ILCGCFTIICAIFTYLQLAIV+EG
Sbjct: 181 LFLISNIVSMSYAFLRLCSISLKSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVREG 240

Query: 241 MTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAY 300
           MTTNEQDKWYTIQEYMREGKLVRSL+DD  SWF K TE K DAAEPLQDQ  TFYSTNAY
Sbjct: 241 MTTNEQDKWYTIQEYMREGKLVRSLNDDPQSWFLKLTE-KGDAAEPLQDQQGTFYSTNAY 299

Query: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336
           DHK Y L HYITIKDASEI N+YDKGTFLAN TDLI
Sbjct: 300 DHKRYILMHYITIKDASEITNVYDKGTFLANFTDLI 335

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  284 bits (727), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 186/316 (58%), Gaps = 16/316 (5%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP+FK TWP S +Y   ++PF +D ++YRWK +LVP  Y  +YL+++  YH+RV   +  
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L+                      M+++ E+S +H   S              + C TC
Sbjct: 79  HLYWFEKGLILPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKTC 138

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           R  KPARSKHCSIC++C+L+ DHHCIW+NNCIG GNY  FYLF+  N  +M Y F RL +
Sbjct: 139 RKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLLF 198

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           IS+    T  RA+LT+ ILCG F IIC++FTYLQL +V +G+TTNE DKWYTI EY R+G
Sbjct: 199 ISIKYKVTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYCRDG 258

Query: 260 KLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEI 319
           KL RS   +   WF             L D + TFYSTN YDH  Y+ T Y  I D ++I
Sbjct: 259 KLARSKSGN---WF-------------LIDSNNTFYSTNIYDHTRYSPTQYTIINDPTDI 302

Query: 320 PNIYDKGTFLANLTDL 335
            NIYDKG+   N  D+
Sbjct: 303 QNIYDKGSCWLNFIDI 318

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  285 bits (729), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 198/320 (61%), Gaps = 9/320 (2%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP +K+  PFS +YR+VFQP + D  +YRWK HLVP FY ++++YL Y Y+ +VE  I +
Sbjct: 21  SPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPLIAS 80

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVS--RAEDSKDHKSGSTXXXXXXXXXXXXAIKCS 137
           +L+                      MV+     +++ ++                 I+C 
Sbjct: 81  QLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPNIECR 140

Query: 138 TCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRL 197
           TC IVKPARSKHC ICN C+L+ DHHC+W+NNCIG+GNYL FY FL+ N  +M Y+F+RL
Sbjct: 141 TCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFIRL 200

Query: 198 WYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMR 257
           + +     +   R +LTL ILCG F +ICA FT+LQL +VK+GMTTNEQDKW+T+QEYMR
Sbjct: 201 FLMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTLQEYMR 260

Query: 258 EGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLT--HYITIKD 315
           +GKL+R+ D++   WF       DDA   +    + FYSTNAYDH+ Y+L+   Y  ++D
Sbjct: 261 DGKLIRTKDEN--KWFI--ANPNDDATITINADTI-FYSTNAYDHEGYHLSSDEYTIVED 315

Query: 316 ASEIPNIYDKGTFLANLTDL 335
             +I N+YD G F  NL D 
Sbjct: 316 PRQITNLYDSGDFFTNLKDF 335

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  278 bits (712), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 139/319 (43%), Positives = 187/319 (58%), Gaps = 17/319 (5%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP +K  WPFS +Y  +F+P L +DQ++RWK ++VP FY S+Y Y+++     V   I N
Sbjct: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L                      +M  +A+ S+  + GS              ++C TC
Sbjct: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
            I KPARS+HC++C  CVLVADHHC+W+NNCIGKGNY  FY FL+ N+ S+ Y FLR+ +
Sbjct: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201

Query: 200 ISLNSTSTL---PRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256
           IS+    ++   PR++L  TILCG F IIC +FTYLQL +V +GMTT E+DKWYTIQ+ M
Sbjct: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261

Query: 257 REGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDA 316
           REG LVR+LD      FF   +Q  +           FYSTNAYD K Y   +Y  + D 
Sbjct: 262 REGNLVRTLDGQ----FFIQDQQNPNQ----------FYSTNAYDSKLYVPQNYSIVNDP 307

Query: 317 SEIPNIYDKGTFLANLTDL 335
            +I NIYD+G+F   L  L
Sbjct: 308 KDITNIYDQGSFWYKLERL 326

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  277 bits (709), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 197/317 (62%), Gaps = 10/317 (3%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP ++  WPFS +Y+ VF P + D++K++ K +++P+FY  +YLYL+Y Y+ +V   I N
Sbjct: 20  SPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIYCYYSKVAPFINN 79

Query: 80  ELFXXXXXX-XXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCST 138
           +L+                       M ++   +K +                  I C T
Sbjct: 80  QLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILCRT 139

Query: 139 CRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLW 198
           C+  KPARSKHCSIC+RCVLVADHHCIW+NNC+GKGNY  FY+FLI+N FS+ YAF+RL 
Sbjct: 140 CQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLL 199

Query: 199 YISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMRE 258
            I   +   LP+  LTLTILCGCF++IC IFT+LQL + +EGMTTNE+DKW+T+ E+MR+
Sbjct: 200 TIFYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEKDKWFTVHEFMRD 259

Query: 259 GKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASE 318
           GKLVR+       W+F      D + + +      FYSTN YDH  Y L ++  I+D S 
Sbjct: 260 GKLVRT---QSGRWYFADPHDSDISEDSV------FYSTNGYDHTEYTLRNFEIIEDPSR 310

Query: 319 IPNIYDKGTFLANLTDL 335
           I NIYD+G FLANL DL
Sbjct: 311 ITNIYDRGDFLANLRDL 327

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  276 bits (706), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 147/316 (46%), Positives = 182/316 (57%), Gaps = 10/316 (3%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP  K  W FS +Y+ +F PFL DD+KY+WK HLVP+FY ++Y Y+V  Y  ++   IK+
Sbjct: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVLLYFTKLNPIIKS 80

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
           +L                       M  R E S    S                  CSTC
Sbjct: 81  QLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           R+ KPARSKHC+ICNRCVL++DHHCIW NNCIG GNY  FY FL+SN   + YAFLR+  
Sbjct: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           ++  S    P  VLT  IL G F  I  +FTYLQ A+V +GMTTNE+DKW+TIQE+MREG
Sbjct: 201 LTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREG 260

Query: 260 KLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEI 319
           +L+R+   D   W     E      EP   Q   FYSTNAYDH  Y   ++  I    EI
Sbjct: 261 RLIRT---DNGQWLIAHPE------EP-AGQATRFYSTNAYDHTIYCPVNFRPITHHDEI 310

Query: 320 PNIYDKGTFLANLTDL 335
           PNIYDKG+FL NL +L
Sbjct: 311 PNIYDKGSFLKNLKEL 326

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  276 bits (706), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 188/317 (59%), Gaps = 9/317 (2%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP+FK  WPFS +Y+ VF P   D+ ++RWK +LVPLFY+SIYL +V+     V   +  
Sbjct: 19  SPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQLSP 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L                      A +   E +K  K  +              I C TC
Sbjct: 79  GLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCRTC 138

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLR-LW 198
           ++ KPARSKHC++CN+CVL  DHHCIWINNC+G GNYL FYLFL+ N  SM YAF+R + 
Sbjct: 139 QLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRSMS 198

Query: 199 YISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMRE 258
            + L      PR++L   +L GCF +IC +FTYLQL +V+EGMTTNE+DKW+TI EYMRE
Sbjct: 199 IVGLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHEYMRE 258

Query: 259 GKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASE 318
            +LV+S       W++  T++ D       DQH  F+STN YD + Y L  Y  I+DA  
Sbjct: 259 KRLVKS---SSGKWYYDLTDRLDLPT----DQH-EFFSTNPYDGRLYRLQSYTLIEDAER 310

Query: 319 IPNIYDKGTFLANLTDL 335
           I NIYD+G+F+ANL  L
Sbjct: 311 INNIYDEGSFMANLRTL 327

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  273 bits (699), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 135/319 (42%), Positives = 190/319 (59%), Gaps = 15/319 (4%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP FK+T   S +Y+  ++P + D++KYRWK H+VP+FY ++++YLV  ++ +VE  I +
Sbjct: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
           +L                       M+   + +  + + S               +C TC
Sbjct: 81  KLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           ++ KPARSKHC++C++C+LV DHHC+W+NNCIG+GN+L FYLFL  N   M YA +RL  
Sbjct: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASMRLLE 200

Query: 200 ISLN---STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYM 256
           I+LN   +   +PR V+TL ILCGCF  IC  F+Y+QL IVK+GMTTNE+DKWYTIQ  M
Sbjct: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260

Query: 257 REGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDA 316
            + KLV+S D++   W+      + +           FYSTNAYDHK Y LT Y  I + 
Sbjct: 261 EDKKLVKSSDNN---WYISFVNDQGETE---------FYSTNAYDHKKYQLTEYKVIDNV 308

Query: 317 SEIPNIYDKGTFLANLTDL 335
            +IPNIYDKG+   N  D 
Sbjct: 309 EDIPNIYDKGSLWKNFKDF 327

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  272 bits (696), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 194/322 (60%), Gaps = 22/322 (6%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP  K+ WPFS +YR ++ P+L D   Y+WK H+VP FY SIYLYLVY Y+ +VE  I N
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAI----- 134
            L                       MV++  +   H +G +             I     
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINI--HGNGISQHDKLKNKFPFDNIIYHSG 136

Query: 135 -KCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYA 193
             CSTC I KPARSKHC+IC  C+L+ DHHCIW+NNCIG GNY  F++FL+ N  S+ YA
Sbjct: 137 NVCSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYA 196

Query: 194 FLRLWYISLNSTSTLPRA--VLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYT 251
           FLRL +I+L S   +P++  +L L IL G F++IC +F YLQ+  V  GMTTNE DKWY 
Sbjct: 197 FLRLLHITL-SKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYA 255

Query: 252 IQEYMREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTH-Y 310
           +QE MREGKL++S D++   WF   TE   D+   +       YSTN YD+K Y +++ Y
Sbjct: 256 VQELMREGKLIKSEDNN---WFALSTEDAPDSPSQV-------YSTNFYDNKTYKISNDY 305

Query: 311 ITIKDASEIPNIYDKGTFLANL 332
             +KDASEIPN+YD+GTFL NL
Sbjct: 306 HIVKDASEIPNVYDRGTFLDNL 327

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  241 bits (615), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 121/321 (37%), Positives = 180/321 (56%), Gaps = 17/321 (5%)

Query: 21  PVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKNE 80
           P F+  + F  +Y  V++P ++D+ +YR K ++VP+FY S+Y Y+VY ++ R  + I   
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 81  LFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTCR 140
           L                      +M+ + + S  H+ GS               +C TC+
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 141 IVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWYI 200
            VKPARSKHC++CN C+ +ADHHC+WINNC+G GNY+ FY FL SN+  + Y+F+RL +I
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 201 SL-----NSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
                  N+T T  +++L L+ILCG FT+I A++ Y    +V  GMTTNE+DKW  + +Y
Sbjct: 201 QFNKSAYNTTPTGEKSLLILSILCGSFTVILAVYCYFVFELVNSGMTTNEKDKWQMVHDY 260

Query: 256 MREGKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKD 315
           +  G LVR   D    +F K     ++           FYST++YD   Y +  Y T+K 
Sbjct: 261 INTGDLVR---DPEGKYFIKYQNGGNNYE---------FYSTDSYDGTQYTIVDYFTVKS 308

Query: 316 ASEIPNIYDKGTFLANLTDLI 336
            +EI NIYDKG F+ NL + I
Sbjct: 309 PAEITNIYDKGNFINNLREFI 329

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  223 bits (568), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 171/315 (54%), Gaps = 18/315 (5%)

Query: 27  WPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKNELFXXXX 86
           WP S +Y  V++PFL D  +YR K ++VP+FY S+Y Y++  Y   +   I   L+    
Sbjct: 27  WPLSWYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIEL 86

Query: 87  XXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSG---STXXXXXXXXXXXXAIKCSTCRIVK 143
                             M +R E       G   S                C +C  VK
Sbjct: 87  YFFQPLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVK 146

Query: 144 PARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWYISLN 203
            ARSKHCSIC RC+ +ADHHCIW N CIG+GN+  FY+FL  +   + YAF RL++  + 
Sbjct: 147 WARSKHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVVV 206

Query: 204 STSTL--PRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGKL 261
           + + L   R+ LTL +L G F ++  +FTY Q+ +VKEGMTTNEQDKW+ I EYMR+GK 
Sbjct: 207 ADNKLTSTRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKC 266

Query: 262 VR-SLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEIP 320
           V  S +     WF +             D+   FYSTNAYDH  Y LT+Y  +K+ASEI 
Sbjct: 267 VNVSCNGSTKKWFLE------------SDEDGKFYSTNAYDHTAYTLTNYHIVKNASEII 314

Query: 321 NIYDKGTFLANLTDL 335
           N+YDKG+F  N  D+
Sbjct: 315 NMYDKGSFWENFKDM 329

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  214 bits (545), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/319 (38%), Positives = 175/319 (54%), Gaps = 11/319 (3%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP+FKS  PF  +Y  VF+P    +++Y+WK  LVP FYT IY+Y  + +++ V   I++
Sbjct: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L+                      +V+   D+  +                  I C +C
Sbjct: 81  GLYTLEARCLPVVLALPLLSGYY-TIVTSPHDTITYVGPEIPFDGIIFHDN---IVCRSC 136

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           R+ K ARSKHCSIC RC+LVADHHC+W+NNCIG GNY  FYLFL+SN   + YA +RL  
Sbjct: 137 RLKKAARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSS 196

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           ++ +      ++ L+L IL  CF +I   FTY+Q A+V++GMTTNE+DKWYTI + MR  
Sbjct: 197 VAPSGLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNE 256

Query: 260 KLVRSLDDDCPSWF----FKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNL--THYITI 313
           +L++ L++DC  +               +         +YSTN YD K Y+L  T Y  +
Sbjct: 257 QLLK-LNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPYDPKTYSLSDTSYHVV 315

Query: 314 KDASEIPNIYDKGTFLANL 332
               +IPNIYD+ +F  NL
Sbjct: 316 NSYQDIPNIYDRCSFWQNL 334

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  211 bits (537), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 120/319 (37%), Positives = 165/319 (51%), Gaps = 27/319 (8%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           +P  ++ WPFS +Y  VF+  L D Q++RWK    P FY  +Y Y V+ ++  V + I  
Sbjct: 19  APALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWLFYGEVYAEIAK 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L+                     A    A  +     G               ++C TC
Sbjct: 79  ALWVPERWVLPAAVVAPAAAGVAAAATPAAVPADAAYDG---------LLFHDGVECRTC 129

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           R+ KPARS+HC +C RCV +ADHHC+W+NNC+G+GNY  FYL L ++   + Y  +RL  
Sbjct: 130 RVRKPARSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHCALLTYGAVRLPL 189

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
            +       PRA+L L +L   F ++C  FT  Q+A+V++GMTTNEQDKWY +QE MREG
Sbjct: 190 AA--PAGRWPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKWYAVQESMREG 247

Query: 260 KLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTH--YITIKDAS 317
            LVR         F+   E  D          V FYSTNAYDH+ Y L +  Y  +    
Sbjct: 248 TLVRLRGR-----FYHRVEGGDG---------VEFYSTNAYDHRTYALHNEPYAVVTSHE 293

Query: 318 EIPNIYDKGTFLANLTDLI 336
           EIPN+YD G+F  NL   +
Sbjct: 294 EIPNVYDTGSFCENLRQRL 312

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  210 bits (534), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 171/327 (52%), Gaps = 27/327 (8%)

Query: 21  PVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKNE 80
           PVFK  W    +YRNVF P   D  K+R+K H+VP+ Y +IYLY    +   +E  I + 
Sbjct: 26  PVFK--W----YYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSR 79

Query: 81  LFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTCR 140
           L+                      M+ + E +      +              ++C TC+
Sbjct: 80  LYAIERWFIIPVALMTPISCGLLTMLVKPESTYI----APPVDQFDGILFHAGVECRTCK 135

Query: 141 IVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWYI 200
           + K ARSKHC+IC RC  +ADHHC+W NNCIGKGNY  FYLFL SN+F   Y F RL Y+
Sbjct: 136 MPKYARSKHCAICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASNVFLTVYGFTRLLYL 195

Query: 201 SLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREGK 260
                S   R +LTL +L G F +I  IF+Y Q+ ++K+GMTTNE+ KW  + + MR  K
Sbjct: 196 QPTVKS---RTLLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARK 252

Query: 261 LVRSLDDDCPSWFFKCTEQKDDAAEPLQDQH-----------VTFYSTNAYDHKHYNLTH 309
           LV    D+   ++++  E +D  +  L+               TFYSTN YD+  Y + +
Sbjct: 253 LVV---DNAGKFYYRIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKY 309

Query: 310 YITIKDASEIPNIYDKGTFLANLTDLI 336
              I D  EI NIYDKG+F  NL D I
Sbjct: 310 PREIVDYEEITNIYDKGSFCNNLKDRI 336

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  215 bits (548), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 112/262 (42%), Positives = 151/262 (57%), Gaps = 8/262 (3%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP+FKS  PF  +Y ++F P   D  +YRWK ++VPLFYTSIY+Y V  ++  +   +  
Sbjct: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L                       M    + +K   S +                C TC
Sbjct: 79  YLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTK---SLADCRVPFDEIIFHPGTICQTC 135

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
             +KPARSKHCSICN+C+L+ DHHCIW+NNCIGKGNY  FY FL+SN+  + Y+FLRL  
Sbjct: 136 HKIKPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTS 195

Query: 200 ISLNSTST--LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMR 257
           I L S +     + +L LTIL GCF II A+F Y Q  +V +GMTTNEQDKW+T+QE+MR
Sbjct: 196 IQLMSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMR 255

Query: 258 EGKLVRSLDDDCPSWFFKCTEQ 279
           +G LVR   D    ++F+  ++
Sbjct: 256 DGNLVR---DKKGHYYFRILDE 274

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 28/43 (65%)

Query: 294 FYSTNAYDHKHYNLTHYITIKDASEIPNIYDKGTFLANLTDLI 336
           FYSTN YD   Y++  Y  IKD  ++ NIYDKG F ANL D I
Sbjct: 511 FYSTNPYDDLTYHVEDYDVIKDPKDLNNIYDKGNFWANLWDRI 553

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  209 bits (533), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 114/332 (34%), Positives = 171/332 (51%), Gaps = 29/332 (8%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP+F++   F  +Y  VF P   D  ++RWK   +P FY SIY Y  + +   +E  I++
Sbjct: 21  SPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRS 80

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            LF                      +  + + +      S              + C TC
Sbjct: 81  RLFGVERLLIIPVALSAPIITGLLTIWIKPKSTY----ASPMLDAYDELIFHSGVSCRTC 136

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           ++ K AR+KHC IC++CV +ADHHC+W NNCIG+GNY  FYLFL+SN+F   Y FLRL +
Sbjct: 137 KLPKFARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLF 196

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           +     S   R +L L+IL GCF +I A+F+Y Q  +V++GMTTNE++KW  I + +R  
Sbjct: 197 LQRFVHS---RQLLILSILLGCFGVILAVFSYFQFVLVRDGMTTNEENKWLVIHDMIRAR 253

Query: 260 KLVRSLDDDCPSWFFKCTEQ-KDDAAEPLQDQH------------------VTFYSTNAY 300
           ++V    DD   ++F+     ++D+AE L +                      +YSTN Y
Sbjct: 254 QMV---TDDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHLNDSSPDIYVYYSTNPY 310

Query: 301 DHKHYNLTHYITIKDASEIPNIYDKGTFLANL 332
           D+  Y++ +   I   + I NIYD+G F  NL
Sbjct: 311 DNATYDVKNPKEILSTAAITNIYDEGGFWKNL 342

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  207 bits (528), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/317 (36%), Positives = 163/317 (51%), Gaps = 15/317 (4%)

Query: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79
           SP FK    F  +Y++++ P   D  +YRWK  LVP FY  I ++ V+ ++ ++  T+  
Sbjct: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78

Query: 80  ELFXXXXXXXXXXXXXXXXXXXXXAMVSRAEDSKDHKSGSTXXXXXXXXXXXXAIKCSTC 139
            L+                       V      K     +             +  C TC
Sbjct: 79  YLYSLEKAFIPITIAFTSLTGVASVFV------KPLGLQAGPQFQPDYIIFHPSAVCQTC 132

Query: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199
           + +K  RSKHC IC RC+ + DHHCIWINNC+G GNY  FY FL+SN   + YA LRL  
Sbjct: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLT 192

Query: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259
           +   +     +  L+L +L   F++I  +FTY QL +V +GMT NEQDKWY +QEYMR G
Sbjct: 193 LFRITAFKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252

Query: 260 KLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEI 319
            LV+ +D      +++        AEP+      FYSTN YDH  Y+L +   I    EI
Sbjct: 253 NLVKDMDG---VLYYRSMSTDAQTAEPI------FYSTNLYDHSKYHLINPAKILSHEEI 303

Query: 320 PNIYDKGTFLANLTDLI 336
            N+YD+G+FL NL + I
Sbjct: 304 INLYDRGSFLDNLKERI 320

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/166 (34%), Positives = 84/166 (50%), Gaps = 13/166 (7%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           CSTC I +P R+ HCSIC  C+ V DHHCIWINNC+G  NY  F +FL+  I S  +  +
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVGAILSSIFIII 249

Query: 196 R--LWYISLNSTSTLPRAVLTLTILCGCFTII-CAIFTYLQLAIVKEGMTTNE-QDKWYT 251
              +    +   S  P A+  L I+ GC TII   I     +A+   G TT E     + 
Sbjct: 250 NCSIHVARIRRASNAPVAI--LLIVYGCLTIIYPGILLGYHIALTGTGQTTREFLHTLHG 307

Query: 252 IQEYMREGKLVRSLDD--DCPSWF----FKCTEQKDDAAEPLQDQH 291
           I+  M   ++ R+ D+  D  S+F    F   +++  +  P +  H
Sbjct: 308 IKNPMLS-RVTRARDNAFDSGSFFHNMIFLMAQRQAPSFLPSRGTH 352

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 72/131 (54%), Gaps = 6/131 (4%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TCRI +P RS HCSIC+ CV+  DHHC+W+NNC+GK NY  F +FL S I ++ +  +
Sbjct: 196 CRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTSTIMTVIFLLI 255

Query: 196 RLW-YISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLA----IVKEGMTTNEQDKW- 249
               +I  N     P + + +TIL   +  +   +  + LA    +     TT E  K+ 
Sbjct: 256 NTGIHIGKNRHEKKPASNIPVTILLTVYGSLSISYPIILLAYHLVLTGTNQTTREFLKYV 315

Query: 250 YTIQEYMREGK 260
           Y I++  R+ K
Sbjct: 316 YEIRDQHRKSK 326

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 85.9 bits (211), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 43/54 (79%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS 189
           C++CRI +P RS HCS CN CV+V DHHCIW+NNCIGK NY  F +FL+S IFS
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLSAIFS 228

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 60/113 (53%), Gaps = 4/113 (3%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C +CRI +P R+ HCS CN CV+V DHHC+W+NNC+GK NY  F +FL+S IFS  +  L
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLSAIFSSVF-LL 233

Query: 196 RLWYISLNSTSTLPR---AVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
               I +   S  PR     L L I  G      AI     + +     TT E
Sbjct: 234 TNCAIHIARESDGPRNYPVALLLLIYAGLTIWYPAILFTYHIFMAGTQQTTRE 286

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/127 (38%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C++CRI +P R+ HCS C  C+L  DHHCIW+NNCIG+ NY  F LFL S I S  +   
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLASAILSSIFLIA 240

Query: 196 RL---WYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTI 252
                 Y   N  S +P  +L L  + G   II     Y  L ++   + T  Q    T 
Sbjct: 241 NCSIHIYHHRNLPSKVPVTILLL--IYGGLAII-----YPMLLLIYHILMTGRQQ---TT 290

Query: 253 QEYMREG 259
           +E++RE 
Sbjct: 291 REFLREA 297

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 84.0 bits (206), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 51/95 (53%), Gaps = 28/95 (29%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS------ 189
           C +CRI +P RS HCS CN CV+V DHHCIW+NNCIGK NY  F +FL+S + S      
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLSAVISSIILLA 234

Query: 190 ----------------------MCYAFLRLWYISL 202
                                 +CYA L LWY ++
Sbjct: 235 NCAIHIARESGGPGHYPVAILLLCYAGLTLWYPAI 269

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 83.6 bits (205), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 50/95 (52%), Gaps = 28/95 (29%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS------ 189
           C +CRI +P RS HCS CN CV+V DHHCIW+NNCIGK NY  F +FL+  I S      
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLGAILSSVILLT 234

Query: 190 ----------------------MCYAFLRLWYISL 202
                                 +CYA L LWY ++
Sbjct: 235 NCAIHIARESGGPRDCPVAILLLCYAGLTLWYPAI 269

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 82.8 bits (203), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 50/89 (56%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+TCRI +P RS HCSIC  C++  DHHCIW+NNCIG+ NY  F  FL+S  F+  +  +
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLSGTFTSIFLII 276

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTI 224
                   +       V  L I+ G  TI
Sbjct: 277 NASIDIARTPKVRDTPVAVLLIIYGGLTI 305

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 81.6 bits (200), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 83/171 (48%), Gaps = 23/171 (13%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TCRI +P RS HCS+C+ CVL  DHHC W+NNCIGK NY  F  FL+++  S C   +
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMASTIS-CILLI 232

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
            L    L+ +  +    ++L I+C C      I+  L L I    +   +Q    T  EY
Sbjct: 233 LLSSFRLSYSPQVRYTPVSLLIICYCGL---GIWYPLILFIYHIFLAGTQQ----TTHEY 285

Query: 256 MRE--------GKLVRSLDD--DCPSWFFKC-----TEQKDDAAEPLQDQH 291
           +R          K+ R+ D   D  S FF        E+  +  +P + QH
Sbjct: 286 LRSIGSKHPIFHKITRNRDSPYDRNSMFFNLIHLWFQERGWNLVDPRRKQH 336

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 69/122 (56%), Gaps = 8/122 (6%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+TCRI +P R+ HC++C+ C+L  DHHC W+NNCIG+ N+  F  FL S++ S  +  L
Sbjct: 187 CTTCRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSSVLSSIW-LL 245

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
               + L    +   A ++L ++C C     +I+  L LAI    +T  +Q    T  EY
Sbjct: 246 TCCALKLRHAGSPSAAPVSLLLICYCAV---SIWYPLLLAIYHLFLTGTQQ----TTHEY 298

Query: 256 MR 257
           ++
Sbjct: 299 LK 300

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 56/182 (30%), Positives = 82/182 (45%), Gaps = 20/182 (10%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TCRI +P RS HCSIC  CVL+ DHHC+W+NNC+G+ NY  F  FL S+  +  +  +
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSSTLTSIFLIV 243

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
                   +       V  L I+ G  TI   +     L +    MT  +Q    T +EY
Sbjct: 244 NAAIDVARTPDVTDTPVAVLLIVYGFLTIWYPMI----LLMYHVFMTGTQQ----TTREY 295

Query: 256 MRE--------GKLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNL 307
           +++         K+ R  D+     F +    K+  +  LQ +     S    DH   + 
Sbjct: 296 LKQIGFKNPVFHKIKRRPDNP----FERGGFFKNMGSLMLQVRGNALVSARHRDHAGTDW 351

Query: 308 TH 309
           TH
Sbjct: 352 TH 353

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C++CRI +P R+ HCS C  CV+  DHHCIW+NNC+G+ NY  F +FLI  + +  +   
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGTVLAELFLIA 240

Query: 196 RLWYISLNSTSTLPRAVLTLTILC 219
                    +S +P  +L L   C
Sbjct: 241 NCSIHIARRSSQVPVTILLLVYAC 264

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 79.0 bits (193), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 70/125 (56%), Gaps = 8/125 (6%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TCRI +P R+ HCS+C  C+L  DHHC W+NNCIG+ NY  F  FL+S+  +     +
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSSWLTAVICIV 232

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
                  ++T  +  AV  L ++   +  +C+ + +L L +    +T+ +Q    T +EY
Sbjct: 233 SCAIRIAHATRLVKVAVAILLLI---YCALCSCYPFL-LLLYHVFLTSTQQ----TTREY 284

Query: 256 MREGK 260
           ++ G+
Sbjct: 285 LKGGR 289

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 78.6 bits (192), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS 189
           C TCRI +P R+ HCSIC  CV+  DHHCIWINNC+G+ NY  F  FLIS   +
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISGTLA 231

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 66/134 (49%), Gaps = 12/134 (8%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+TCRI +P R+ HCS CN C++  DHHCIW+NNC+G+ NY  F  F+ S + ++    +
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYSAVLTIILLVI 248

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
                    + T     L L   CG       I+  L L I    +   +Q    T  EY
Sbjct: 249 NCSVRLSKGSPTAKTPSLLLICYCG-----VGIWYPLILGIYHIFLAGTQQ----TTHEY 299

Query: 256 MREGKLVRSLDDDC 269
           +   KL++S +  C
Sbjct: 300 L---KLIKSGNPIC 310

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 77.8 bits (190), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 67/123 (54%), Gaps = 8/123 (6%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+TCRI +P R+ HCS C  C++  DHHC W+NNCIG+ NY  F+ FL+S + +  +   
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVSCVIATAFIIA 231

Query: 196 RLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEY 255
               I ++ +     A + + +L  C  ++C  F  L   I    +T ++Q    T +EY
Sbjct: 232 NC-AIRVSRSVHAKDAPVAILLLIYCGLVVCYPFILLVYHIF---LTGSQQ----TTREY 283

Query: 256 MRE 258
           ++ 
Sbjct: 284 LKS 286

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 74.7 bits (182), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 39/54 (72%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFS 189
           C TC+I +P R+ HCS+C  CVL  DHHCIW+NNC+G+ NY  F  FL+S+  +
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSSTLA 213

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 73.9 bits (180), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS 185
           C+TCRI +P R+ HCS C  CVL  DHHC W+NNCIG+ NY  F  FL S
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLAS 227

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  CR+ KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FL   IFS  Y   
Sbjct: 80  CKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFLFWVIFSTAYLLF 139

Query: 196 RL 197
            L
Sbjct: 140 LL 141

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C+  KP R+ HC  C++CVLV DHHC W  NC+G  N+  F  FL+  I +  Y   
Sbjct: 80  CQKCKTYKPERTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLVWVIITTSYLGF 139

Query: 196 RLW-----YISLNSTSTLPRAVLTLTIL----CGCFTIICAIFTYLQLAIVKE--GMTTN 244
            LW     +  L  T    + +  + I        F  +  I   L+ +  +   GMT  
Sbjct: 140 MLWKRIFMHWQLRHTRIYVQKIELVFIFINTPLNAFVWLTIILLLLRCSKNQFLCGMTQI 199

Query: 245 EQDKWYTIQEYMREGKLVRSLDDD 268
           E+ +W  I+     G+L+  L ++
Sbjct: 200 ERWEWERIENQFNNGRLIPQLLEN 223

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+ C   KP RS HC  C +CVL+ DHHC W  NC+G GN+ QF  FLI  I +    F 
Sbjct: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLIWVIITTSQLF- 140

Query: 196 RLWYISL 202
             WY+ L
Sbjct: 141 --WYLLL 145

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 68.6 bits (166), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 33/50 (66%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS 185
           C+ C+I +P R+ HC IC  CV   DHHC WINNC+G+ NY  F  FL +
Sbjct: 186 CTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTA 235

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 50/91 (54%), Gaps = 8/91 (8%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL----ISNIFSMC 191
           C  C   KP R+ HC  CN+C+L+ DHHC W  NC+G  NY  F  FL    ++  F + 
Sbjct: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFLFWVIVTTAFLLA 140

Query: 192 YAFLRLWYISLN--STSTL--PRAVLTLTIL 218
             F R+ +I  N  S+S L   + ++ LTIL
Sbjct: 141 QLFRRIGFIWTNWYSSSALVQRQEIVMLTIL 171

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 67.0 bits (162), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 31/48 (64%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G GNY  F  FL
Sbjct: 80  CKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFLRFL 127

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 62/138 (44%), Gaps = 7/138 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISN------IFS 189
           C TC + KP R  HCS CN+C L  DHHC W  +C+G  N   F  FL+        +F 
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLLYTTAYSILVFF 192

Query: 190 MCYAFLRLWYISLNSTSTLPR-AVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           +  A L +W+ S      L    +L + IL    TI    FT   + +V +  TT E  +
Sbjct: 193 LTGADLLMWFRSQGYNQELINLPLLIVWILSLVITISMLAFTSYTIYLVAKNQTTIEMYE 252

Query: 249 WYTIQEYMREGKLVRSLD 266
           W   +        VR LD
Sbjct: 253 WTNYRNQRNIMDEVRGLD 270

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TC++ KP R  HCS C++C+L  DHHC W   CIG  N   F  FL   I+   Y+ +
Sbjct: 101 CQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAECIGFENQKYFVQFL---IYCTAYSIV 157

Query: 196 RLWYISLN----------STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L++ S                +   +LT+ IL    T+    F+   +  + +  TT E
Sbjct: 158 VLFFTSCELHYWFSGKQYEDELIDLMLLTVWILAIVITVSLIFFSSFSIYQLLKNQTTIE 217

Query: 246 QDKWYTIQEYMREGKLVRSLDD 267
               Y ++   R+ +L+R L+D
Sbjct: 218 M---YGMKREKRDLELLRGLED 236

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 32/51 (62%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISN 186
           C TC + KP RS HCS CNRCVL  DHHC W + CIG  N   F  FLI N
Sbjct: 110 CRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN 160

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 67/142 (47%), Gaps = 16/142 (11%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TC++ KP R  HCS CN+C+L  DHHC W   CIG  N   F  FL   I+   YAF+
Sbjct: 109 CQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFL---IYCTIYAFV 165

Query: 196 RL---------WYISLNSTST-LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            L         WY + N  +  +   +L + +L    +I    F+   +  V +  TT E
Sbjct: 166 ALGLISYQFVNWYKNQNYMNEYIDFTLLIVGLLAFVISISVLAFSSFSIYQVLKNRTTIE 225

Query: 246 QDKWYTIQEYMREGKLVRSLDD 267
               Y I+ Y R+  ++   ++
Sbjct: 226 M---YGIRRYNRDFAILNGTEE 244

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 39/75 (52%), Gaps = 4/75 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF- 194
           C  CR  KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FL   I +  Y   
Sbjct: 80  CKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFPHFMRFLFWVIATTGYLLY 139

Query: 195 ---LRLWYISLNSTS 206
              LR ++I  N  S
Sbjct: 140 ELCLRAYFILSNHNS 154

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 36/62 (58%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C+  KP R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL+  I +  +   
Sbjct: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLVWVIVATAFLLY 139

Query: 196 RL 197
           +L
Sbjct: 140 QL 141

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FL
Sbjct: 80  CKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFL 127

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 36/62 (58%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C++ KP R+ HC  CN+CVL+ DHHC W  NC+G  N+  F  FL   + +  +   
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFLFWVVVTTGFLLY 139

Query: 196 RL 197
           +L
Sbjct: 140 QL 141

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 64.3 bits (155), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 31/50 (62%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           + C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL
Sbjct: 78  VYCKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 65/117 (55%), Gaps = 7/117 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI-SNIFSMCY-- 192
           C+TC + KP RS HCS CN+C L  DHHC W ++CIG  N   F  FL+ S ++S+    
Sbjct: 110 CATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSSCIGFNNQKFFVQFLMYSTLYSISIFI 169

Query: 193 -AFLRL--WYISLN-STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            A L++  W+ + N +T  +   +L + +L    ++    FT   + ++ +  TTNE
Sbjct: 170 AATLQIVSWFRNQNYTTQYIDINLLVVWLLSTGASVSLFCFTGFSIYLLTKNQTTNE 226

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 58/120 (48%), Gaps = 13/120 (10%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF- 194
           C TC + KP R  HCS CNRC+L  DHHC W+ +C+G  N   F  FL   +++  YAF 
Sbjct: 108 CRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFL---MYATLYAFN 164

Query: 195 --------LRLWYISLNSTSTLPRAVL-TLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
                   L +W+   +    L   VL ++ +L    +I  + FT   +  V    TT E
Sbjct: 165 VLIFDTIQLYIWFHQGDYERQLIDLVLFSVWLLAFAVSIALSCFTGFSIYQVAHNQTTIE 224

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/156 (30%), Positives = 68/156 (43%), Gaps = 25/156 (16%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C TC + KP R  HCS C++C+L  DHHC W   C+G  N   F  FL   I++  YA L
Sbjct: 106 CRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECVGFKNQKYFVQFL---IYTTVYAIL 162

Query: 196 RLWYIS----------LNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNE 245
            + Y S          L  T  +   +L + IL     +    FT   +       TT E
Sbjct: 163 VMTYTSFQIYDWFKNELYETEIIKIRLLMVWILSVAVFLTVTCFTGFSIYQTINNRTTIE 222

Query: 246 QDKWYTIQEYM---------REGKLVRSLDDDCPSW 272
               YT+++Y          R+ +L R++ D   +W
Sbjct: 223 M---YTLRKYREELELYGNYRDSQLTRNIFDLGSTW 255

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 30/48 (62%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  FL
Sbjct: 80  CKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFLRFL 127

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 30/49 (61%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           C  C   KP RS HC  CN+CVL+ DHHC W  NCIG  N+  F  FL+
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 34/59 (57%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF 194
           C  C+  KP RS HC  CN+CVL+ DHHC W  NC+G  NY  F  F+   I +  + F
Sbjct: 100 CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYPHFLRFIFWVIATTGFLF 158

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 57/121 (47%), Gaps = 7/121 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF- 194
           C  C++ KP RS HCS CN+C L  DHHC W  +CIG  N   F  FL+   +   + F 
Sbjct: 105 CRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLLYTTWYAVFVFM 164

Query: 195 ---LRLWYISLN---STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
              L+LW    N       +  +++T+ +L     I    FT   + +V +  TT E   
Sbjct: 165 TTGLQLWKWLDNKMYEKELIDLSLMTVWLLSIISCISMFAFTSYSIYLVTKNTTTIEMYG 224

Query: 249 W 249
           W
Sbjct: 225 W 225

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 35/62 (56%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C   KP RS HC  CN+CVL+ DHHC W  NC+G  N+  F  FL+  I +  +  +
Sbjct: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLMWIIITTGFLLV 143

Query: 196 RL 197
            L
Sbjct: 144 HL 145

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGN---YLQFYLFLISN---IFS 189
           C +CR  KP R  HCS C+RC+L  DHHC WI  C+G  N   ++QF L+  +    + S
Sbjct: 103 CQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAGCVGFRNQKLFIQFLLYTTAYAIFVLS 162

Query: 190 MCYAFLRLWYISLNSTSTLPRA-VLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           M    L  W+ +      L    +L L I      I   +F+   ++ V +  TT E   
Sbjct: 163 MTSVQLYRWFYNDKFQEELISGYLLFLWIFSLVVFIAMTLFSAFSVSQVLKNQTTIEM-- 220

Query: 249 WYTIQEYMREGKLV 262
            Y +Q +  + +++
Sbjct: 221 -YGVQRWRNQARIL 233

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 60/125 (48%), Gaps = 7/125 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI-SNIFS----- 189
           C TC I KP R  HCS CN+C L  DHHC W  +C+G  N   F  FL  + ++S     
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFLAYTTVYSLYVLL 164

Query: 190 MCYAFLRLWYISLNSTST-LPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           M  A L  W+  +   S  L   +L + +L     I    FT   + +V +  TT EQ +
Sbjct: 165 MTSAQLYSWFRQMKYKSELLDLHLLVVWVLSVIAAIATFAFTTYTIWLVTKNETTIEQYE 224

Query: 249 WYTIQ 253
           W  I+
Sbjct: 225 WGNIR 229

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 57/125 (45%), Gaps = 7/125 (5%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISN------IFS 189
           C  C + KP R  HCS C +C L  DHHC W  +C+G  N   F  FLI        IF 
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLIYGTVFSILIFL 165

Query: 190 MCYAFLRLWYISLN-STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           +    L LW+ +   +   +   +L + IL    +I    FT   + ++ +  TT E  +
Sbjct: 166 LSGTELLLWFKNQRYNQEMIQLPLLVVWILSVAISISMLAFTSYTVYLITKNQTTIEMYE 225

Query: 249 WYTIQ 253
           W  ++
Sbjct: 226 WSNLK 230

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 62.0 bits (149), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 31/51 (60%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISN 186
           C TC + KP R  HCS C+RC+L  DHHC W   CIG  N+  F  FLI N
Sbjct: 106 CRTCLVWKPDRCHHCSSCDRCILKMDHHCPWFAECIGFKNHKYFINFLIYN 156

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 65/142 (45%), Gaps = 12/142 (8%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYA-- 193
           C  C+  KP R+ HC  C +CVLV DHHC +  NC+G  N+  F  FL   I +  Y   
Sbjct: 80  CKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCVGYNNFPHFMRFLFWIITTTTYLSI 139

Query: 194 --FLRLWYI--SLNSTSTL--PRAVLTLTILCGCFTIICAIFTYLQLAIVK----EGMTT 243
             F R W++    +ST+ L   + ++ LTIL      +    + L    +K     GMT 
Sbjct: 140 QFFKRTWFVWNIRHSTAQLVTKKEIIFLTILTPANAFVLLTISILFGRCIKNQVLNGMTQ 199

Query: 244 NEQDKWYTIQEYMREGKLVRSL 265
            E  +   I+      +LV  L
Sbjct: 200 IEAWEMDRIESMFYNRRLVPQL 221

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 61.6 bits (148), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 29/48 (60%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C+ C   KP R+ HC  CN+CVL  DHHC W  NC+G  N+  F  FL
Sbjct: 80  CNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCVGHRNFAHFIRFL 127

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 31/57 (54%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCY 192
           C  C   KP R+ HC  C +CVL+ DHHC W  NC+G  N+  F  FL   I +  Y
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFLFWVIVTTTY 136

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 32/62 (51%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C   KP R+ HC  C +CVL  DHHC W  NC+G  N+  F  FL   + +  Y  L
Sbjct: 80  CKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNCVGHNNFPHFVRFLTWVVLTTSYLGL 139

Query: 196 RL 197
            L
Sbjct: 140 LL 141

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C + KP R  HCS C+ CVL  DHHC W   C G  N   F  FL   +++ CYAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDICVLKMDHHCPWFAECTGFKNQKFFIQFL---MYTTCYAFL 162

Query: 196 RLWY 199
            L Y
Sbjct: 163 VLIY 166

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 58.9 bits (141), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 60/133 (45%), Gaps = 21/133 (15%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAF- 194
           C  C++ KP R  HCS C++C L  DHHC+W   CIG  N+  F  FL   +++  YAF 
Sbjct: 171 CVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFPGCIGYNNHKFFLHFL---LYASVYAFW 227

Query: 195 --------LRLWYISLNSTSTLPRAVLTLTILC-----GCFTIICAIFTYLQLAIVKEGM 241
                   L +W+       +  R +L + ++C        T+    F    + +V +  
Sbjct: 228 ICIITTWDLVVWF----RAHSYERELLNVHLVCLWALSAAATVALTAFCAFNIYLVCKNE 283

Query: 242 TTNEQDKWYTIQE 254
           TT E  +  T+  
Sbjct: 284 TTGEYQRRSTLNS 296

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 27/48 (56%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C TC   KP R  HCS CNRC+L  DHHC W   CIG  N   F  FL
Sbjct: 106 CQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFAECIGFKNQKYFIQFL 153

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 57.8 bits (138), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C + KP R  HCS C+ C+L  DHHC W   C G  N   F  FL+   F   YAFL
Sbjct: 106 CQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLMYTTF---YAFL 162

Query: 196 RLWY 199
            L Y
Sbjct: 163 VLIY 166

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 25/37 (67%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIG 172
           C+ C   KP R+ HC  CN+CVLV DHHC W  NC+G
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 69/143 (48%), Gaps = 13/143 (9%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGN---YLQFYLFLIS-NIFSMC 191
           C TC + KP R  HCS C++C+L  DHHC W   CIG  N   ++Q+ L+  + +I    
Sbjct: 107 CRTCHVWKPDRCHHCSRCDKCILKMDHHCPWFPGCIGFNNQRFFIQYLLYATTYSIVIFL 166

Query: 192 YAFLRL--WYISLN-STSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDK 248
           ++ ++L  W+ +       +   +L++ +L    ++  + FT   +  V +  TT E   
Sbjct: 167 FSSIQLLHWFNTKQYEVELIDFHLLSVWLLGVAVSVSLSFFTGFSIYQVTKNQTTVE--- 223

Query: 249 WYTIQEYMREGKLVRSLDDDCPS 271
              +  Y R  + +  L D C S
Sbjct: 224 ---MHIYRRYREELEILADTCGS 243

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           CS C  +K  RS H S+ N C+   DH+CIW+   IGK NY QF +FL
Sbjct: 119 CSNCEGLKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFL 166

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 60/138 (43%), Gaps = 18/138 (13%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGN---------YLQFYLFLISN 186
           C  C + KP R  HCS C+ C+L  DHHC W   C G  N         Y  FY FL+  
Sbjct: 106 CQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLMYTTFYAFLV-- 163

Query: 187 IFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQ 246
           +   CY  L  W+    ++ +  R ++ L +L      I    + L  +        N Q
Sbjct: 164 LIDTCYE-LGTWF----NSGSFSRELIDLHLLGTALLAIAVFISVLAFSAFSIYQVCNNQ 218

Query: 247 D--KWYTIQEYMREGKLV 262
              + ++++ Y R+ +++
Sbjct: 219 TTIELHSMRRYRRDLEIL 236

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 28/64 (43%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C  C + KP R  HCS C+ C+L  DHHC W   C G  N   F  FL   +++  YAFL
Sbjct: 106 CQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFL---MYTTLYAFL 162

Query: 196 RLWY 199
            L Y
Sbjct: 163 VLIY 166

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 27/49 (55%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           C +C   KP R  HCS CN CVL  DHHC W   C+G  N   F  FLI
Sbjct: 106 CKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLI 154

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 52.4 bits (124), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 24/39 (61%)

Query: 145 ARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
            R+ HC  CN CV++ DHHC W  NC+G  NY  F  FL
Sbjct: 99  PRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 28/48 (58%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           CS C+ +K  R+ H S    CV   DH+C+W+   IGK NYL F  F+
Sbjct: 123 CSECQSLKLERTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFV 170

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 61/143 (42%), Gaps = 22/143 (15%)

Query: 105 MVSRAEDSKDHKSGSTXXXXXXXXX-------XXXAIKCSTCRIVKPARSKHCSICNRCV 157
           +V+ +E   D K GS                     I C+ C+ +K  R+ H S    C+
Sbjct: 87  IVADSESESDEKDGSEAATRSIKPPRIYQCDPQGYPIWCTACQSLKSNRTHHSSTLGYCI 146

Query: 158 LVADHHCIWINNCIGKGNY-------LQFYLFLISNIFSMCYAFLRLWYISLNSTSTLPR 210
              DH+C+WI   +G+ NY         F+LF I  I S+  +FLR     + S S +PR
Sbjct: 147 PRFDHYCVWIGTIVGRKNYRLFVQFAFYFWLFTIYMIASIA-SFLRR---IIKSRSQIPR 202

Query: 211 A----VLTLTILCGCFTIICAIF 229
                ++ L + C    ++  +F
Sbjct: 203 VNPNILVVLALCCMAMLMVGPLF 225

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%)

Query: 133 AIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
            I C TC+ +K  R+ H      C+   DHHC+W+   IGK NYL F  F+
Sbjct: 121 PIWCDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFV 171

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           C+ C+ VK  R+ H      CV   DH+C W+   IG GNYL F  FL+
Sbjct: 126 CAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLV 174

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 47/104 (45%), Gaps = 14/104 (13%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY-------LQFYLFLISN 186
           I C+ C+ +K  R+ H S    C+   DH+C+WI   +G+ NY         F+ F I  
Sbjct: 130 IWCTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQFAFYFWAFAIFV 189

Query: 187 IFSMCYAFLRLWYISLNSTSTLPRA---VLTLTILCGCFTIICA 227
           I S      ++    + S   +PR    +L +  LCG  T++  
Sbjct: 190 IVSTASFLPKI----IRSQPHVPRVNPNILIMMGLCGMATLMVG 229

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 8/105 (7%)

Query: 133 AIKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY-------LQFYLFLIS 185
            I CS C+ +K  R+ H +    CV   DH+C+WI   +G+ NY       + F+ + + 
Sbjct: 124 PIWCSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQFSMYFFFYFVI 183

Query: 186 NIFSMCYAFLRLWYISLNSTSTLPRAVLTLTILCGC-FTIICAIF 229
            +  +C     + + + +++  +   +L L ILC   F ++  +F
Sbjct: 184 VLIPVCKYLKDIIHHNRHTSPPVNPNILVLLILCAIGFLMVTPLF 228

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 27/49 (55%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLF 182
           I CS C+ +K  RS H S    C+   DH+C+WI   IG+ NY  F  F
Sbjct: 129 IWCSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF 177

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 11/107 (10%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY-------LQFYLFLISNIF 188
           CSTC+ +K  RS H  +   CV   DH+C+W+   IG+ NY       + F ++L++   
Sbjct: 127 CSTCQSLKIERSHHSELLKYCVPRFDHYCVWLGTVIGRKNYKLFMQYVMYFTIYLVTASL 186

Query: 189 SMCYAFLRLWYISLNSTSTLPRAVLTLTILCGCF----TIICAIFTY 231
           ++     R+   +     TL   ++ L IL   F    T + A+F++
Sbjct: 187 TIALFMKRIVDYNKEHDLTLNLNIIVLFILVLAFAFFVTPLFAVFSF 233

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           I CS C+ +K  R+ H S    CV   DH+C+W+   IG+ NY  F  F+
Sbjct: 135 IWCSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLF 182
           I CS C+ +K  R+ H S    C+   DH+C+WI   IG+ NY  F  F
Sbjct: 129 IWCSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           I CS C+ +K  R+ H S    CV   DH+C+W    IG+ NY  F  F+
Sbjct: 130 IWCSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 27/48 (56%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           CS C+ +K  R+KH S    CV   DH+C+W+   IG  NY  F  F+
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFV 163

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 6/64 (9%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C+ C+ +K +RS H     RC+L  DH+C WI   I + NY  F  ++        +  L
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYV------GWFNLL 171

Query: 196 RLWY 199
            LWY
Sbjct: 172 LLWY 175

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRL 197
           KP RSK+ S+ N  V   DH+C WI N +G  N+  F +F I+++ S  + FL L
Sbjct: 479 KPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITSMESGIFTFLAL 532

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           CS C+ +K  R+ H      CV   DH+C+W+   IG+ NY  F  FL+
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 26/51 (50%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           I CS C  VK  R+ H S    CV   DH C W+   IG+ NY  F  F++
Sbjct: 125 IWCSACDSVKTERAHHSSDMEYCVPRFDHKCAWLGAVIGRDNYRFFIQFVM 175

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLF 182
           I CS C+ +K +R+ H +    CV   DH+C+WI   +G+ NY  F  F
Sbjct: 126 IWCSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQF 174

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQF------YLFLISNI 187
           I C+ C+ +K  R  H      C+   DH+C WI   IG+ NY  F      Y  L++ I
Sbjct: 115 IWCTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVFYYNLLLAWI 174

Query: 188 FSMCYAFLR 196
           +    AF+R
Sbjct: 175 WLSISAFIR 183

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C    I KP RSK   + N  V   DH+C WI N +G  N+  F +F I+ + S  + FL
Sbjct: 472 CIETWIRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFITLMESGIFTFL 530

Query: 196 RL 197
            L
Sbjct: 531 AL 532

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 31/179 (17%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS---NIFSMCY 192
           C    + KP RSK+  + +  +L  DH+C WI N +G  N+  F  F+++    IFS   
Sbjct: 456 CLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILALELGIFSFVK 515

Query: 193 AFLRLWYISLN--------STSTLPRAVLT--LTILCGCFTIICAIFTY----LQLAIVK 238
             L+ ++  L+            L   ++    T L   +  I A++ +    +QL  + 
Sbjct: 516 VCLK-YFDELDMDGDCFILGDDDLCSGLIGDRFTFLIMTWACIQAVWIFSLVIVQLFQIT 574

Query: 239 EGMTTNEQDKWYTIQEYMREGKLV-------RSLDDDCPSWFFKCTEQKDDAAEPLQDQ 290
           +G+T +E      +   +REG+ V           +  P  F    + +++AA P+++ 
Sbjct: 575 KGLTNSE------LNALIREGRRVDIDSQTHNEFFNTVPEGFINNKDTEEEAAPPVRNN 627

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS 185
           C    I KP RSK  +  N  V   DH+C W+ N IG  N+  F  F+IS
Sbjct: 463 CIETWIRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRL 197
           KP RSK  S+ N  V   DH+C WI N +G  N+  F +F I+ + S  + F  L
Sbjct: 479 KPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAF-IFFIALMESGIFTFFAL 532

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMC-YAF 194
           C    + KP RS++  + +  V   DH C WI N IG  N+  F LF+I  +  +  Y +
Sbjct: 479 CIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFIILMVIGIWEYTY 538

Query: 195 LRLWY 199
           L + Y
Sbjct: 539 LAMEY 543

>ZYRO0C11132g Chr3 complement(861388..863667) [2280 bp, 759 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 759

 Score = 38.5 bits (88), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYL-FLISNIFSMCYAF 194
           C    + KP RS+  S+ N  V   DH+C W+ N IG  N+  F +  L+  I  + + +
Sbjct: 464 CIETWVKKPLRSRFSSLSNSLVARFDHYCPWVYNDIGLRNHKAFLMCILLVEILMLLFNY 523

Query: 195 LRLWY 199
           L + Y
Sbjct: 524 LCMEY 528

>Suva_2.432 Chr2 complement(762658..764949) [2292 bp, 763 aa] {ON}
           YDR264C (REAL)
          Length = 763

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 6/58 (10%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL------ISNIFSMCYAF 194
           KP RS+  S+ N  V   DH+C WI N +G  N+  F  F+      I   F +C  +
Sbjct: 478 KPLRSRFSSLNNAVVARFDHYCPWIFNDVGLKNHKGFMFFITLMECGILTFFKLCLEY 535

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNY---LQFYLFL---ISNI 187
           I C+ C+ +K  R+ H      CV   DH C ++ + IGK NY   +Q+ +F+   ++ I
Sbjct: 125 IWCTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQYCVFMTIWLAII 184

Query: 188 FSMCYAFLR 196
           ++   A++R
Sbjct: 185 WTSIVAYIR 193

>SAKL0G07326g Chr7 complement(599477..601690) [2214 bp, 737 aa] {ON}
           uniprot|Q875S9 Saccharomyces kluyveri AKR1
           Palmitoyltransferase AKR1
          Length = 737

 Score = 37.4 bits (85), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 1/62 (1%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFL 195
           C +  + KP RSK  +     V   DH C WI N IG  N+  F LF I  + +  + FL
Sbjct: 452 CISTWVRKPIRSKFSNFSRALVTRFDHFCPWIYNDIGLRNHKTF-LFFILCLETCIFVFL 510

Query: 196 RL 197
           +L
Sbjct: 511 KL 512

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS 185
           KP RSK        ++  DH C WI N +G  N+ QF  FL+S
Sbjct: 461 KPLRSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLS 503

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 3/56 (5%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLW 198
           KP RSK+       V   DH+C WI N +G  N+  F  F ++  + M   FL +W
Sbjct: 455 KPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTVQYHM---FLFMW 507

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 36.6 bits (83), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS 185
           KP RS++  + N  V   DH+C W+ N +G  N+  F  F++S
Sbjct: 471 KPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILS 513

>KNAG0C06230 Chr3 complement(1208896..1211154) [2259 bp, 752 aa]
           {ON} Anc_5.626 YOR034C
          Length = 752

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 11/92 (11%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS-NIFSMCYAFLRLWYIS 201
           KP R K  S  +R VL  DH+C W+ N +G  N+ +F  +++S  +  +C+  L      
Sbjct: 467 KPLRCKFSSFHSRLVLRFDHYCPWVYNDVGLLNHKKFMYYVMSVGLGIVCFVKL------ 520

Query: 202 LNSTSTLPRAVLTLTILCGCFT--IICAIFTY 231
             S            + CG      +CA FTY
Sbjct: 521 --SMEFFDAFDDDDDVACGFLGDDELCAGFTY 550

>KNAG0B03140 Chr2 (604028..606076) [2049 bp, 682 aa] {ON} Anc_5.626
           YOR034C
          Length = 682

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 68/168 (40%), Gaps = 27/168 (16%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI-SNIFSMCYAF 194
           C    I KP R     +  + V   DH+C WI N +G  N+  +  FLI    F M +  
Sbjct: 405 CLKTWIRKPVRCSLSKLNQQQVARFDHYCAWIYNDVGLKNHKLYIFFLILLETFLMTFGV 464

Query: 195 LRLWYISLNSTSTLPRAVLTLTILCGCF------------TIICAIFT----YLQLAIVK 238
           L   Y  L    T    +   TI+C  +            TI  AIF      LQL  + 
Sbjct: 465 LNWRYFGL-MEKTAECFLFNRTIICHGYKNLKVVFLFLVWTIFQAIFVGNLLMLQLRKIA 523

Query: 239 EGMTTNEQDKWYTIQEYMREGKLVRSLDDDCPSWFFKCTEQK--DDAA 284
            G+TT E      ++E++R     RSL+    + +F   E    D++A
Sbjct: 524 YGITTFE---LVFLKEFVRN----RSLETKICNDYFDVREAAKCDESA 564

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           KP RSK+  + N  V   DH C WI N +G  N+  F  F++
Sbjct: 481 KPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

>TDEL0A04920 Chr1 complement(867970..870222) [2253 bp, 750 aa] {ON}
           Anc_5.626 YOR034C
          Length = 750

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL 183
           C    I KP RS+  S+    +   DH+C WI N +G  N+ +F  F+
Sbjct: 462 CIESWIRKPLRSRFSSLNGTLIARFDHYCPWIYNDVGLKNHKRFLYFV 509

>TBLA0J00830 Chr10 complement(187815..190034) [2220 bp, 739 aa] {ON}
           Anc_5.626 YOR034C
          Length = 739

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 60/139 (43%), Gaps = 18/139 (12%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFL------ISNIFS 189
           C    + KP RSK   +    V   DH+C W+ N IG  N+ +F +F+      I +   
Sbjct: 468 CLETWVRKPLRSKFSYLNQSVVNRYDHYCPWVYNDIGLRNHKRFIMFIFFSEVTIWSFVI 527

Query: 190 MCYAFLRLWYIS------LNSTSTLPRAVLT--LTILCGCFTIICAIFTY----LQLAIV 237
           +C+ +     +       L    ++ + VL    T+L   ++++  ++      +QL  +
Sbjct: 528 VCFEYFDELEVEEDAKCLLMGGGSVCKGVLKSRFTLLLMVWSMLQGVWVMFLICVQLFQM 587

Query: 238 KEGMTTNEQDKWYTIQEYM 256
             G+T NE +K     E M
Sbjct: 588 LRGITNNEFNKLANAHESM 606

>Suva_8.87 Chr8 complement(157531..159723) [2193 bp, 730 aa] {ON}
           YOR034C (REAL)
          Length = 730

 Score = 35.0 bits (79), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 27/56 (48%), Gaps = 3/56 (5%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLW 198
           KP RSK+       V   +H+C W+ N IG  N+  F  F  S  + M   FL +W
Sbjct: 438 KPLRSKYSLFSGALVARFNHYCPWVYNDIGLKNHKLFMFFAFSVQYEM---FLFMW 490

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 34.7 bits (78), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLW 198
           KP RSK        V   DH C W+ N IG  N+  F  F ++  + M   FL +W
Sbjct: 452 KPLRSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALTVQYHM---FLFMW 504

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 144 PARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRL 197
           P RSK+ +  N  +   DH+C W+ N IG  N+ + +LF I  +    + F+RL
Sbjct: 464 PLRSKYKTARNVLIARYDHYCPWVYNQIGFCNH-KIFLFFIMFLQIGVFIFVRL 516

>NCAS0C05280 Chr3 complement(1073710..1075983) [2274 bp, 757 aa]
           {ON} Anc_5.626
          Length = 757

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           C    I KP RS   ++    V   DH C WI N IG  N+  F  F++
Sbjct: 457 CLETWIRKPLRSHFSTLNTHNVARFDHFCPWIYNDIGLKNHKNFMWFIL 505

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 22/41 (53%)

Query: 144 PARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLI 184
           P RSK+       +   DH C W+ N IG  N+  FY+F++
Sbjct: 476 PLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVV 516

>KAFR0C05960 Chr3 complement(1187537..1189720) [2184 bp, 727 aa]
           {ON} Anc_5.626 YOR034C
          Length = 727

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 55/128 (42%), Gaps = 18/128 (14%)

Query: 136 CSTCRIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLIS-------NIF 188
           C T  + +P +S    +  + V   DH+C+W+ N I   N   F+  L++       +IF
Sbjct: 435 CLTTWVRRPFKSHISPLQKKRVAGFDHYCMWLYNDIALKNRKAFFYLLLALQILLYFHIF 494

Query: 189 SMCYAFLRLWYISLNSTSTLPRAVLT----------LTILCGCFTIICAIFTYL-QLAIV 237
                F  +   + NS S LP   L           L+++   F ++    +++ QL  V
Sbjct: 495 LCVSYFKSIQTAAWNSASILPFEALKQVLAENKKVLLSLIVATFQLLIVTNSFVCQLLTV 554

Query: 238 KEGMTTNE 245
            +G+T  E
Sbjct: 555 LQGLTIQE 562

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 1/42 (2%)

Query: 134 IKCSTCRIVKPARSKHCSICNRCVLVADHH-CIWINNCIGKG 174
           + CS C+  K    K    C+ CV + D   C ++N  +GKG
Sbjct: 11  VVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

>Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 1511
           aa] {ON} complement(6278..9313,9316..10815) [4536 nt,
           1512 aa]
          Length = 1511

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 265 LDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEIPNIYD 324
           + D  PS FF  +++  D A P  D   +  S N+YD+        I   ++     +Y+
Sbjct: 861 MQDLLPSEFFTSSKESQDLARPRNDSTFSNNSVNSYDN-----ASSIRSSNSHASQPMYE 915

Query: 325 KGTFLANLTDL 335
           + T +A+L  L
Sbjct: 916 QATGIASLASL 926

>AER388C Chr5 complement(1365604..1367778) [2175 bp, 724 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR264C
           (AKR1) and YOR034C (AKR2)
          Length = 724

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 144 PARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLF 182
           P R+K+    +  +L  DH+C WI N IG  N+  F  F
Sbjct: 456 PLRAKYKRFVHSVILRYDHYCPWIYNYIGFRNHKIFIYF 494

>Skud_15.199 Chr15 complement(354702..356927) [2226 bp, 741 aa] {ON}
           YOR034C (REAL)
          Length = 741

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 26/56 (46%), Gaps = 3/56 (5%)

Query: 143 KPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLW 198
           K  RSK+       V   DH+C WI N IG  N+     F ++  + M   FL +W
Sbjct: 449 KSLRSKYSVFSGALVARFDHYCPWIYNDIGLKNHKLSLFFAMTVQYHM---FLFMW 501

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.137    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,851,878
Number of extensions: 1270081
Number of successful extensions: 4297
Number of sequences better than 10.0: 129
Number of HSP's gapped: 4309
Number of HSP's successfully gapped: 139
Length of query: 336
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 226
Effective length of database: 40,868,139
Effective search space: 9236199414
Effective search space used: 9236199414
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)