Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR119W-A (COX26)8.273ON66663351e-42
Skud_4.3808.273ON66663194e-40
Smik_4.3648.273ON65653151e-39
Suva_2.2808.273ON66663063e-38
SAKL0H16786g8.273ON74681408e-13
CAGL0B01875g8.273ON74411191e-09
ZYRO0D06908g8.273ON77681191e-09
TBLA0F030308.273ON75571147e-09
NDAI0J012908.273ON75721103e-08
KLLA0F19371g8.273ON80631085e-08
Kpol_YGOB_YDR119W-A8.273ON75701077e-08
TDEL0F040008.273ON62641067e-08
TPHA0A017408.273ON79561051e-07
Ecym_42978.273ON7462931e-05
Kwal_YGOB_YDR119W-A8.273ON7466878e-05
KLTH0G13442g8.273ON7454834e-04
KNAG0H031708.273ON7158825e-04
KLLA0F19382gsingletonON7557780.002
KAFR0B054408.273ON6637670.060
NCAS0B037708.273ON6059600.61
NOTE: 1 genes in the same pillar as YDR119W-A were not hit in these BLAST results
LIST: KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR119W-A
         (66 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...   133   1e-42
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...   127   4e-40
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...   125   1e-39
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...   122   3e-38
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    59   8e-13
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    50   1e-09
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    50   1e-09
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    49   7e-09
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    47   3e-08
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    46   5e-08
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    46   7e-08
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    45   7e-08
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    45   1e-07
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    40   1e-05
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    38   8e-05
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    37   4e-04
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    36   5e-04
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    35   0.002
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    30   0.060
NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}       28   0.61 

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score =  133 bits (335), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 66/66 (100%), Positives = 66/66 (100%)

Query: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60

Query: 61 SKARKA 66
          SKARKA
Sbjct: 61 SKARKA 66

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score =  127 bits (319), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 60/66 (90%), Positives = 63/66 (95%)

Query: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          MFFSQVLRSSARAAPIKRYTGGR+GESWVITEGRRLIPE+ QWSA LS+CLGWPGAVYF 
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVLQWSAALSICLGWPGAVYFL 60

Query: 61 SKARKA 66
          SKARKA
Sbjct: 61 SKARKA 66

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score =  125 bits (315), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 59/65 (90%), Positives = 63/65 (96%)

Query: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          MFFS+VLRSSARAAPIKRYTGGR+GESWVITEGRRLIPE+FQWSA LS+CLGWP AVYFF
Sbjct: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60

Query: 61 SKARK 65
          SKARK
Sbjct: 61 SKARK 65

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score =  122 bits (306), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (93%)

Query: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          MFFSQVLRSSARAAPIKRYTGGR+GE+W+ITE RRLIPE+FQW AV+  CLGWPGAVYFF
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAVYFF 60

Query: 61 SKARKA 66
          SKARKA
Sbjct: 61 SKARKA 66

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 58.5 bits (140), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%), Gaps = 11/68 (16%)

Query: 1  MFFSQVLRSSA---RAAP--------IKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSV 49
          MF SQVLRS+A   R+A         + R + GR+GE W ITE +RL+P IF W A ++ 
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 50 CLGWPGAV 57
           LGWP AV
Sbjct: 61 VLGWPFAV 68

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 50.4 bits (119), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 28/41 (68%)

Query: 22 GRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFFSK 62
          GRIG SW I E +RL P +  W++ L+V LGWP  +YF+ K
Sbjct: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 50.4 bits (119), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 1  MFFSQVLRSSARAAP---IKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAV 57
          MFF+QVLR+SA +A     K+ +    GE W + E RRL     +W+  LS+ L WP A+
Sbjct: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60

Query: 58 YFFSKARK 65
            FS+  +
Sbjct: 61 IKFSEHNR 68

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 48.5 bits (114), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 1  MFFSQVLRSSARAAPI---KRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWP 54
          M F    RSSA  A +   + +T     ESW +TE +R++P I  W+ +LSV LGWP
Sbjct: 1  MLFQHAARSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWP 57

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 47.0 bits (110), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 8/72 (11%)

Query: 1  MFFSQVLRSSARAAPIKRY-TGGRI-------GESWVITEGRRLIPEIFQWSAVLSVCLG 52
          M F+ VL+ S R   ++++ T G         G  WV +E +R+ P I +WS  L V LG
Sbjct: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60

Query: 53 WPGAVYFFSKAR 64
          WP   Y++ K +
Sbjct: 61 WPAPFYYYHKIK 72

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 46.2 bits (108), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 1  MFFSQVLRSSARAA---------PIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCL 51
          MFF++ LRS+A  A              +G R+GE+W +TE RRL P I  +   +   L
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60

Query: 52 GWP 54
          GWP
Sbjct: 61 GWP 63

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 45.8 bits (107), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 2  FFSQVL-RSSARAAPIK--RYTG--------GRIGESWVITEGRRLIPEIFQWSAVLSVC 50
           FS++L R++AR   ++  RY          G IGESW +TE +R+ P I  W   L+  
Sbjct: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60

Query: 51 LGWPGAVYFF 60
          L WP  +Y +
Sbjct: 61 LSWPFIIYHY 70

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 45.4 bits (106), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          MF++QVLRS+A AA           +SW ++E +RL P I  W   L+ CLGWP A+  F
Sbjct: 1  MFYTQVLRSAAAAARATSRN--HNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHF 58

Query: 61 SKAR 64
            A 
Sbjct: 59 MSAN 62

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 45.1 bits (105), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 5  QVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60
          Q++R S+ AA  K      +GESW++TE +R+ P +  W + ++  L WP  + +F
Sbjct: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 40.4 bits (93), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 1  MFFSQVLR--SSARAAPIKRY------TGGRIGESWVITEGRRLIPEIFQWSAVLSVCLG 52
          M +S++L+  S+   +P+         T   IGE W++TE +RL+P I  W   ++  L 
Sbjct: 1  MLYSRILKAVSTIPKSPMSNIGARRAATSKHIGEPWMVTETKRLVPTILIWGGTMTGILL 60

Query: 53 WP 54
          WP
Sbjct: 61 WP 62

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 38.1 bits (87), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 31/66 (46%), Gaps = 12/66 (18%)

Query: 1  MFFSQVLRSSAR----AAPIKRYTGGRI--------GESWVITEGRRLIPEIFQWSAVLS 48
          M  SQ+LRS A     AA      G R+           W + E +R++P +  W+  ++
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 49 VCLGWP 54
          + LGWP
Sbjct: 61 IMLGWP 66

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 36.6 bits (83), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 29/54 (53%), Gaps = 3/54 (5%)

Query: 4  SQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAV 57
          SQV RS++R   + +    R    W + E +RL+P I  W A +   LGWP AV
Sbjct: 19 SQVSRSASRV--VLKGPSSR-ARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 36.2 bits (82), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 1  MFFSQVLRSSAR-AAPIK-RY--TGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWP 54
          MF SQV +S  R + PI  RY  +GGR+G  +  TE +R IP++  W + L + L WP
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWP 58

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 2  FFSQVLRSSARAAPIKR----YTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWP 54
           F ++LR+    A   R     +G  +GESW  +E RRL P +  ++  +   + WP
Sbjct: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWP 57

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 30.4 bits (67), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 11/37 (29%), Positives = 19/37 (51%)

Query: 23 RIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYF 59
           IG  ++  + ++ +  I  W   L V LGWP  +Y+
Sbjct: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

>NCAS0B03770 Chr2 complement(674509..674691) [183 bp, 60 aa] {ON}
          Length = 60

 Score = 27.7 bits (60), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 1  MFFSQVLRSSARAAP-------IKRYTGGRI-GESWVITEGRRLIPEIFQWSAVLSVCL 51
          M F+ +LR++AR A         + YT G + G  W+  E +R+ P +  W+++L   L
Sbjct: 1  MIFNTILRNTARRAGASSRQAFTRSYTVGPLTGVRWLKGEVKRVTPTLGVWASILITTL 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.138    0.450 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,092,974
Number of extensions: 171617
Number of successful extensions: 414
Number of sequences better than 10.0: 20
Number of HSP's gapped: 411
Number of HSP's successfully gapped: 20
Length of query: 66
Length of database: 53,481,399
Length adjustment: 39
Effective length of query: 27
Effective length of database: 49,009,425
Effective search space: 1323254475
Effective search space used: 1323254475
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)