Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR119W (VBA4)8.272ON76876838670.0
Smik_4.3638.272ON76576627050.0
Skud_4.3798.272ON75975926830.0
Suva_2.2798.272ON77577525240.0
TDEL0F039908.272ON6315495311e-57
SAKL0H16808g8.272ON6575004917e-52
ZYRO0C01430g8.272ON5904904869e-52
KLLA0A04631g8.272ON5795574594e-48
AGR076C8.272ON6865314564e-47
Kwal_26.6669singletonON5905144233e-43
TPHA0A017508.272ON6365534211e-42
Kwal_56.237548.272ON5895154153e-42
TBLA0F030408.272ON9065014162e-41
KLTH0G13464g8.272ON5935574049e-41
Kpol_543.448.272ON6435104061e-40
Ecym_42988.272ON6785103047e-28
NDAI0J012808.272ON6947702832e-25
Ecym_73992.473ON5631671413e-08
NCAS0B037808.272ON5894291352e-07
NDAI0H022002.473ON5711591333e-07
CAGL0J01375g2.473ON5641641324e-07
NCAS0A078102.473ON5682021324e-07
KLLA0F17776gna 1ON5534351314e-07
Skud_13.2442.473ON5621721307e-07
Kpol_467.242.473ON3701871261e-06
YMR088C (VBA1)2.473ON5621721253e-06
Suva_13.2652.473ON5611581234e-06
Smik_13.2722.473ON5611721201e-05
SAKL0C02178gsingletonON5652171182e-05
YPR198W (SGE1)singletonON5431491172e-05
KLTH0D05434g2.473ON5761761145e-05
Smik_17.11singletonON5441491137e-05
KLLA0F13684g2.473ON5711581137e-05
Skud_16.503singletonON5431491092e-04
KLTH0H05456gna 2ON5681641074e-04
KLLA0D19941gsingletonON6111911020.001
NCAS0C03460na 3ON630264970.006
Smik_16.81na 3ON625155960.008
SAKL0E04246gna 1ON565330940.012
KNAG0E025602.473ON578169940.013
SAKL0A00726gsingletonON598177930.015
KLLA0E09879gsingletonON630152930.017
TDEL0A024902.473ON554160920.024
Kwal_14.728singletonON568185910.027
KAFR0B054508.272ON625398910.028
TPHA0G031502.473ON600159900.034
YKR105C (VBA5)singletonON582155900.038
KLTH0D16962gsingletonON571229890.057
SAKL0C05588gsingletonON677202890.060
Skud_7.560na 3ON642149880.070
Kwal_14.1585na 2ON570159880.075
ABL040W2.473ON567176870.097
KLTH0B10142gsingletonON568157860.13
KLTH0E06138g4.30ON614187860.13
YGR224W (AZR1)na 3ON613149850.15
KLTH0B00132gsingletonON568157850.15
CAGL0B02079gna 3ON624162850.15
SAKL0B12716gsingletonON632155840.21
TDEL0G03260singletonON612155830.24
SAKL0E02992g2.473ON570207830.29
KLTH0C10142gsingletonON573203820.33
TBLA0A03700singletonON572142800.58
ZYRO0G21868gna 2ON620183790.83
Kwal_26.9616singletonON562164790.88
TBLA0A03400singletonON574143780.99
KLTH0B00594gsingletonON618193771.2
Kwal_26.77552.473ON559176771.5
KNAG0H031808.272ON67773771.6
Kwal_55.206864.30ON61390761.7
ZYRO0G03234g2.473ON562160762.0
TBLA0A03460singletonON568141752.2
TBLA0D052301.322ON39756742.4
SAKL0F00198gsingletonON537155752.5
SAKL0G19426g2.652ON24078733.0
TDEL0C00120singletonON569220743.1
KAFR0G015803.323ON83937743.3
TBLA0B00840singletonON637141734.0
KLLA0F18106g4.30ON589148716.3
YOR092W (ECM3)2.192ON613103709.0
KNAG0K01020singletonON599737010.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR119W
         (768 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protei...  1494   0.0  
Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W ...  1046   0.0  
Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W ...  1038   0.0  
Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W ...   976   0.0  
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...   209   1e-57
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...   193   7e-52
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...   191   9e-52
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...   181   4e-48
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...   180   4e-47
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...   167   3e-43
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...   166   1e-42
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...   164   3e-42
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...   164   2e-41
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...   160   9e-41
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...   160   1e-40
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...   121   7e-28
NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8....   113   2e-25
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    59   3e-08
NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {O...    57   2e-07
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    56   3e-07
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    55   4e-07
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    55   4e-07
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    55   4e-07
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    55   7e-07
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    53   1e-06
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    53   3e-06
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    52   4e-06
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    51   1e-05
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    50   2e-05
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    50   2e-05
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    49   5e-05
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    48   7e-05
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    48   7e-05
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    47   2e-04
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    46   4e-04
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    44   0.001
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    42   0.006
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    42   0.008
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    41   0.012
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    41   0.013
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    40   0.015
KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {...    40   0.017
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    40   0.024
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    40   0.027
KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa] ...    40   0.028
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    39   0.034
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.038
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    39   0.057
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    39   0.060
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    39   0.070
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    39   0.075
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    38   0.097
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    38   0.13 
KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} simila...    38   0.13 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.15 
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    37   0.15 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    37   0.15 
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    37   0.21 
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               37   0.24 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    37   0.29 
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    36   0.33 
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               35   0.58 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    35   0.83 
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    35   0.88 
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    35   0.99 
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    34   1.2  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    34   1.5  
KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {O...    34   1.6  
Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028...    34   1.7  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    34   2.0  
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     33   2.2  
TBLA0D05230 Chr4 complement(1285787..1286980) [1194 bp, 397 aa] ...    33   2.4  
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    33   2.5  
SAKL0G19426g Chr7 complement(1670664..1671386) [723 bp, 240 aa] ...    33   3.0  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         33   3.1  
KAFR0G01580 Chr7 complement(348320..350839) [2520 bp, 839 aa] {O...    33   3.3  
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    33   4.0  
KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} simi...    32   6.3  
YOR092W Chr15 (495127..496968) [1842 bp, 613 aa] {ON}  ECM3Non-e...    32   9.0  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    32   10.0 

>YDR119W Chr4 (688227..690533) [2307 bp, 768 aa] {ON}  VBA4Protein
           of unknown function with proposed role as a basic amino
           acid permease based on phylogeny; GFP-fusion protein
           localizes to vacuolar membrane; physical interaction
           with Atg27p suggests a possible role in autophagy;
           non-essential gene
          Length = 768

 Score = 1494 bits (3867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/768 (95%), Positives = 730/768 (95%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60

Query: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120
           NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL
Sbjct: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120

Query: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180
           KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV
Sbjct: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180

Query: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE 240
           VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE
Sbjct: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE 240

Query: 241 LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG 300
           LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG
Sbjct: 241 LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG 300

Query: 301 QXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST 360
           Q                CIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST
Sbjct: 301 QLVFLKLSLISSVKLLLCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST 360

Query: 361 IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS 420
           IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS
Sbjct: 361 IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS 420

Query: 421 IMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLKN 480
           IMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEI          VQVTSLDLTGLKN
Sbjct: 421 IMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEILTLTLFLLCFVQVTSLDLTGLKN 480

Query: 481 NTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCI 540
           NTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCI
Sbjct: 481 NTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCI 540

Query: 541 IPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLL 600
           IPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLL
Sbjct: 541 IPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLL 600

Query: 601 LYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGA 660
           LYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGA
Sbjct: 601 LYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGA 660

Query: 661 VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKF 720
           VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKF
Sbjct: 661 VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKF 720

Query: 721 VFQTLIECYLQACRNVFKLSTLXXXXXXXXXXXXNRIHCRSQNCLSLS 768
           VFQTLIECYLQACRNVFKLSTL            NRIHCRSQNCLSLS
Sbjct: 721 VFQTLIECYLQACRNVFKLSTLFFTITVVAIFIFNRIHCRSQNCLSLS 768

>Smik_4.363 Chr4 (649481..651778) [2298 bp, 765 aa] {ON} YDR119W
           (REAL)
          Length = 765

 Score = 1046 bits (2705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/766 (67%), Positives = 596/766 (77%), Gaps = 9/766 (1%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEIN- 59
           MGKKDRQRKKLREFAKLKNRQRNL++SVQ LK EVQ++A      + + L NDK EEIN 
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQRNLKESVQNLKKEVQQKAVCSEHLDLVQLENDKSEEIND 60

Query: 60  ------ENSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPAD 113
                 EN PLLS    Q+E  + K  D+DTI+  PLH   K DDS Q E +  + K  +
Sbjct: 61  ESEEINENVPLLSTHGGQKEEKVSKVPDVDTINTHPLHSS-KNDDSHQTEADCAERKSGN 119

Query: 114 KANEDDLKPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFE 173
           K + D  K  SQ E      LQSS+TDF+DRS+SPLQSITS NTPMSEHELP SS+NS E
Sbjct: 120 KTDHDYPKSLSQDEPGIKLPLQSSMTDFTDRSISPLQSITSNNTPMSEHELPASSTNSLE 179

Query: 174 RADDMPVVQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYV 233
           R D+MP+VQ  +Q  + + L + A  PEVP    ++  YGYGSI ++I DVE+G NP YV
Sbjct: 180 RGDNMPIVQPSSQIPTGQILSMAASPPEVPGGRAQMDPYGYGSISRTIEDVESGANPTYV 239

Query: 234 ENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAY 293
            N+SSDELVHDLTR+RIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVIS Y
Sbjct: 240 ANSSSDELVHDLTRKRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISVY 299

Query: 294 LLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGS 353
           LL NAIGQ                C+AQFSFILG YLSWSS HFWTFI AR VTGFG GS
Sbjct: 300 LLGNAIGQLMFLKLSLVSGVKLLLCVAQFSFILGSYLSWSSIHFWTFILARSVTGFGSGS 359

Query: 354 LIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
           LIALKSTIMNRFSQKN+++Y LS SM  F++GV +GPF+++ FDSSHGSGW+NAFLIPVP
Sbjct: 360 LIALKSTIMNRFSQKNENQYPLSTSMTVFSLGVAVGPFLVSFFDSSHGSGWKNAFLIPVP 419

Query: 414 FCLVNASIMLADMYSVKSTLYGR-PTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTS 472
           FCLVNASIMLAD+YSVK+T++   PT TL KRFK  L SPDLYEI          VQ TS
Sbjct: 420 FCLVNASIMLADIYSVKNTIHHEGPTTTLQKRFKKVLWSPDLYEILTLALFLLCFVQATS 479

Query: 473 LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISF 532
           LD T L+++TMIQ ++FSVII+CG+LFF+IE SD  MNSV S+SLQGDK LIWTM+GI F
Sbjct: 480 LDSTRLEHSTMIQEIIFSVIIICGVLFFVIEKSDVRMNSVFSLSLQGDKHLIWTMMGIFF 539

Query: 533 CFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKF 592
           CFAALMCIIPFGTTYF+IVLNL TL++AERL PFFFSIV+GYFSV YFW S+ QN+L KF
Sbjct: 540 CFAALMCIIPFGTTYFMIVLNLDTLEIAERLLPFFFSIVVGYFSVCYFWNSERQNYLFKF 599

Query: 593 VLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISG 652
           VLSG TLLLYVALMG++L+L VWKQY CLSLP LGSSMILTLLS LYHEYH QRKSPISG
Sbjct: 600 VLSGVTLLLYVALMGMNLSLSVWKQYTCLSLPLLGSSMILTLLSTLYHEYHVQRKSPISG 659

Query: 653 SIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDW 712
           SI YCF A+GGT+G+S  GYVFHKTL++ M+E+VM FSKQGYLKKDL KIIKHAT+SS+W
Sbjct: 660 SIAYCFAAMGGTIGVSSAGYVFHKTLVRTMNEEVMKFSKQGYLKKDLFKIIKHATQSSNW 719

Query: 713 VHESAPKFVFQTLIECYLQACRNVFKLSTLXXXXXXXXXXXXNRIH 758
           VH+SAPKF+F+TLIECYLQACRNVFKLS L            NRIH
Sbjct: 720 VHKSAPKFIFRTLIECYLQACRNVFKLSALFFTITVVTLFFFNRIH 765

>Skud_4.379 Chr4 (659832..662111) [2280 bp, 759 aa] {ON} YDR119W
           (REAL)
          Length = 759

 Score = 1038 bits (2683), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/759 (69%), Positives = 604/759 (79%), Gaps = 1/759 (0%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           MGKKDRQRKKLREFAKLKNRQ+ L+ SVQ LKNEVQRE       N IA+ NDK EE  E
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQKLQNSVQNLKNEVQREVGESENPNPIAIENDKSEENKE 60

Query: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120
           N+PLL   S++ E    K +DIDT D +P  E  K  +  Q E + ++GK  DKA++D  
Sbjct: 61  NTPLLLTSSERREDDGSKPLDIDTFDTRPFQERSKSGNPVQAEGDDMEGKSEDKADQDHH 120

Query: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180
           K  SQ E+   S LQ+S+ DFSDRS+SPLQSITS +T MSE ELP SS+NS E   D+ V
Sbjct: 121 KFLSQDESGTKSPLQNSMIDFSDRSISPLQSITSDHTQMSERELPGSSTNSLEGNGDIHV 180

Query: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDE 240
            Q++++  +SK+L     +P VPVS  EI+ YGYGSI Q+I DVE+  +P Y+ +TSSD 
Sbjct: 181 AQSESERPTSKTLATATSAPAVPVSRAEISPYGYGSISQTIEDVEDETDPSYIASTSSDA 240

Query: 241 LVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIG 300
            VH  TRRRIFSSCMCTYLFFIAMDSSI+LVI SKIASEFHELWRLSL++S YLLSNAIG
Sbjct: 241 FVHQETRRRIFSSCMCTYLFFIAMDSSILLVIVSKIASEFHELWRLSLIVSVYLLSNAIG 300

Query: 301 QXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKST 360
           Q                C+AQFSFILG YLSWSS+HFWTFIFAR V GFG GSLIALKST
Sbjct: 301 QLLFLKLSIISSVKLLLCMAQFSFILGSYLSWSSSHFWTFIFARFVAGFGSGSLIALKST 360

Query: 361 IMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNAS 420
           IMNRFSQKN+SRYSLSAS+I F++GV IGPF++ LFDSSHGSGW+NAFLIPVPFCLVNAS
Sbjct: 361 IMNRFSQKNESRYSLSASVIIFSLGVAIGPFVVGLFDSSHGSGWKNAFLIPVPFCLVNAS 420

Query: 421 IMLADMYSVKSTLYGR-PTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLK 479
           IMLAD+YSVK  L+    T TLWKR K  LLSPDLYEI          VQVT+LDLT L+
Sbjct: 421 IMLADIYSVKDNLHHEGSTFTLWKRVKKILLSPDLYEILTLTLFLLCFVQVTTLDLTELE 480

Query: 480 NNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMC 539
           + TMIQ +LFSVI++CG+LF+LIE +DTYMNSVISMSLQGDKRLIWT+ GISFCF+ALMC
Sbjct: 481 HRTMIQWVLFSVILICGVLFWLIEANDTYMNSVISMSLQGDKRLIWTVTGISFCFSALMC 540

Query: 540 IIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATL 599
           IIPFGTTYF IVLNL+TLQ+AERL PFFFSIV+GYFSV YFWKSK QN+LLKFVLSG TL
Sbjct: 541 IIPFGTTYFTIVLNLNTLQIAERLLPFFFSIVIGYFSVCYFWKSKKQNYLLKFVLSGVTL 600

Query: 600 LLYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYHEQRKSPISGSIVYCFG 659
           +LY+ LMGV L+LPVWKQY+CLSLPFLGSSM+LTLLS+LYHEYHEQRKS  SGSIVYCFG
Sbjct: 601 ILYITLMGVGLSLPVWKQYVCLSLPFLGSSMLLTLLSSLYHEYHEQRKSLNSGSIVYCFG 660

Query: 660 AVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPK 719
           A+GGT+GISLGGYVFHKTL K +HE+VM FSKQGYLKKDLLKIIKHATESSDWVHESAPK
Sbjct: 661 AIGGTIGISLGGYVFHKTLTKSLHEEVMKFSKQGYLKKDLLKIIKHATESSDWVHESAPK 720

Query: 720 FVFQTLIECYLQACRNVFKLSTLXXXXXXXXXXXXNRIH 758
           F+F+TLIECYLQACRNVFKLS +            N+I+
Sbjct: 721 FIFKTLIECYLQACRNVFKLSAVFFTIMVISMFFFNKIN 759

>Suva_2.279 Chr2 (482935..485262) [2328 bp, 775 aa] {ON} YDR119W
           (REAL)
          Length = 775

 Score =  976 bits (2524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/775 (62%), Positives = 587/775 (75%), Gaps = 17/775 (2%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           MGKKDRQRKKLREFAKLKNRQ+NLRKSVQ+LK EVQR++  P   N+I  GN K EE +E
Sbjct: 1   MGKKDRQRKKLREFAKLKNRQQNLRKSVQSLKKEVQRKSVAPENLNRIVFGNLKREEASE 60

Query: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120
           NSPLL APS+  E S PK ++I+  D + L E P+   S + E + I+GK A+ ANE+  
Sbjct: 61  NSPLLPAPSEPREGSGPKTLNINANDTRSLPELPENSTSVETESDDIEGKLAENANEEPP 120

Query: 121 K------PP---SQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNS 171
           K      PP   S+ E    S  Q+S++DFSDRSVSPLQSITS NTPMS HE+P S +N+
Sbjct: 121 KFLSQEEPPKFLSREEPGKKSPSQNSVSDFSDRSVSPLQSITSDNTPMSVHEVPESLANA 180

Query: 172 FERADDMPVVQADNQTSSSKSLHI-------VAPSPEVPVSGDEITSYGYGSIPQSIGDV 224
            E   D+ V Q D+   +  +L            +PEV V   ++ +Y YGSI +++ DV
Sbjct: 181 LEGNGDIVVAQLDSCVPAINALPTSDLSPTSATSAPEVLVDRPQMRAYEYGSISRTVKDV 240

Query: 225 ENGLNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELW 284
           ENG    Y    SSD+ VHDLTRRRIFSSCMCTYLFFIAMDS+I++ I SKIASEFHELW
Sbjct: 241 ENGTTSSYARVASSDKFVHDLTRRRIFSSCMCTYLFFIAMDSTILMSIVSKIASEFHELW 300

Query: 285 RLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFAR 344
           RLSL+IS YLLSNAIGQ                C+AQFSFILG YLSWS+ HFWTF+FAR
Sbjct: 301 RLSLIISIYLLSNAIGQLVFLKLSIVTSVKLLLCVAQFSFILGSYLSWSAFHFWTFVFAR 360

Query: 345 CVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGW 404
            +TGFG G+L+ALKSTIMNRFS K  + YSLSAS+I F++GV IGPF++ LFD+S GSGW
Sbjct: 361 SITGFGSGALMALKSTIMNRFSDKKKNGYSLSASVIVFSLGVAIGPFLVYLFDNSRGSGW 420

Query: 405 RNAFLIPVPFCLVNASIMLADMYSVKSTLY-GRPTPTLWKRFKNTLLSPDLYEIXXXXXX 463
           +NAFLIPVPFCLVNASIMLAD+YS+K  L+ G   P  WKR K  L+SPDLYEI      
Sbjct: 421 KNAFLIPVPFCLVNASIMLADIYSIKDNLHHGGSAPISWKRIKKILMSPDLYEILTLALL 480

Query: 464 XXXXVQVTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRL 523
               VQVTSLD+T L+++ +IQ +LF VII CGILF+ IET++TY NS+ISMSL+GDK L
Sbjct: 481 LLCFVQVTSLDITRLEHSAVIQGVLFFVIITCGILFWWIETNETYANSIISMSLRGDKHL 540

Query: 524 IWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKS 583
           +WT++GISFCFAALMCIIPFGTTYF IVLN+STLQ+AERL P   +IV+GYFSV YFWK 
Sbjct: 541 MWTIMGISFCFAALMCIIPFGTTYFTIVLNISTLQIAERLLPLSVAIVVGYFSVCYFWKP 600

Query: 584 KGQNFLLKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGSSMILTLLSNLYHEYH 643
           + +N+LL+ VL G TL+LY+ALMG SL+LPVWKQY+CLSLP LGS+MILTLLS+LYHEYH
Sbjct: 601 QMKNYLLEVVLGGVTLILYIALMGASLSLPVWKQYVCLSLPLLGSAMILTLLSSLYHEYH 660

Query: 644 EQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKII 703
           + +KSPISGSIVYCF A+GGT+GISLGGYVFHKTL+K +H+ VM FSK GY +KDLLKII
Sbjct: 661 QPKKSPISGSIVYCFSAMGGTIGISLGGYVFHKTLLKAVHDGVMKFSKHGYHEKDLLKII 720

Query: 704 KHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTLXXXXXXXXXXXXNRIH 758
           +HAT+SSDWVHESAPKF+FQTLIECYLQACRNVFKLS +            NR++
Sbjct: 721 EHATQSSDWVHESAPKFIFQTLIECYLQACRNVFKLSAILFTITVMTMFFFNRVN 775

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score =  209 bits (531), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 150/549 (27%), Positives = 263/549 (47%), Gaps = 24/549 (4%)

Query: 198 PSPEVP------VSGDEITSYGYGSIPQSIGDVENGLNPPYVENTSSDELVHDLTRRRIF 251
           PS ++P      +   E  + GYGSI     D  +G N      ++++E+     R R+ 
Sbjct: 60  PSTDLPGFVAEEIGQQEEVANGYGSIT----DPHDGDNKSERPVSTAEEISG--ARLRVI 113

Query: 252 SSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXX 311
              M   +F  A+D++I+   ++ +ASEF++L ++S + ++YLLS+A  Q          
Sbjct: 114 MLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGKVSDIF 173

Query: 312 XXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRFSQKND 370
                      +F++G  +   S  FW  + AR V G GGG L ++ S TI +    +  
Sbjct: 174 GRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAGVGGGGLTSMSSITITDLVPLRER 233

Query: 371 SRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVK 430
           + Y      + + +G   G  +   F  + G GWR AFLI VP   ++  +++  +    
Sbjct: 234 AMYQ-GICNVFYGLGTACGGIVGGWFSDNKG-GWRMAFLIQVPLSAISLLVIILHLKLPS 291

Query: 431 STLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLKNNTMIQALLFS 490
                R T       K  LL+ D              +   SL    +   +   AL+  
Sbjct: 292 K----RATRNQDNSIKRKLLAIDWLGASTLVIFLVLFLLTASLGGKEIAYGSRTFALMLI 347

Query: 491 VIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFII 550
             ++  ++F  +E      + ++ +     + ++ + +   FC  A M    +   YF  
Sbjct: 348 SSLLSCLVFIYVELR-VAADPILPLRFLAIRSVLGSSLSNWFCMMATMTTSYYLPIYFSG 406

Query: 551 VLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSL 610
           VLN+S   + +RL P FFS+  G     Y+ K   + +    +     +L  + ++ +  
Sbjct: 407 VLNMSPTDVGKRLMPNFFSVAFGSLGAGYYMKKTRKYYWFSLIFCAVAVLGQLQILLIDP 466

Query: 611 NLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGIS 668
            +P W+QYI L +P +G+S+++T  LL+ +    HE + +  + SI Y F + G T+G+S
Sbjct: 467 KIPTWRQYILLLVPGVGTSVLITVALLAMIAAVPHEHQAA--TTSISYAFRSAGCTLGVS 524

Query: 669 LGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIEC 728
           +GG +F ++L KL    V+ +  + + K++LLKII  A+ESS+WVH SAP F+ QTL+EC
Sbjct: 525 IGGAIFRESLSKLTTRYVLRYISKEHPKEELLKIIDKASESSEWVHHSAPDFIRQTLLEC 584

Query: 729 YLQACRNVF 737
           Y +AC+N F
Sbjct: 585 YHKACKNTF 593

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 28/137 (20%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           MGKKD+QR KLREF     RQ+ L+++ +    E  R    P ++  I           E
Sbjct: 1   MGKKDKQRNKLREF----TRQKQLQQAKKNDMLEETRPLVAPSSAEPI-----------E 45

Query: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120
            S LL  P K E +  P + D+    A+ + +        Q+EV +  G   D  + D+ 
Sbjct: 46  ASLLL--PIKPEILQDP-STDLPGFVAEEIGQ--------QEEVANGYGSITDPHDGDNK 94

Query: 121 --KPPSQHEACGNSALQ 135
             +P S  E    + L+
Sbjct: 95  SERPVSTAEEISGARLR 111

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score =  193 bits (491), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 144/500 (28%), Positives = 236/500 (47%), Gaps = 14/500 (2%)

Query: 246 TRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXX 305
            R +I    M   +F  ++D++I+  + + IASEF+E+  +S + +AYLLS+A  Q    
Sbjct: 126 ARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISWIATAYLLSSATFQPLYG 185

Query: 306 XXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNR 364
                         +   F LG  +   S   W  +  R + G GGG L ++ S T  + 
Sbjct: 186 KISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAGIGGGGLTSMSSITTSDI 245

Query: 365 FSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLA 424
              +N + Y    +   F +G   G  +   F S HG GWR AFLI +P C ++ S+++A
Sbjct: 246 VPLRNRALYQGICNFF-FGLGTACGGLVGGWF-SEHGGGWRVAFLIQIPLCAISCSLIVA 303

Query: 425 DMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLKNNTMI 484
            +   K             +    L   D +            +  +SL    L   +  
Sbjct: 304 YLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLVVFLLLFMLASSLGGKELPFQSNG 363

Query: 485 QALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFG 544
              L   I+V G  F  +ET  +  + ++ ++   ++ ++ + +   F    +M    F 
Sbjct: 364 FYALCVAIVVGGATFVYVETYVS-KDPILPVAFLKNRTILGSSLANWFSMMGMMTTSYFL 422

Query: 545 TTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVA 604
             Y+  VLN+    + +R  P FFS  LG     Y+ K  G+    K++L     L  V 
Sbjct: 423 PVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGAGYYMKKTGK---YKWLLMAFCALAVVG 479

Query: 605 LMGVSL---NLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKSPISGSIVYCFG 659
            + +SL   N+ VW+QYI L +P  G S+++T  LL+ +    HE + +  + SI Y F 
Sbjct: 480 QLQISLIEPNIAVWRQYILLVIPGFGLSVLITVTLLAMIAAVPHEHQAA--TTSISYAFR 537

Query: 660 AVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPK 719
           + G T+G+S+GG +F K+L  L+   VM  +   + +++L KII  A  SSD++H+SAP+
Sbjct: 538 STGCTLGVSIGGAIFRKSLGSLLERNVMKLASDKHPREELAKIIDSAAHSSDYIHDSAPE 597

Query: 720 FVFQTLIECYLQACRNVFKL 739
           FV Q LIE Y  ACRN +K 
Sbjct: 598 FVRQALIESYHFACRNTYKF 617

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 17/21 (80%)

Query: 4  KDRQRKKLREFAKLKNRQRNL 24
          K++QRKKL+ F KLK RQR L
Sbjct: 8  KNKQRKKLQAFVKLKERQRQL 28

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score =  191 bits (486), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 139/490 (28%), Positives = 239/490 (48%), Gaps = 19/490 (3%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           +F  A D +++  I + IASEF+EL R+S + +AYLLS+A  Q                 
Sbjct: 89  IFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLM 148

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
           +    F++G  +   +  FW  + AR ++G GGG + ++ S  ++      D        
Sbjct: 149 LNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSITISDIVPLRDRALYQGMC 208

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPT 438
              F +G   G  +   F S HG GWR AFLI VP   + +S+++A    +        +
Sbjct: 209 NFFFGLGTACGGVVGGWF-SDHGGGWRMAFLIQVPLSAL-SSLLIAVFMKLPPRSKRVNS 266

Query: 439 PTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLK-NNTMIQALLFSVIIVCGI 497
           P      KN LLS D              +   SL    +  N+    AL     + C  
Sbjct: 267 PA---SIKNKLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACA- 322

Query: 498 LFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTL 557
            FF+        + ++ +S   ++ ++ +     FC  A+M    +   Y+  VLN++  
Sbjct: 323 -FFIGVELYGAKDPILPLSFLRNRSVLGSSFSNWFCMMAMMTTSYYLPIYYSGVLNMNPT 381

Query: 558 QLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSLNLPVWKQ 617
           ++ +RL P FFS  LG     Y+ K  G+ + L       +LL ++ +  +  ++  W+Q
Sbjct: 382 RVGKRLMPNFFSTALGSLGAGYYMKRTGKYYWLTVGFCTLSLLGHLQINLMKPDIATWRQ 441

Query: 618 YICLSLPFLGSSMILT-----LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGY 672
           +I L +P  G S+++T     +++ + H +H       + SI Y F + G T+G+S+GG 
Sbjct: 442 FILLVIPGFGYSVLITVALLAMIAAVPHNHHAA-----TTSISYAFRSTGSTLGVSIGGA 496

Query: 673 VFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQA 732
           +F ++L  L+  KV+ F+ + + +K+LL+II+ A++SS+WVH+SAP+F+  TLI CY  A
Sbjct: 497 IFRQSLNGLLSRKVLKFADK-HPRKELLEIIEKASKSSEWVHDSAPEFIRPTLIGCYHFA 555

Query: 733 CRNVFKLSTL 742
           C++ F   TL
Sbjct: 556 CKDTFLFCTL 565

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score =  181 bits (459), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 159/557 (28%), Positives = 253/557 (45%), Gaps = 52/557 (9%)

Query: 224 VENGLNPPYVEN----------------TSSDEL-----VHDLTRRR--IFSSCMCTYLF 260
           V N LNP   E                  S DE      V +++R R  I  S MC   F
Sbjct: 13  VRNALNPELSEGLPAYVGAEVAETEHLLESEDEAREGLQVSEMSRARLHIIISSMCLGSF 72

Query: 261 FIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIA 320
             A+D++I+  + S IASEF+EL  +S + +AYLLS+A  Q                 I+
Sbjct: 73  LAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIIS 132

Query: 321 QFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMI 380
              FILG  +   S + WT +  R + G GGG + +L S   +       SR        
Sbjct: 133 NLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLR-SRALYQGIFN 191

Query: 381 TFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIML---------ADMYSVKS 431
            F    +    ++  + S   +GWR AFL+ VP C ++  +++           +  V +
Sbjct: 192 FFFGLGIAIGGLIGGWFSESKNGWRMAFLVQVPLCAISLVLIIIFLKLPPGCKGLGLVSN 251

Query: 432 TLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLKNNTMIQALLFSV 491
              G+         K+ L   D              +  +SL    +  N+ I  LL   
Sbjct: 252 DKDGKVD------IKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVA 305

Query: 492 IIVCGILFFLIE--TSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFI 549
            I+ G  F  +E   SD   + ++ +    ++ ++       FC  + + +  +   Y+ 
Sbjct: 306 TILSGTAFIYVELYISD---DPILPIRFLTNRSILGASFANWFCMMSGVTLAFYVPVYWS 362

Query: 550 IVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ--NFLLKFVLSGATLLLYVALMG 607
            V NL    + +R++P FFS   G     Y+ K  G+   FLLKF  +G  +L  + ++ 
Sbjct: 363 SVQNLKPTDMGKRIAPNFFSTAFGSIGAGYYMKKTGRYYGFLLKF--TGLMVLGQLQVLL 420

Query: 608 VSLNLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTV 665
           +  ++  W+QYI L LP  GSS+++T  LL+ +    HE + +  + SI Y F + G T+
Sbjct: 421 MKPDISTWRQYILLPLPHFGSSVLITVTLLAMIAAVPHEHQAA--TTSISYAFRSTGSTL 478

Query: 666 GISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTL 725
           G+S+G  +F   L   + + VM F    Y K+ LL IIK A+ESS++VH +APKF+  TL
Sbjct: 479 GVSVGAALFRNKLSGSLFDSVMKFESDKYSKEYLLSIIKQASESSEYVHANAPKFIQATL 538

Query: 726 IECYLQACRNVFKLSTL 742
           I+CY QAC++ F    L
Sbjct: 539 IQCYEQACKSTFAFCFL 555

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score =  180 bits (456), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 141/531 (26%), Positives = 224/531 (42%), Gaps = 48/531 (9%)

Query: 228 LNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLS 287
           L    VE    D      TRRR+  + MC  +F  A+D +I+  +   IASEF+EL R+S
Sbjct: 119 LTATAVEAAKEDAGGLGATRRRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRIS 178

Query: 288 LVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVT 347
            + +AYLLS+A  Q                  +   F LG  +   S + W  +  R V 
Sbjct: 179 WIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVA 238

Query: 348 GFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNA 407
           G GGG L ++ S                    + F +G   G  +  LF +    GWR A
Sbjct: 239 GIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTACGGLVGGLF-ADRAVGWRMA 297

Query: 408 FLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXX 467
           FL+ VP  L++ + +      +  TL   P P    +       P               
Sbjct: 298 FLVQVPLTLLSTTAI-----QLFLTL---PKPVDAHKGAGQRSIP--------------- 334

Query: 468 VQVTSLDLTGLKNNTMIQALLFSVIIVCGI----------LFFLIETSDTYM-------- 509
              T L +        +   LF   +VC +          +F +I  S +Y         
Sbjct: 335 -WTTKLRMVDWTGTVTLVVFLFCFTLVCSLYGEDLPHLYLIFVVILLSGSYFIYHELYVA 393

Query: 510 -NSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFF 568
            + ++ +    ++ ++   +   FC   +M    +   Y+  VLN+    + +R+ P FF
Sbjct: 394 TDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVPSFF 453

Query: 569 SIVLGYFSVSYFWKSKGQN--FLLKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFL 626
           S   G     Y+ K  G+   FLL F L G  +L  V +  V+ ++  W+QY    +P  
Sbjct: 454 STAFGSLGAGYYMKRTGKYYWFLLAFCLVG--VLGQVQISYVTPSISTWRQYCLYMIPGF 511

Query: 627 GSSMILTLLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKV 686
           GS+++LT+          QR    + SI Y F + G T+G+S+GG +F   L   ++ K+
Sbjct: 512 GSAVLLTVTLLALIVAVPQRHQAATTSISYAFRSTGSTLGVSIGGAIFRNGLSNQLYSKL 571

Query: 687 MPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVF 737
           MP     +   +LL+II+ A  S++WVH+ AP+F    LI+CY  A R  F
Sbjct: 572 MPLQSPEHPASELLRIIEKAAHSTEWVHKEAPEFARHILIDCYHYAGRYTF 622

 Score = 38.1 bits (87), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 2  GKKDRQRKKLREFAKLKNRQRNLRKSVQT-LKNEVQ--REAKVPRTSNQIAL 50
          G K +QR +LREFAK K RQR L    Q  +  + Q  R    PR   Q  L
Sbjct: 7  GLKTKQRDRLREFAKRKERQRALAGQNQAGVGQDAQPARRQHRPRAGEQSGL 58

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score =  167 bits (423), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 139/514 (27%), Positives = 241/514 (46%), Gaps = 22/514 (4%)

Query: 237 SSDELVHDLTRRRIF--SSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYL 294
           SS+ L  DL  RRIF  S+ M   +F  A+D++I+  +   I SE +++  +SLV ++Y+
Sbjct: 68  SSNNL-SDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYV 126

Query: 295 LSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSL 354
            S AI Q                  +   F  G      S   W  I  R VTG GGG L
Sbjct: 127 FSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGL 186

Query: 355 IALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPF 414
            ++ + I+N      +         + +A+G   G  +  LF S +G+GWR AF+I +PF
Sbjct: 187 TSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLF-SEYGNGWRMAFMIQLPF 245

Query: 415 CLVN--ASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTS 472
           C ++  + I+  D+   K  L GR +     R  +  L                 +    
Sbjct: 246 CFLSTISIIVYLDLSDDKQDL-GRSSLYCKLRLID-WLGALTLVTFLLLFLVTMTIGGQH 303

Query: 473 LDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISF 532
           +    L+   +  A+  S + +  +  FL        + ++ +S   +K ++ + +   F
Sbjct: 304 VPYGSLRFFLLCVAVCASGLALAYVEIFLAN------DPILPISFLRNKNVLGSSLANWF 357

Query: 533 CFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKF 592
           C   +M I  +   Y+  V N   +Q+ ++  P FFS+ LG F  +Y+ +  G  +  + 
Sbjct: 358 CMMGMMTITYYLPIYWSSVSNQGPIQVGKKSIPSFFSMALGSFGTAYYVQKNGTYY--RL 415

Query: 593 VLSGATLLLYVALMGVSLN--LPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKS 648
           +++   ++++  L  V +   +P W+QYI L++P  G S+++T  LL+ +    H+ + +
Sbjct: 416 LMTSCLIIIFGQLQIVYITPEMPQWRQYILLAVPGFGVSILITVTLLAMIAAVPHKHQAA 475

Query: 649 PISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATE 708
             + S+ Y F   G  +G SL G +F  TL K +   VM F    + KK+L  +I+ A  
Sbjct: 476 --TTSLSYAFRTTGCIIGASLAGAIFQNTLKKNVTTAVMKFLGDEHSKKELNLVIEKALR 533

Query: 709 SSDWVHESAPKFVFQTLIECYLQACRNVFKLSTL 742
           SSDWV+  +P+FV + L++CY  AC   F+   L
Sbjct: 534 SSDWVNNGSPEFVHEALLKCYENACGQTFRFCLL 567

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 143/553 (25%), Positives = 261/553 (47%), Gaps = 58/553 (10%)

Query: 212 YGYGSIPQSI--GDVENGLNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSII 269
           + YGS+  SI   + +N L+P               TR R+  S M   +F  A+D++I+
Sbjct: 71  HDYGSVANSIILDNDKNNLSP---------------TRLRLAMSSMYLGIFLSALDNTIV 115

Query: 270 LVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGY 329
             + ++I SEF+EL R+S + +AYLLS+A  Q                     +F +G  
Sbjct: 116 STLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCL 175

Query: 330 LSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRFSQKNDSRYSLSASMITFAMGVVI 388
           +  ++  FW  +  R ++G GGG + ++ + T+ +    +N + Y        + +G+ +
Sbjct: 176 ICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRALYQ-GVCNFYYGLGIAL 234

Query: 389 GPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADM--------YSVKSTLYGRPT-- 438
           G  +   F    GS WR AFL  VP  +++   ++  +        Y ++ T+    +  
Sbjct: 235 GGIIGGWFTEKLGS-WRGAFLFQVPLSVISTVTVMVWLQLPKDSKSYGLEITMSNNSSNN 293

Query: 439 ---PTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSL---DLTGLKNNTMIQALLFSVI 492
                + K+ K      D Y            + ++S    D++ +K+NT +   L SV 
Sbjct: 294 GTESIIMKKLKTI----DWYGAMSLVIFLLSFMILSSAGGSDIS-VKSNTFLYLTLISVT 348

Query: 493 IVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVL 552
                ++  ++ +    + ++ +    D+ ++ + +   F    LM I  +   YF  V+
Sbjct: 349 SFISFIYIELKFAK---DPILPLVFLKDRSVLGSSLSNWFTMMLLMTISYYLPIYFTSVM 405

Query: 553 NLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNF----LLKFVLSGATLLLYVALMGV 608
            +    + +R  P FFS+  G     Y+ K  G+ +        V+    L +Y+   G+
Sbjct: 406 GIGAYDVGKRTLPNFFSVAFGSLGAGYYMKKTGKYYWFVTFFCLVVVIGCLQIYLINDGI 465

Query: 609 SLNLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVG 666
           S    VW+QY+   +P LG+++++T  LLS +    HE +   ++ SI Y F + G T+G
Sbjct: 466 S----VWRQYLLSFVPGLGAAVLITIALLSMIVAVPHEYQ--AVTTSISYAFRSTGCTLG 519

Query: 667 ISLGGYVFHKTLIKLMHEKVMPFSKQG--YLKKDLLKIIKHATESSDWVHESAPKFVFQT 724
           +S+G  +F  +L K +  K++    Q   Y +K+LL+II HA++S DWVH  AP+F  +T
Sbjct: 520 VSIGAALFRDSLNKYLRAKILELGSQNGNYSEKELLQIIDHASKSIDWVHNEAPRFFKRT 579

Query: 725 LIECYLQACRNVF 737
           ++ECY  AC+ VF
Sbjct: 580 ILECYHYACKKVF 592

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score =  164 bits (415), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 126/515 (24%), Positives = 235/515 (45%), Gaps = 25/515 (4%)

Query: 230 PPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLV 289
           PP    + + E     +R RI    M   +F  A+D +I+  + ++I SEF+ L ++S +
Sbjct: 67  PP----SETPEFALSSSRIRIIMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWI 122

Query: 290 ISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGF 349
            ++YLLS++  Q                  +   F +G  +   S   W  +  R V+G 
Sbjct: 123 ATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGI 182

Query: 350 GGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFL 409
           GG  L  L S +++      +           F +G   G  +   F       WR AF 
Sbjct: 183 GGCGLTCLASMVISDLVPLRERAVYQGLCNFIFGLGTASGGLVGAAFQD-----WRMAFT 237

Query: 410 IPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQ 469
           I  P  L + +++++ +      L  R      + + + L   D   +          + 
Sbjct: 238 IQCPISLASCALIVSYL-----ELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLFML 292

Query: 470 VTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIG 529
           V+SL    +  ++++ ALL    +V G +F  +E     ++ V+ ++    + ++ + + 
Sbjct: 293 VSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELY-VAVDPVLPIAFLKYRSVLGSSLA 351

Query: 530 ISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFL 589
             F   +++    +   Y+  VLN+    + +R  P FFS+  G      + K  G+ + 
Sbjct: 352 NWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAFGSLGAGIYMKRTGKYYW 411

Query: 590 LKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGSSMILT-----LLSNLYHEYHE 644
                 G  +L  + +  ++   PVW+QY+ L +P  G S+++T     ++S + HE+H 
Sbjct: 412 FLLAFCGIGILGQLKINLLTPATPVWQQYLLLVVPSFGLSVLITVTLLAMISAVPHEHHA 471

Query: 645 QRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIK 704
                 + SI Y F + G T+G+S+G  +F  TL  L+  KV+ F+   + +++LL+II 
Sbjct: 472 A-----TTSISYAFRSTGATLGVSIGAAIFRSTLNTLLQNKVLQFASDEHPREELLRIIN 526

Query: 705 HATESSDWVHESAPKFVFQTLIECYLQACRNVFKL 739
           +A  S++WVH+ AP+FV  TL+ECY  A ++ FK 
Sbjct: 527 NAAHSANWVHKEAPEFVRATLVECYHYASKSTFKF 561

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score =  164 bits (416), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 133/501 (26%), Positives = 237/501 (47%), Gaps = 33/501 (6%)

Query: 255 MCT-YL--FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXX 311
           MC+ YL  F  A+D++++  + + I SEF+++ ++  V ++YLLS+A+ Q          
Sbjct: 400 MCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSDIF 459

Query: 312 XXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRFSQKND 370
                   +   F  G  +   S      ++ R V G GGG + ++ + T+ +    ++ 
Sbjct: 460 GRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLRSR 519

Query: 371 SRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFC-----LVNASIMLAD 425
           + Y    +   F +G   G  +  +F   H  GWR  F   VP       L+ + +++  
Sbjct: 520 AVYQGICNFF-FGLGTAFGGVIGGIF-VDHQYGWRMVFWSQVPVSGLSTLLICSFLVVPR 577

Query: 426 MYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLKNNTMIQ 485
           + + + +L  +     W      L S  +             +   SLD+   + + +I 
Sbjct: 578 IKNYEVSLGRKLMRVDW------LGSISMILWLTSFLLITTMMGGISLDIDSDQFHYLI- 630

Query: 486 ALLFSVIIVCGILFFLIE---TSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIP 542
             +FS   V  I+F L E    SD     V+ +    ++ ++   +G  FC    M I  
Sbjct: 631 --MFSS--VSAIIFVLTELFVASD----PVLPLRFLSNRSVLGASLGNFFCVMGFMTICF 682

Query: 543 FGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLY 602
           +   YF  VL++S   + +R++P F    LG      + K  G+ +    + +  + L +
Sbjct: 683 YLPIYFASVLDISPTGIGKRMAPNFLCTALGSLGAGVYMKQTGKYYWFVVLFALVSTLGH 742

Query: 603 VALMGVSLNLPVWKQYICLSLPFLGSSMIL--TLLSNLYHEYHEQRKSPISGSIVYCFGA 660
             L  + L + +  QY+ + LP +GSS+I+   LL+ +    H+ + +  + SI Y F +
Sbjct: 743 YYLTLIPLTVSITVQYLLVVLPGVGSSIIIVVALLAMIAAVPHKHQAA--TTSISYAFRS 800

Query: 661 VGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKF 720
            GGT+G++LG  VFH+TLIK +H  V+ +    + +K+LL+IIK A+ S++WVH  AP F
Sbjct: 801 TGGTLGVALGSSVFHRTLIKRLHTDVLEYVSPEHPRKELLRIIKKASHSTEWVHRKAPTF 860

Query: 721 VFQTLIECYLQACRNVFKLST 741
           +  TLI CY  AC +VF   T
Sbjct: 861 IRDTLITCYDVACHDVFVFCT 881

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score =  160 bits (404), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 138/557 (24%), Positives = 241/557 (43%), Gaps = 30/557 (5%)

Query: 214 YGSIPQSIGDVEN---GLNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIIL 270
           YGS  +S    EN         V    S E     +R  I    M   +F  A+D +I+ 
Sbjct: 48  YGSTTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVS 107

Query: 271 VIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYL 330
            + + I SEF+ L + S + ++YLLS++  Q                  +   F +G  +
Sbjct: 108 TLLTHIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLI 167

Query: 331 SWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGP 390
              S   W  +  R ++G GG  L +L + IM+      D           F +G   G 
Sbjct: 168 CGLSNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGTASGG 227

Query: 391 FMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLL 450
            +   F       WR AF++  P  +++  +++     V   L  R + +    +   L 
Sbjct: 228 LVGAYFRD-----WRLAFILQCPISVLSGILIV-----VYLELPPRASASNKDCWSARLR 277

Query: 451 SPDLYEIXXXXXXXXXXVQVTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMN 510
             D              +  +S+  + +   + + A + +  +V G +F  +E      +
Sbjct: 278 RLDWAGATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVEL-RVAAD 336

Query: 511 SVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSI 570
            V+ ++   D+ ++ + +   FC  ++M    +   Y+  VL +    + +R  P FFS+
Sbjct: 337 PVLPVTFLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSV 396

Query: 571 VLGYFSVSYFWKSKGQN--FLLKFVLSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGS 628
             G      + K  G+   FLL F +      + + L  ++  +PVW+QY+   +P  G 
Sbjct: 397 AFGSLGAGLYMKRTGKYYYFLLAFCVLAIAGQVQIVL--ITPQMPVWRQYLLQVVPGFGV 454

Query: 629 SMILT-----LLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMH 683
           S+++T     +++ + HE+H       + SI Y F + G T+G+S+G  VF  +L  L+ 
Sbjct: 455 SVLITVTLLAMIAAVPHEHHAA-----TTSISYAFRSTGATLGVSVGAAVFRSSLTSLLD 509

Query: 684 EKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFK--LST 741
            KVM F+  G+ +++L  II  A  SSDWVH SAP FV  TL+ECY  A R  FK  L+T
Sbjct: 510 AKVMRFASDGHSERELRGIIASAARSSDWVHRSAPPFVRATLLECYHFASRATFKFCLTT 569

Query: 742 LXXXXXXXXXXXXNRIH 758
           +            +++H
Sbjct: 570 MVLAGVSCSIIKEHKLH 586

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score =  160 bits (406), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 139/510 (27%), Positives = 237/510 (46%), Gaps = 38/510 (7%)

Query: 247 RRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXX 306
           R +I    M   +F  A+D++I+  + + IASEF+EL R+S V +AYLLS+A  Q     
Sbjct: 119 RLKIIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGK 178

Query: 307 XXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRF 365
                           +F +G  +   S  F   +  R + G GGG + ++ S T  +  
Sbjct: 179 ISDIFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIV 238

Query: 366 SQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLAD 425
             +N + Y        F +G  +G  +   F S    GWR +FLI +P    +  +++  
Sbjct: 239 PLRNRALYQ-GICNFYFGLGTALGGVVGGWF-SDRSVGWRMSFLIQLPIAFFSTILIILF 296

Query: 426 MYSVK--------------STLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVT 471
           +   K              ST+  R +   W     T L   L+            +  T
Sbjct: 297 LRLPKESKGRGLQVDGNYFSTIKVRLSAVDW--IGATTLVLFLFSFMITASLGGKEIPYT 354

Query: 472 SLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGIS 531
           S    GL            V+ V G L F         + ++ +    D+ ++ + +   
Sbjct: 355 SHKFIGL-----------CVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVLGSSLSNW 403

Query: 532 FCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLK 591
           FC  ALM +  +   YF  VLN+    + +R+ P FFS   G     Y+ K  G+ +   
Sbjct: 404 FCMMALMTVSYYLPIYFAGVLNMKPTDIGKRIIPNFFSTAFGSLGAGYYMKKTGKYYW-- 461

Query: 592 FVLSGATL--LLYVALMGVSLNLPVWKQYICLSLPFLGSSMILT--LLSNLYHEYHEQRK 647
           FV+S   L  +  + ++ +  ++ V+KQY  + +P LG+S+++T  LL+ +    H  + 
Sbjct: 462 FVISFCVLASIGCLQIVWIQPDISVFKQYTLMFIPGLGASVLITVALLAMIAAVPHNHQA 521

Query: 648 SPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHAT 707
             ++ SI Y F + G T+G+S+GG +F ++L  L+  KV+ F    + + +L++II  A+
Sbjct: 522 --VTTSISYAFRSTGCTLGVSIGGAIFRESLDNLLKSKVLKFKSPEHSEDELMRIIDKAS 579

Query: 708 ESSDWVHESAPKFVFQTLIECYLQACRNVF 737
           +S++WV  S+P F+ QTLI+CY  AC+NVF
Sbjct: 580 QSTEWVQNSSPSFIKQTLIDCYHFACKNVF 609

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 1  MGKKDRQRKKLREFAKLKNRQ 21
          MGKKD+QRKKLR F K K +Q
Sbjct: 1  MGKKDKQRKKLRNFTKAKVKQ 21

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score =  121 bits (304), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 125/510 (24%), Positives = 219/510 (42%), Gaps = 47/510 (9%)

Query: 253 SCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXX 312
           S +   +F  ++D +I+  +   IASEF  L  +S + ++YLLS  I Q           
Sbjct: 156 SSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSDIFG 215

Query: 313 XXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSR 372
                  +   F LG  +  ++   W  +  R V G GGG L ++ S I++         
Sbjct: 216 RKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRA 275

Query: 373 YSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNA------------- 419
                  I + +G+ +G  M     + +G GWR  FL+ V   L++              
Sbjct: 276 SYQDLFNICYVLGITLGGSMGGWL-AEYG-GWRLVFLLQVVAALISGCFIQAFLILPKVH 333

Query: 420 ---SIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXXVQVTSLDLT 476
               I LA+  S+K+ LY                      +          + + SL LT
Sbjct: 334 HGNGIALANKESLKTKLY----------------------MMDWLGTFCLVIFLASLTLT 371

Query: 477 -GLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFA 535
             L +      LL  +++     +F+    +   + ++S+ L  D+ ++ + +   FC  
Sbjct: 372 CSLVDLNFNFLLLLILLMFVSGYYFVYHELNIAADPILSVHLLTDRNVLASSLANFFCML 431

Query: 536 ALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ--NFLLKFV 593
             +  I +   YF  VL +   ++ +R    F    +G F   Y+ K +G+   F+    
Sbjct: 432 NDVLTIFYVPMYFASVLYMGPKEIGKRTIISFLGTSIGSFGTGYYIKRRGKYRTFICLAC 491

Query: 594 LSGATLLLYVALMGVSLNLPVWKQYICLSLPFLGSSMILT-LLSNLYHEYHEQRKSPISG 652
           + G    L +AL+  S++   W+QY+ L +P L ++ + T LL +L      + ++  + 
Sbjct: 492 IIGILGQLQIALIKPSIS--TWRQYLLLLIPILYTTTVRTSLLISLIAAVPYKNQTA-AA 548

Query: 653 SIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDW 712
           SI Y F + G  +G SLGG +F  +L  L++  +MP   + + K  LL II  AT S+DW
Sbjct: 549 SISYTFRSTGAILGASLGGGIFRSSLKSLLNTNIMPLESEIHPKSQLLHIIDKATHSTDW 608

Query: 713 VHESAPKFVFQTLIECYLQACRNVFKLSTL 742
           VH  +P++    LI CY   C+ +F  S +
Sbjct: 609 VHRESPEYAIPILISCYHYVCKRIFTFSVV 638

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 45/98 (45%), Gaps = 13/98 (13%)

Query: 2  GKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALG---NDKIEEI 58
          G K ++R +L+EFAKLK RQR       TLK++   E  +   SN I+ G       E  
Sbjct: 7  GIKTKERNRLKEFAKLKGRQR-------TLKSDEAGETYLGDKSNTISFGPYSRSSDESQ 59

Query: 59 NENSPLLSAPSK---QEEVSIPKAVDIDTIDAQPLHEG 93
           E  P L+   K   Q+  S      I+ ++ Q L  G
Sbjct: 60 GETIPFLTRIDKNVIQDTSSGRPGFVINKLEVQELSLG 97

>NDAI0J01280 Chr10 (299922..302006) [2085 bp, 694 aa] {ON} Anc_8.272
          Length = 694

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 173/770 (22%), Positives = 318/770 (41%), Gaps = 123/770 (15%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLR-----KSVQTLKNEV--QREAKVPRTSNQIALGND 53
           MG+KD+QRK+LR+FAKLK +QR L       +   LKN++    +  VP+T ++   GN 
Sbjct: 1   MGRKDKQRKRLRDFAKLKEKQRQLHLDQFIATSDNLKNKLIATSQNSVPQTIDEQPTGNI 60

Query: 54  KIEEINENSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPAD 113
           +  +  E +PLL     +  +++ ++  ID + +        +++  ++EV S+  +   
Sbjct: 61  EDNDSTELTPLLLKKQSENHIAVAESSGIDALKSD------TVEEPIEEEVTSLAHQKQK 114

Query: 114 KANEDDLKPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFE 173
             ++D+                              Q I   + P S  E  +SSS S  
Sbjct: 115 NISDDN------------------------------QLIEEPSRPQSSRE-EISSSASTN 143

Query: 174 RADDMPVVQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYV 233
            A  +P           K +H  +PS              YGSI Q +   E       V
Sbjct: 144 EAPIVP----------HKKIH--SPS--------------YGSIEQRLSHEEPAFTEEVV 177

Query: 234 ENTSSDELVHDLTRRRIFSSCMCTY---LFFIAMDSSIILVIASKIASEFHELWRLSLVI 290
           +  +++  +  L   ++ +  +  +   LF I  D ++ +++++   S   +    S +I
Sbjct: 178 DLETNNRDISLLNEPQLTAGMIFLFSLLLFTIIFDFTLAMMLSTTSGSHVKQSSNSSWII 237

Query: 291 SAYLLSNAIGQXXXXXXXXXXXXXXXXC-IAQFSFILGG-YLSWSSAHFWTFIFARCVTG 348
           ++YL++  I Q                  I    F++G   L+  +  FW  + AR + G
Sbjct: 238 ASYLITMYISQLLTAQVSGKYKNYKTLSYIGTMLFLIGSSILTIKTVSFWWIVMARFILG 297

Query: 349 FGGGSLIALKSTIMNR-FSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNA 407
              GSLI +  TI+N+    K  SR S+    I    G+ +  +   +F +S    W+N 
Sbjct: 298 LASGSLIYVMLTIINKCILNKRFSRPSMKIFTIPIVGGLSLA-YATAIFITS----WQNV 352

Query: 408 FLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKNTLLSPDLYEIXXXXXXXXXX 467
           + +   F     ++ L   Y   +  Y      L        L  DL             
Sbjct: 353 YFLLAIFSFF--TLFLIMFYFPSNESYKTNNTNLSSIVAT--LDIDLIGCTILSVFLLLI 408

Query: 468 VQVTSLDLTGLKNNTMIQALLFSVIIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTM 527
             +T+ +  G    +   A L   II+ GIL  L ET+ T  N +I +    +K + +  
Sbjct: 409 AVITTGNSNGFSITSPYSATLVISIILVGILLLLSETT-TNKNPIIPLDFIENKVIFFKS 467

Query: 528 IGISFCFAALMCIIPFGTTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQN 587
           + + F   +L+  I +   Y    LN+S   + +R SP F +I+    +VS   +   QN
Sbjct: 468 LTVFFASMSLITFIHYFPFYLEKTLNISLFDIYKRTSPMFLTILFIIITVSR--RISTQN 525

Query: 588 FLLKFVLSGATLLLYVALMGV-------------SLNLPVWKQYICLSLPFLGSS--MIL 632
            L         L+ +  +MG+             + +  +WKQ +   LP LGS+  +I 
Sbjct: 526 TL------SYGLVTFFGIMGLIGQCILLNYVYNDTADYKLWKQCMIGILPILGSTFLVIA 579

Query: 633 TLLSNLYHEYHEQRKSPISGSIVYCFGAVGGTVGISLGGYVFHKTLIKLMHEKVMPFSKQ 692
           TL+     +  + +K PI  +  +    +G  +GI + G++F++ L    ++++   S +
Sbjct: 580 TLM-----DVTDDKKLPIISTSSFAVSTLGSILGICISGFIFNQGL----YDELWVHSTE 630

Query: 693 GYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECYLQACRNVFKLSTL 742
              +K L KII+    +S++  ES+ ++    ++E Y      VF  S +
Sbjct: 631 ---EKGLGKIIRKMINNSEY--ESSSRYYCYEILESYFIVSGYVFLFSAI 675

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 75/167 (44%), Gaps = 4/167 (2%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  +MD +II  I + +  EF E  R+  V +++LL++ + Q                 +
Sbjct: 58  FLASMDRTIIANIMNSVTEEFKESHRIQWVATSFLLTSTVFQPIYGKLSDVTGRRFVLVL 117

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIM-NRFSQKNDSRYSLSAS 378
           A   F+LG  ++  + + W F F R + G G G +  +    M + FS K  S Y  S +
Sbjct: 118 AYSLFLLGCLVTAYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMFSVKEQSIYQ-SYA 176

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLAD 425
            I + +G V+G  +  +  +    GWR  FL  VP   +   + L D
Sbjct: 177 HIIYTIGEVLGAPIGGI--ALETVGWRAIFLAQVPVLTICIYLTLCD 221

>NCAS0B03780 Chr2 complement(674904..676673) [1770 bp, 589 aa] {ON}
           Anc_8.272 YDR119W
          Length = 589

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/429 (22%), Positives = 155/429 (36%), Gaps = 92/429 (21%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSV-QTLKNEVQREAKVPRTSNQIALGNDKIEEIN 59
           MG+KD+QRKKLREFAKLK +QR L   +     N  Q+      T  Q+        E  
Sbjct: 1   MGRKDKQRKKLREFAKLKEKQRLLENKIHHATPNGTQKPTSELNTVQQL--------EPE 52

Query: 60  ENSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANED- 118
           E++PLL   +                     HE                  PA+K   D 
Sbjct: 53  ESTPLLKTSN---------------------HE---------------TSTPAEKEMPDK 76

Query: 119 -DLKPPSQHEACGNSALQSSITDFS-DRSVSPLQSITSCNTPMSEHELPVSSSNSFERAD 176
            DLK P+   +     +  +I D S  +   PL        P  E    ++SS       
Sbjct: 77  RDLKFPAPSFSTQYRNMALNIQDASAAQDPVPL--------PTEELRQQITSS------- 121

Query: 177 DMPVVQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENT 236
           D   +  DN T+SS                   T+ GYGSI    G   N  +     +T
Sbjct: 122 DTTTIYTDNNTTSSLYAR---------------TTDGYGSIH---GQSSNTSDIDLHVDT 163

Query: 237 SSDELVHDL---TRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAY 293
            S     DL    + ++  + +   LF I  + S ++ ++S I S F    +L+L + + 
Sbjct: 164 ESSAPQADLMTCVKSKLLLTVLSLGLFMIFFEFSAMIELSSFILSGFDRFSQLALSLGSS 223

Query: 294 LLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGS 353
                +                       +F++G  L ++S  +++F   RC+    G +
Sbjct: 224 FALIGLTLSALIEYPKLCTLKSSIIAGNVAFVVGSLLIFNSKLYFSFGLGRCINAI-GAA 282

Query: 354 LIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
           LI   +   N  + +   +Y      +   +G V G     +F       WR  ++IP  
Sbjct: 283 LIIYTTFTTNLMAHELCKKY---VYYLISMLGAVCGTITSGVF----CDLWRKIYIIPTI 335

Query: 414 FCLVNASIM 422
             ++   ++
Sbjct: 336 LAIIQIVLL 344

 Score = 40.0 bits (92), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 101/248 (40%), Gaps = 25/248 (10%)

Query: 492 IIVCGILFFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGTTYFIIV 551
           II   +LF      D      IS+S +    L+  M    F   AL+  + +   Y  IV
Sbjct: 338 IIQIVLLFLYFPLDDITNKDEISISRKNLLDLLPNM----FSMLALIATLIYLPVYSTIV 393

Query: 552 LNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVALMGVSLN 611
            N S LQL+ R+ P + S+    F+V        + +    + S   L+ Y  L  +  +
Sbjct: 394 WNESYLQLSIRVLPIYLSM----FAVVLIQARYAKKYNTSLLGSLVGLIGYYQLYSLDKS 449

Query: 612 LPVWKQYICLSLPFLG-SSMILTLLSNLYHEYHEQRKSPISGSIVYCFGA-VGGTVGISL 669
            P W  ++   +P +G +S+I+    N+                 +  G  VGG+  I L
Sbjct: 450 TPDWFHFVAGCIPLIGVTSVIMANTKNMRD---------------FAVGILVGGSATIIL 494

Query: 670 GGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQTLIECY 729
              +F +TL   + + ++    +G  KK+LLKI++   ++  W    AP      +   +
Sbjct: 495 CQGLFTRTLHDTLRDNLLKLQSEGLKKKELLKILEKTIKNPQWALIDAPAITRGAITNSF 554

Query: 730 LQACRNVF 737
             A   +F
Sbjct: 555 ALAIHQIF 562

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 45/159 (28%), Positives = 69/159 (43%), Gaps = 5/159 (3%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           FF ++DS+I+  I +++A EF E  +   + +++LL+N   Q                  
Sbjct: 54  FFSSLDSTIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLT 113

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A F F LG  L+  + +   F  AR + G G G + A+ S   +      +       + 
Sbjct: 114 AHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRERGIFQGYAN 173

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP---FC 415
           I F MG V+G  +  LF      GWR  F I VP   FC
Sbjct: 174 IVFGMGQVLGAPLGGLFLDH--IGWRTLFGIQVPMIMFC 210

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 78/164 (47%), Gaps = 4/164 (2%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++D +I+  I +++A EF E  +   + ++YLL+N   Q                  
Sbjct: 48  FLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLT 107

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRFSQKNDSRYSLSAS 378
           A F F LG  L+  +     F  AR + G GGG + A+ S T+ +  +Q+    Y   A+
Sbjct: 108 AHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYAN 167

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIM 422
            I F +G ++G  +  LF  +   GWR  F + VP  L+ +S++
Sbjct: 168 -IVFGLGQILGAPIGGLFIDTL--GWRILFGLQVPTILLCSSLV 208

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 91/202 (45%), Gaps = 13/202 (6%)

Query: 222 GDVENGLNPPYVENTSSDELVHDLTRRRIFSSCMCTYL--FFIAMDSSIILVIASKIASE 279
           G+ +NGL   Y E        ++L+  + F   +  +L  F  ++DS+I+  I +K+A E
Sbjct: 20  GEEDNGLEEQYHE--------YNLSLPK-FPILLSLWLGSFLSSLDSTIVANIMNKVAEE 70

Query: 280 FHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWT 339
           F E  +   + +++LL+N   Q                  + F F LG +L+  + +   
Sbjct: 71  FEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQ 130

Query: 340 FIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSS 399
           F  AR + G G G + A+ S  ++      +       + I F +G ++G  +  LF  S
Sbjct: 131 FSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQGYANIVFGLGQLLGAPLGGLFIDS 190

Query: 400 HGSGWRNAFLIPVPFCLVNASI 421
              GWR  F + VP  L+ +++
Sbjct: 191 --VGWRVIFGVQVPMLLLCSTL 210

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 93/435 (21%), Positives = 173/435 (39%), Gaps = 29/435 (6%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           +  A+D++I+  +   IASE     ++S + ++YLLS +  Q                  
Sbjct: 43  YLAALDTTIVTTLLPTIASELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIW 102

Query: 320 AQFSFILGGYLSWS--SAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSA 377
           +   F  G  L  +  +   W     R + G GGG L +L +   +              
Sbjct: 103 SNLCFGFGCILCGAPFTKSLWMLCIGRFIAGVGGGGLNSLSTITTSDIIPLRQRGVYQGM 162

Query: 378 SMITFAMGV----VIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTL 433
             I FA+G     +IG F+          GWR AFL  VP  L++ S+++  +    +  
Sbjct: 163 GNIVFALGCASGSLIGAFLQQRI------GWRWAFLCQVPLSLLSCSLIMKFL----NLP 212

Query: 434 YGRPTPTLWKRFKNTLLSPDLYEIX--XXXXXXXXXVQVTSLDLTGLKNNTMIQALLFSV 491
            G P   L       + + D+ E             + +  + L+ L N + +    +++
Sbjct: 213 AGSPGRGLINLSNKKITTADVREHVDFTGSFTLITTMLLLMIILSVLDNPSHLTYGTWAL 272

Query: 492 IIVCGIL--FFLIETSDTYMNSVISMSLQGDKRLIWTMIGISFCFAALMCIIPFGT-TYF 548
            IV   L  +  + T  +  N ++ + L G  R +      ++ F     ++ +    ++
Sbjct: 273 FIVGLALAGYTFVSTELSVHNPMVPIRLLGSNRTVLASSLTNWFFTMSTFVLAYYVPVFW 332

Query: 549 IIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQ----NFLLKFVLSGATLLLYVA 604
             V +L    +  R    FF I +G      + K  G+    +  L  V    TL++Y++
Sbjct: 333 QTVYHLKPWNIGVRTVSNFFGIAIGSMMTGLYMKRTGKYKALSNTLNTVTVAGTLIVYLS 392

Query: 605 LMGVSLNLPVWKQYICLSLPFLGSSMILTL-LSNLYHEYHEQRKSPISGSIVYCFGAVGG 663
                    +  +Y  L LP LG + +LT+ L +L        ++ ++ SI Y F A+G 
Sbjct: 393 TYNTEPKGLL--EYFMLFLPGLGYASMLTITLLSLIASVDTSHQAQVT-SIQYAFRAIGS 449

Query: 664 TVGISLGGYVFHKTL 678
           T+G+S  G ++   L
Sbjct: 450 TLGVSFAGLIYQSKL 464

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 54.7 bits (130), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++DS+I+  I +++A +F E  R   + +++LL+N   Q                 I
Sbjct: 47  FLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLI 106

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           AQF F LG  L+  + +   F  AR + G G G L A+ S  ++      +       + 
Sbjct: 107 AQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKS 431
           I F  G ++G  +  +F  +   GWR  F + VP       IML  + ++K+
Sbjct: 167 IVFGFGQLLGAPLGGVFIET--IGWRALFGVQVPM------IMLCTILAIKN 210

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 86/187 (45%), Gaps = 7/187 (3%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++DS+I+  I +K+A EF E      + +++LL+N   Q                  
Sbjct: 45  FLSSIDSTIVANIMNKVAEEFQESQEKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLT 104

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A   F LG +L+  S +   F  AR + G GGG + A+ S  +       D       + 
Sbjct: 105 ALSFFGLGCFLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYAN 164

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTP 439
           I F MG ++G  +  LF ++   GWR  F I VP  LV  +I+L +MY V   L   P P
Sbjct: 165 IVFGMGQLLGAPVGGLFIATI--GWRALFWIQVP--LVIIAIILGEMY-VNIKLVHVPPP 219

Query: 440 TLWKRFK 446
           +  +RFK
Sbjct: 220 S--ERFK 224

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 76/172 (44%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++DS+I+  I +++A EF E  +   + +++LL+N   Q                  
Sbjct: 47  FLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLT 106

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           AQF F LG  L+  + +   F  AR + G G G L A+ S  ++      +       + 
Sbjct: 107 AQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKS 431
           I F  G ++G  +  +F  +   GWR  F I VP       IML  + ++K+
Sbjct: 167 IVFGFGQLLGAPLGGVFIET--IGWRALFGIQVPV------IMLCSVLAIKN 210

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 70/158 (44%), Gaps = 2/158 (1%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++DS+I+  I +++A EF E  +   + +++LL+N   Q                  
Sbjct: 47  FLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLT 106

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           AQF F LG  ++  + +   F  AR V G G G L A+ S  ++      +       + 
Sbjct: 107 AQFFFGLGCLMTCFARNVTEFSIARAVCGIGAGGLNAISSIAVSDICTARERGVYQGYAN 166

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLV 417
           I F  G ++G  +  +F  +   GWR  F + VP  +V
Sbjct: 167 IVFGFGQLLGAPLGGIFIET--IGWRALFGVQVPMIIV 202

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/172 (24%), Positives = 75/172 (43%), Gaps = 8/172 (4%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++D +I+  I +++A EF E  R   + +++LL+N   Q                  
Sbjct: 47  FLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLT 106

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A F F +G  L+  + +   F  AR + G G G L A+ S  ++      +       + 
Sbjct: 107 AHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGLNAIGSIAVSDICTARERGVYQGYAN 166

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKS 431
           I F +G ++G  +  +F  +   GWR  F + VP       IML  + ++K+
Sbjct: 167 IVFGLGQLLGAPLGGVFIET--IGWRALFGVQVPV------IMLCSVLAIKN 210

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/217 (25%), Positives = 89/217 (41%), Gaps = 11/217 (5%)

Query: 234 ENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAY 293
             TS  EL     R  + +  M ++L   A+D++I+  +   IAS+     ++S + +AY
Sbjct: 28  STTSHSELPPTKVRITVLALLMGSFL--SALDTTIVATLLPTIASDLDASSQMSWIATAY 85

Query: 294 LLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLS---WSSAHFWTFIFARCVTGFG 350
           LLS +  Q                 ++  +F LG  +    W++ + W     R V G G
Sbjct: 86  LLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTN-NVWVLSTGRFVAGIG 144

Query: 351 GGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLI 410
           GG    L +   +                I F++G   G  +  +     G GWR AFL+
Sbjct: 145 GGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLGAVLQ--QGIGWRWAFLV 202

Query: 411 PVPFCLVNASIMLADMYSVKSTLYGRPTPTLWKRFKN 447
            VP  LV A +M+A +  + +   GR    LW   K 
Sbjct: 203 QVPMALVCA-LMIAVVLDLPADSPGR--GLLWLELKR 236

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D  I++ +   I  +FH+   +  +++ Y LSNA+                   I+   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVF 83

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +S  S    T I  R V GFGG  + +L   +     ++N     ++A  I++ +
Sbjct: 84  EIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGTSIVRENHRGIMITALAISYVI 143

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              +GPF+   F+  H S WR  F I +P
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLP 170

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/176 (26%), Positives = 74/176 (42%), Gaps = 12/176 (6%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQ-XXXXXXXXXXXXXXXXC 318
           F +A+D +I+  + ++IA EF E  +   + +++LL+N   Q                  
Sbjct: 51  FLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATL 110

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRF-SQKNDSRYSLSA 377
           IAQF F LG  +S  + +   F   R V G GGG + A+ S  ++   + K    Y   A
Sbjct: 111 IAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSIAVSDICTAKERGMYQGYA 170

Query: 378 SMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP---FCLV----NASIMLADM 426
           +++    G                 GWR  F I VP   FC+     N +I LA +
Sbjct: 171 NIV---FGSGQLLGAPLGGLLITTIGWRAIFAIQVPMALFCMFLTGRNVNIKLAHL 223

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 65/149 (43%), Gaps = 2/149 (1%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D  I++ +   I  +FH+   +  +++ Y LSNA+                   I+   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALSNAVFMLLWGRLAEILGTTECLMISVVIF 83

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +S  S    T I  R + GFGG  + +L   +     Q+N     ++A  +++ +
Sbjct: 84  EIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVVGTSIVQENYRGIMITALAVSYVI 143

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              +GPF+   F+  H S WR  F I +P
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLP 170

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 68/158 (43%), Gaps = 4/158 (2%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++DS+I+  I +K+A EF E  +   +++++LL+N   Q                 +
Sbjct: 51  FLGSLDSTIVANIMNKVAEEFEESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMV 110

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A   F++G   +  S +   F  AR V G G G + AL S  ++      +       + 
Sbjct: 111 AHSFFLVGCLFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYAN 170

Query: 380 ITFAMGVVI-GPFMMNLFDSSHGSGWRNAFLIPVPFCL 416
           + F  G ++ GP    L DS    GW+  F   VP  +
Sbjct: 171 VVFGTGSMLGGPIGGWLMDS---FGWKVIFAGQVPLIM 205

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 64/149 (42%), Gaps = 2/149 (1%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D  I++ +   I  +FH+   +  +++ Y L+NA+                   I+   F
Sbjct: 24  DIVIVVTLYDTIGIKFHDFGNIGWLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIF 83

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +S  S    T I  R + GFGG  + +L   +     Q+N     ++A   ++ +
Sbjct: 84  EVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVVGTSIVQENHRGTMITALATSYVI 143

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              +GPF+   F+  H S WR  F I +P
Sbjct: 144 AEGVGPFIGGAFN-EHLS-WRWCFYINLP 170

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 72/164 (43%), Gaps = 12/164 (7%)

Query: 263 AMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQF 322
           A+D +II    ++IAS F E  +++ V +AY+L+    Q                  A+ 
Sbjct: 62  AVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEV 121

Query: 323 SFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITF 382
            FI+G  +  ++      I AR + G GG  L A+ + I++  +        LS   I +
Sbjct: 122 VFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAP-------LSQRSIYW 174

Query: 383 AMGVVIGPFMMNLFDSSHGS-----GWRNAFLIPVPFCLVNASI 421
             G VI  F  ++     G      G R  F++ +PFCL + S+
Sbjct: 175 GWGSVIWGFSQSVGGPLGGLLLNWFGVRGLFVVQIPFCLFSLSL 218

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/191 (23%), Positives = 77/191 (40%), Gaps = 3/191 (1%)

Query: 229 NPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSL 288
           N P   + S+  L+  L R  +  + +    F  A+D  I+  I   +++      +   
Sbjct: 39  NTPDHNDNSNVRLMSGL-RLYVCVAALVLATFIFALDVFIVNTIIDSVSASLGGYSKSGW 97

Query: 289 VISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTG 348
           +I+ Y L N++                   ++ F F +G  +S S+      I  R + G
Sbjct: 98  LIAGYSLPNSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAG 157

Query: 349 FGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAF 408
            GG  L  L   I +   ++ +    +S  M  FA   +IGPF+   F ++H   WR  F
Sbjct: 158 VGGSGLQTLSLVIGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAF-TTH-VIWRWCF 215

Query: 409 LIPVPFCLVNA 419
            I +P   V A
Sbjct: 216 WINLPIGAVTA 226

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 100/264 (37%), Gaps = 15/264 (5%)

Query: 199 SPEVPVSGD--------EITSYGYGSIPQSIGDVENGL--NPPYVENTSSDELVHDLTRR 248
           +PE+ VS D        EI S+G      +  +V N +   P +      + +  DL   
Sbjct: 15  NPEILVSIDSFGIEPSMEIASHGINEESGTDAEVSNHVEKKPNFNSKYGKNAMGEDLPSG 74

Query: 249 RIFSSCMCTYLFFIAM---DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXX 305
            +  +C  +    I +   D  I+  I   +A +F    +   + + Y L NA+      
Sbjct: 75  IVLYTCAFSLALAIFLAALDIMIVSTIIEDVAKKFGAYSKTGWIFAGYSLPNALLALLWG 134

Query: 306 XXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRF 365
                         A   F +G  +S  +      I  R + G GG  + +L   I +  
Sbjct: 135 RIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNL 194

Query: 366 SQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLAD 425
             +      ++     FA+  VIGPF+   F ++H + WR  F I +P   V  ++ +  
Sbjct: 195 VDERRRGLIIACMSSAFAVASVIGPFLGGAF-TTHAT-WRWCFYINLPVGGVAFALFVVF 252

Query: 426 MYSVKSTLYGRPTPTLWKRFKNTL 449
               + +L G    +  K F NTL
Sbjct: 253 YNPQRKSLEGISILSSLKEFCNTL 276

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 64/155 (41%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+  I  ++A +      +  + + Y L NA+                   
Sbjct: 71  LFLAALDVMIVSTIIEEVAKQLGSYSEIGWLFTGYSLPNALLVLIWGRIATPIGFKATML 130

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
            A   F +G  +S  ++     I  R + G GG  + +L   I +   +++     ++  
Sbjct: 131 FAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGSTLVEESKRGMLIAIL 190

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
             +FA+  V+GPF+  +F SS    WR  F I +P
Sbjct: 191 SSSFAIASVVGPFLGGVFTSS--VTWRWCFYINLP 223

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 73/330 (22%), Positives = 132/330 (40%), Gaps = 40/330 (12%)

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTP 439
           I F++G   G  +  +     G GWR AFLI VP  L++  +++  +  + S   GR   
Sbjct: 174 ICFSLGCASGSVLGAVLQ--QGIGWRWAFLIQVPIALISG-LLIVFVLELPSDSPGRGLI 230

Query: 440 TLWKRFKNTLLSPDLYE-------IXXXXXXXXXXVQVTSL-DLTGLKNNTMIQALLFSV 491
            L     NT     + +       I          + ++ L D + L  N+ +      V
Sbjct: 231 WLEHARGNTFQWSKVTKMIDFVGSITLVMSMLLLMITISFLSDPSQLSENSWVVL----V 286

Query: 492 IIVCGILFFLIETSDTYMNSVISMSLQGDKRLI-------WTMIGISFCFAALMCIIPFG 544
           ++V G     + T  T  N ++ + L  + R +       W M   +F   A+M  IP  
Sbjct: 287 LLVAGFCAKFVHTECTIHNPMVPLRLLWENRTVFASSFTNWFMTMSTF---AVMYYIP-- 341

Query: 545 TTYFIIVLNLSTLQLAERLSPFFFSIVLGYFSVSYFWKSKGQNFLLKFVLSGATLLLYVA 604
             ++  V   +   +  R    F  I  G      + K  G+ +    V +       ++
Sbjct: 342 -VFWQTVFKFTPYDIGFRSISNFVGIATGSMLAGVYMKCTGKYWNFSLVTNILYFTGILS 400

Query: 605 LMGVSL-NLPVWK-QYICLSLPFLGSSMILT-----LLSNLYHEYHEQRKSPISGSIVYC 657
           L   +  N P    +Y+ + LP  G + +LT     L++++  E+  Q  S     I Y 
Sbjct: 401 LFACTFRNTPQGVLEYLLMFLPGFGYATMLTVTLLALIASVDFEHQAQVTS-----IQYA 455

Query: 658 FGAVGGTVGISLGGYVFHKTLIKLMHEKVM 687
           F A G T+G+SL G ++  +L   ++  ++
Sbjct: 456 FRATGSTLGVSLAGLIYQASLQYKLYRDIL 485

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 40.8 bits (94), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 80/169 (47%), Gaps = 6/169 (3%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  A+D +++  I + IA+EF E  +   + ++YLL+N   Q                  
Sbjct: 53  FVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVIT 112

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS-TIMNRFSQKNDSRYSLSAS 378
           A F F LG  L+  + +   F  AR + G GGG + A+ S T+ +  S +    Y   A+
Sbjct: 113 AHFFFALGCLLTCFAQNVTQFSIARAICGIGGGGINAMSSITVTDICSARERGVYQGYAN 172

Query: 379 MITFAMGVVIG-PFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADM 426
           ++ F  G ++G P    L DS    GWR+ F I VP  ++ + + L ++
Sbjct: 173 VV-FGTGQLLGAPIGGFLLDS---IGWRSIFGIQVPMLMLCSVLALKNV 217

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 74/177 (41%), Gaps = 3/177 (1%)

Query: 237 SSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLS 296
           S D++V          S +   LF  A+D  I+  I   ++ +F+E  +   +++ Y L 
Sbjct: 32  SQDQVVKGFALYACLGS-LTLALFLSALDILIVSTIIETVSRDFNEYSKSGWLVTGYSLP 90

Query: 297 NAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIA 356
            A+                   ++   F +G  +S  +      I  R ++G GG  L  
Sbjct: 91  TALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQT 150

Query: 357 LKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
           L   I++    +     ++S    +FA+  ++GPF+   F ++H + WR  F I +P
Sbjct: 151 LCFLIISTLVNERSRGMAISVLSCSFAVASIVGPFLGGAF-TTHVT-WRWCFYINLP 205

>KLLA0E09879g Chr5 complement(874102..875994) [1893 bp, 630 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 630

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 33/152 (21%), Positives = 63/152 (41%), Gaps = 2/152 (1%)

Query: 262 IAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQ 321
           +A+D  I+  +   ++       +   +I+ Y L N++                   I+ 
Sbjct: 88  VALDVFIVNTVIDVVSKNLGGYAKSGWLITGYSLPNSLLSLIWGRATSLLGFQSSMLISI 147

Query: 322 FSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMIT 381
           F F +G  +S ++      +  R V G GG  L  +   I     ++ +    ++  M  
Sbjct: 148 FIFEVGSIVSATATSMNNLVVGRVVAGIGGSGLQTVSMIIGCSLVEERNRTIVIAVIMSA 207

Query: 382 FAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
           FA+  +IGPF+   F ++H + WR  F I +P
Sbjct: 208 FAVSSLIGPFIGGAF-TTHAT-WRWCFWISLP 237

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 41/160 (25%), Positives = 72/160 (45%), Gaps = 2/160 (1%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++D +I+  I +++A EF E  +   + +++LL+N   Q                 +
Sbjct: 46  FVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLM 105

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A F  ++G  L+  + +   F  AR + G GGG + A  S  ++      +       + 
Sbjct: 106 AYFFLVIGCLLTCLARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQGYAN 165

Query: 380 ITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNA 419
           I F MG ++G  +  LF  +   GWR  F I VP  +V+A
Sbjct: 166 IVFGMGQMLGAPLGGLFIDTI--GWRAIFGIQVPVVMVSA 203

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 72/185 (38%), Gaps = 6/185 (3%)

Query: 231 PYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVI 290
           P  E   + +  ++ TR  +    +   +F  A+D  I+  I   +   F +  +   ++
Sbjct: 25  PEQEECETSKAKNNNTRLLLSLFSLGLSMFVTALDVLIVGTIIDTVCKSFGDYTKSGWIV 84

Query: 291 SAYLLSNAIGQXXXXXXXXXX--XXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTG 348
           + Y L NA+                    CI  F    G  +S  +      I  R V+G
Sbjct: 85  TGYSLPNALFSLLWGRISANLGPRISIVACIVLFE--AGSLISALARSMNMLIAGRVVSG 142

Query: 349 FGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAF 408
            GG  L  L   I  +   +      LS    TFA+  +IGPF+   F ++H + WR  F
Sbjct: 143 VGGSGLQTLSLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAF-TTHVT-WRWCF 200

Query: 409 LIPVP 413
            I +P
Sbjct: 201 YINLP 205

>KAFR0B05450 Chr2 complement(1116514..1118391) [1878 bp, 625 aa]
           {ON} Anc_8.272 YDR119W
          Length = 625

 Score = 39.7 bits (91), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 85/398 (21%), Positives = 135/398 (33%), Gaps = 105/398 (26%)

Query: 1   MGKKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           MGKKD+QRK+LR+F +LK               E QR            L +D    I +
Sbjct: 1   MGKKDKQRKRLRKFVQLK---------------EAQR------------LFDDPTTPIAK 33

Query: 61  NSPLLSAPSKQEEVSIPKAVDIDTIDAQPLHEGPKIDDSPQDEVNSIKGKPADKANEDDL 120
            + L +A   + E  +   +             P     P  E+  IK     K  E  L
Sbjct: 34  ETILANAIPIKLETKLNATL-------------PTAKKEPDHELQRIK-----KGTESCL 75

Query: 121 KPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCNTPMSEHELPVSSSNSFERADDMPV 180
             P                            +T+ N P+ E +L +S++   ER  D  V
Sbjct: 76  FSPK---------------------------LTTSN-PLRETDLSLSTN---ERIIDKSV 104

Query: 181 VQADNQTSSSKSLHIVAPSPEVPVSGDEITSYGYGSIPQSIGDVENGLNPPYVENT-SSD 239
                 T+S +  H +    E            YGSI     D EN +      N   + 
Sbjct: 105 AI----TTSLRESHSLELGSE------------YGSI-----DFENSVAKDGNFNVCQAH 143

Query: 240 ELVHDLTRRRIFSSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAI 299
           ++    TR     +C+C  +  +  D S  LV +  I+SEF  L    ++   YLL+  I
Sbjct: 144 QIKISATRLHFIIACICISMLSLGADFSFTLVSSPSISSEFDHLADFFIIFGIYLLAIPI 203

Query: 300 GQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFW---TFIFARCVTGFGGGSLIA 356
                                  S +L    S S  +F      + +R + G   GS   
Sbjct: 204 AFYVTSLTIKKYFISSTI----LSNLLALISSLSCTYFKGLNMLVLSRILFGAACGSCCY 259

Query: 357 LKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMN 394
           +  T+  +    N      + ++  F +G +I   ++N
Sbjct: 260 IDLTLCEKLVPTNTKNKYSNIALAHFGLGTIIPALLLN 297

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 703 IKHATESSDWVHESAPKFVFQTLIECYLQACRNVF 737
           IK A  S +W+ E +P  +  ++  CYL + R VF
Sbjct: 566 IKKALSSVEWIREDSPDLISTSIFSCYLDSIRYVF 600

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 68/159 (42%), Gaps = 4/159 (2%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  A+D++I+ VI +++A +F+   +   + ++YLL+N   Q                 I
Sbjct: 77  FLSALDATIVAVIMNRVAEDFNASNQKQWIATSYLLTNTAFQPLYGRLSDIIGRKYTQLI 136

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
             F F +G +L+  S     F  AR V G GGG + A+ S  ++      +       + 
Sbjct: 137 VPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSIAVSDICTVKERGMYQGYAN 196

Query: 380 ITFAMGVVIG-PFMMNLFDSSHGSGWRNAFLIPVPFCLV 417
           I +  G +IG P    L D     GWR  F   VP   V
Sbjct: 197 IFYGAGQLIGAPIGGLLIDR---IGWRALFAFQVPMVAV 232

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 61/155 (39%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+  I   +A +F    +   +++ Y L NAI                   
Sbjct: 47  LFITALDILIVGTIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLIWGRFASIIGFQHSLI 106

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
           +A   F  G  ++  ++     IF R V G GG  L  L   I      +      +S  
Sbjct: 107 LAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFVIGCTMVGERSRPLVISIL 166

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              FA+  ++GP +   F ++H + WR  F I +P
Sbjct: 167 SCAFAVAAIVGPIIGGAF-TTHVT-WRWCFYINLP 199

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 85/229 (37%), Gaps = 14/229 (6%)

Query: 255 MCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXX 314
           +C  LF  A+D  I + +   I  EF++   +  +++ Y L NA+               
Sbjct: 13  LCVTLFLGALDIVICITLYDTIGQEFNDYANVGWLMAGYNLPNALFMLLWGRIASLVGLK 72

Query: 315 XXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYS 374
                +   F  G  ++ ++      I AR ++GFGG  + +L   +     ++      
Sbjct: 73  CSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRARV 132

Query: 375 LSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLY 434
           ++   I + +    GPF+     + H S WR  F + +P   V A   L   Y+      
Sbjct: 133 ITVLGIAYMLAEGAGPFVGGGL-AEHVS-WRWCFYVNLPIGGV-ALAALGWGYNPAGRAP 189

Query: 435 GRPTPTLWKRFK----NTLLSPDLYEIXXXXXXXXXXVQVTSLDLTGLK 479
           GR     W R +     TLL    +            + V  LD+ GL 
Sbjct: 190 GRALARFWVRARAFPYGTLLQAQFWR-------RAAALMVFRLDIPGLA 231

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 84/202 (41%), Gaps = 10/202 (4%)

Query: 229 NPPYVENTSSDELVHDLTRRRIFSSC--MCTYLFFIAMDSSIILVIASKIASEFHELWRL 286
            PP +  +     +H +   +++++   +   LF  A+D  II      IA +F +  + 
Sbjct: 101 TPPGISRS-----LHTMAGIKLYTTIGSLTLVLFLAALDVLIISASIEVIAEQFKDYSKS 155

Query: 287 SLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCV 346
             ++S Y L+ A+                   ++   F  G  +S  S      I  R V
Sbjct: 156 GWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVV 215

Query: 347 TGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRN 406
            G GG  + +L   I +  +        +S    ++A+  V+GPF+     ++H + WR 
Sbjct: 216 AGIGGSGIQSLCFVIASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGAL-TTHVT-WRW 273

Query: 407 AFLIPVPFCLVNASIMLADMYS 428
            F I +P   + A ++LA +Y+
Sbjct: 274 CFYINLPIGGL-AFVVLAMVYN 294

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 61/149 (40%), Gaps = 2/149 (1%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D+ I+  I  ++A +F     +  + + Y L NA+                    A   F
Sbjct: 92  DTMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIF 151

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +S  +      I  R + G GG  + +L   I +   ++++    ++    +FA+
Sbjct: 152 EVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSNLVEESNRGVLIAILSCSFAI 211

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
             V+GPF+  +F S     WR  F I +P
Sbjct: 212 ASVVGPFLGGVFTSR--VTWRWCFYINLP 238

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 38.5 bits (88), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 66/159 (41%), Gaps = 12/159 (7%)

Query: 263 AMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQF 322
           A+D +II    +++AS F E   ++ V +AY+L+    Q                  A+ 
Sbjct: 65  AIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEV 124

Query: 323 SFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITF 382
            FI+G  L   +        AR + G GG  L A+ + I++  +        LS   I +
Sbjct: 125 VFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAP-------LSQRSIYW 177

Query: 383 AMGVVIGPFMMNLFDSSHGS-----GWRNAFLIPVPFCL 416
            +G +I  F  ++     G      G    F+I VPFCL
Sbjct: 178 GLGSLIWGFSQSIGGPLGGLLLNWFGVSGLFVIQVPFCL 216

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 73/176 (41%), Gaps = 31/176 (17%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++D+SI+  I +KIA EFHE  +   + +++LL+NA  Q                 I
Sbjct: 55  FLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLI 114

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKS----------TIMNRFSQKN 369
           AQ  F+LG  L+          FAR VT F     I              T+ +  + K 
Sbjct: 115 AQSFFLLGTLLT---------CFARNVTEFAIARAICGMGGGGIGAMSSITVSDICTTKE 165

Query: 370 DSRYSLSASMITFA---MGVVIGPFMMNLFDSSHGSGWRNAF---LIPVPFCLVNA 419
              Y   A++I  A   +G  +G  +M  F+      WR  F   ++ +  C++ A
Sbjct: 166 RGMYQGYANVIFGAGQVLGAPVGGLIMETFN------WRIIFAAQVVAIMICMILA 215

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 61/157 (38%), Gaps = 6/157 (3%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXX--XXXXX 316
           +F  A+D  I+  I   +   F +  +   +++ Y L NA+                   
Sbjct: 54  MFVTALDVLIVGTIIDTVCKTFGDYTKSGWIVTGYSLPNALFSLLWARLSAVLGPRISVV 113

Query: 317 XCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLS 376
            CI  F    G  +S  +      I  R V G GG  L  L   I  +   +      LS
Sbjct: 114 SCIILFE--AGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLVIGCQLVDEKSRPLVLS 171

Query: 377 ASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
               TFA+  ++GPF+   F ++H + WR  F I +P
Sbjct: 172 LLNCTFAVASIVGPFLGGAF-TTHVT-WRWCFYINLP 206

>KLTH0E06138g Chr5 (558501..560345) [1845 bp, 614 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 614

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 79/187 (42%), Gaps = 20/187 (10%)

Query: 231 PY-VENTSSDELVHDLT---RRRIFSSCMCTYLFF----IAMDSSIILVIASKIASEFHE 282
           PY V     D+ +H      R+R F   +C  L      +AM SSI      +I +++H 
Sbjct: 150 PYEVAFDGPDDPIHPYNWPMRKRAF---LCLLLGLNAVTVAMGSSIFASAVPQICAKYHV 206

Query: 283 LWRLSLV-ISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTFI 341
              + ++ ++ Y+   A                    I+ F F+L  + + ++    T +
Sbjct: 207 AQVVGVLGVTLYVFGFAASPVIYAPLSELYGRQKLLIISSFGFVLFMFATATAKDLQTIM 266

Query: 342 FARCVTGFGGGSLIAL-KSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSS- 399
             R   GF G + +A+  +   + F   N++R     +++ FAMGV +GP +  +F S  
Sbjct: 267 ICRFFAGFIGAAPLAIVPACFFDMFD--NETR---GTAVVVFAMGVFMGPILAPVFGSYI 321

Query: 400 -HGSGWR 405
              + WR
Sbjct: 322 VQHTTWR 328

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 60/149 (40%), Gaps = 2/149 (1%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D  I+  I  ++A +F     +  + + Y L NA+                    A   F
Sbjct: 83  DIMIVSTIIEEVAKQFGSYSEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIF 142

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +S  +      I  R + G GG  + +L   I +   +++     ++    +FA+
Sbjct: 143 EIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGSTLVEESQRGILIAVLSCSFAI 202

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
             V+GPF+  +F SS    WR  F + +P
Sbjct: 203 ASVVGPFLGGVFTSS--VTWRWCFYVNLP 229

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 6/157 (3%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXX--XXXXX 316
           +F  A+D  I+  I   + + F +  +   +++ Y L NA+                   
Sbjct: 54  MFVTALDVLIVGTIIDTVCTSFGDYTKSGWIVTGYSLPNALFSLLWGRLSAVLGPRISVI 113

Query: 317 XCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLS 376
            CI  F    G  +S  +      I  R + G GG  L  L   I  +   +      LS
Sbjct: 114 SCIILFE--TGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLVIGCQLVNEKSRPLVLS 171

Query: 377 ASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
               TFA+  ++GPF+   F ++H + WR  F I +P
Sbjct: 172 LLNCTFAVASIVGPFLGGAF-TTHVT-WRWCFYINLP 206

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 68/162 (41%), Gaps = 4/162 (2%)

Query: 252 SSCMCTYLFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXX 311
           S  +C  LF  A+D   +  I  +++ +F +  ++  + + Y L NA+            
Sbjct: 48  SLVLC--LFLAALDVMTVSTIIEEVSQKFGDYSKVGWLFTGYSLPNALLVLIWGRIATLV 105

Query: 312 XXXXXXCIAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDS 371
                   A   F +G  +S  +      I  R + G GG  + +L   I +   ++ + 
Sbjct: 106 GFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISSTLVEERNR 165

Query: 372 RYSLSASMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              ++    +F +  V+GPF+   F ++H + WR  F I +P
Sbjct: 166 GLIIAVMSSSFGIASVVGPFLGGAF-TTHVT-WRWCFYINLP 205

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 63/155 (40%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+      I+ +F++  +   ++S Y L  A+                   
Sbjct: 51  LFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLL 110

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
           ++   F  G  +S  S      I  R V G GG  + +L   I +  + +     ++S  
Sbjct: 111 LSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVL 170

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              +A+  V GPFM   F ++H + WR  F I +P
Sbjct: 171 SCAYAVAAVAGPFMGGAF-TTHVT-WRWCFYINLP 203

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 63/155 (40%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           +F  A+D  I+  I   +A EF +  +   + + Y L +A+                   
Sbjct: 65  IFLAALDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSML 124

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
            A   F +G  ++  +      I  R + G GG  +  L   I++   +++     ++  
Sbjct: 125 TAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEESKRGLLIACM 184

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              F +  V+GPF+   F ++H + WR  F I +P
Sbjct: 185 GSAFGIASVVGPFLGGAF-TTHVT-WRWCFWINLP 217

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 36.6 bits (83), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 93/207 (44%), Gaps = 15/207 (7%)

Query: 218 PQSIG-DVENGLNPPYVENTSSDELVH----DLTRRRI-FSSCMCTYLFFIAMDSSIILV 271
           PQS+  ++E+  N    +N+S +E  H    DL +  I FS  M ++L   A+D +I+  
Sbjct: 19  PQSLSLNLEDEFNR---KNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLG--ALDGTIVAN 73

Query: 272 IASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLS 331
           I +++A EF E  +   + +++LL+N   Q                 +A   F LG  L+
Sbjct: 74  IMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLT 133

Query: 332 WSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIG-P 390
             + +   F  AR + G GGG + A+ S  ++      +       + + F+ G ++G P
Sbjct: 134 CFARNVTEFSIARAICGIGGGGISAMSSITVSDICTARERGAYQGYANVVFSTGQLLGAP 193

Query: 391 FMMNLFDSSHGSGWRNAFLIPVPFCLV 417
                 D     GWR  F + VP  L+
Sbjct: 194 LGGFALDR---IGWRAIFGLQVPMLLI 217

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 45/203 (22%), Positives = 77/203 (37%), Gaps = 20/203 (9%)

Query: 265 DSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSF 324
           D  I++ +   I  +F +  R+  +++ Y L NA+                    +   F
Sbjct: 23  DIVIVITLYETIGEKFKDYARIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIF 82

Query: 325 ILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAM 384
            +G  +   S      I  R V G GG  + +L   +     ++ +    ++   + FA+
Sbjct: 83  EIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVVGTSLVEERNRGMVITVLGLAFAV 142

Query: 385 GVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMY-----SVKSTL------ 433
              +GP +   F  +    WR  F I +P   V A  ML   Y     SV+ TL      
Sbjct: 143 AFAVGPVIGGAF--TENVSWRWCFYINLPIGGV-ALTMLTFSYNTTEKSVQETLTYNCRQ 199

Query: 434 -----YGR-PTPTLWKRFKNTLL 450
                YG+  T + W+R  N L+
Sbjct: 200 LQTYRYGQWVTASFWRRAYNFLM 222

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 35.4 bits (80), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 56/142 (39%), Gaps = 4/142 (2%)

Query: 285 RLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFW-TFIFA 343
           R  L+ S + + NAIG                  +A   FI+G  +  +S   W  ++  
Sbjct: 115 RTGLLTSMFNIGNAIGCFFLGRLGDMYGRRIGLIVAAVIFIVGNIIQIASIRAWYQYMIG 174

Query: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSH--G 401
           R V G G G +  L   +++  + KN     +S   +   +G+ +G +  N     +   
Sbjct: 175 RIVAGVGAGLIAILSPMLISEVAPKNSRGAMVSCYQLMITLGIFLG-YCTNFGTKRYHNS 233

Query: 402 SGWRNAFLIPVPFCLVNASIML 423
           + WR    +   +CL   S M+
Sbjct: 234 TQWRVGVGLQFAWCLCMISAMM 255

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 70/183 (38%), Gaps = 9/183 (4%)

Query: 263 AMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQF 322
           A+D +I+    + +AS F +   ++ V +AYLL+    Q                   + 
Sbjct: 116 ALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEI 175

Query: 323 SFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKND-SRYSLSASMIT 381
            F +G  L   S        AR + G GG    A+ + I++  +  ++  +Y    SM+ 
Sbjct: 176 VFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSERGKYWGYGSMLG 235

Query: 382 FAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIMLADMYSVKSTLYGRPTPTL 441
              GV                G    F+  +PFCL  A++ L+  Y      Y + T   
Sbjct: 236 ---GVFQSLGGPLGGILLTYFGVSGLFIPQIPFCL--ATLYLSWKYVQD---YNQDTKGS 287

Query: 442 WKR 444
           WKR
Sbjct: 288 WKR 290

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 62/164 (37%), Gaps = 2/164 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I + +   I   F++   +  +++ Y L NA+                   
Sbjct: 17  LFLGALDIVICITLYDTIGKVFNDYANVGWLMTGYNLPNALCMLLWGRIASLVGLKNSLV 76

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
            +   F  G  L+  +      I  R + GFGG  +  L   +  R   +      ++  
Sbjct: 77  ASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFAVGTRMVDEKHRARVVTIL 136

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIM 422
            I + +    GPF+   F + H S WR  F I +P   V  +I+
Sbjct: 137 GIAYMLAEGAGPFIGGAF-AEHVS-WRWCFFINIPIGGVALAIL 178

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 34.7 bits (78), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 54/143 (37%), Gaps = 6/143 (4%)

Query: 285 RLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFW-TFIFA 343
           R  L++S + +  AIG                  IA   FI+G  +  +S   W  +   
Sbjct: 117 RTGLIVSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVGNVIEIASVEAWYQYFIG 176

Query: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIG---PFMMNLFDSSH 400
           R V G G G +  L   +++  S K      +S   +   MG+ +G    +    +D S 
Sbjct: 177 RIVAGVGMGVIAVLSPMLISEVSPKAMRGAMVSCYQLMITMGIFLGYCANYGTKTYDDSR 236

Query: 401 GSGWRNAFLIPVPFCLVNASIML 423
              WR    +   +CL   + ML
Sbjct: 237 --QWRIPLGLQFAWCLFMVAGML 257

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 42/193 (21%), Positives = 74/193 (38%), Gaps = 8/193 (4%)

Query: 223 DVENGLNPPYVENTSSDELVHDLTRRRIFSSCMCTYLFFIAMDSSIILV--IASKIASEF 280
           D ENG   P    T+    +  LT  R +       L        I++V  I   +A++F
Sbjct: 51  DSENGQAAPSEPETA----ISPLTGLRFYVCFASLALSLFLAALDILIVGTIMETVAAKF 106

Query: 281 HELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFWTF 340
           +       +++ Y L NA+                   ++   F +G  ++ ++      
Sbjct: 107 NGYSMTGWLVTGYNLPNALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTML 166

Query: 341 IFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSH 400
           I  R ++G GG  +  L   I +          ++S     FA+  V GPF+   F ++H
Sbjct: 167 IGGRVISGIGGSGIQTLCFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAF-ATH 225

Query: 401 GSGWRNAFLIPVP 413
            + WR  F I +P
Sbjct: 226 VT-WRWCFYINLP 237

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 46/176 (26%), Positives = 75/176 (42%), Gaps = 12/176 (6%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQ-XXXXXXXXXXXXXXXXC 318
           F +A+D +I+  + ++IA EF E  +   + +++LL+N   Q                  
Sbjct: 51  FLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAAL 110

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRF-SQKNDSRYSLSA 377
           +AQF F LG  +S  + +   F   R V G GGG + A+ S +++   + K    Y   A
Sbjct: 111 VAQFFFCLGLVISCFAQNVTQFAVGRAVCGIGGGGIAAMSSIVVSDICTAKERGMYQGYA 170

Query: 378 SMITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP---FCLV----NASIMLADM 426
           +++    G                 GWR  F I VP    C+V    N +I LA +
Sbjct: 171 NIV---FGSGQLLGAPLGGLLITTLGWRAIFAIQVPVTLLCMVLAFRNVNIKLAHL 223

>KNAG0H03180 Chr8 complement(595395..597428) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 35/73 (47%)

Query: 665 VGISLGGYVFHKTLIKLMHEKVMPFSKQGYLKKDLLKIIKHATESSDWVHESAPKFVFQT 724
           V I+    +F+  L K +   +     + + ++ L +I+  A ESS W+  SAP+F  +T
Sbjct: 583 VAITGASILFNVALRKSLWTALEQLVSEEHPQEQLQQILHRALESSHWIQHSAPEFAQET 642

Query: 725 LIECYLQACRNVF 737
           +   +      +F
Sbjct: 643 IYASFRHNFTTLF 655

>Kwal_55.20686 s55 (517314..519155) [1842 bp, 613 aa] {ON} YLL028W
           (TPO1) - polyamine transport protein [contig 140] FULL
          Length = 613

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 8/90 (8%)

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIAL-KSTIMNRFSQKNDSRYSLSA 377
           I+ F F+L  + + ++ +  T +  R   GF G + +A+  +   + +  +N        
Sbjct: 243 ISSFGFVLFMFATATAENLQTIMICRFFAGFVGAAPLAIVPACFFDMYDNENRG-----T 297

Query: 378 SMITFAMGVVIGPFMMNLFDSS--HGSGWR 405
           +++ FAMGV +GP +  +F S     + WR
Sbjct: 298 AVVVFAMGVFMGPILAPVFGSYIVQHTTWR 327

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 67/160 (41%), Gaps = 7/160 (4%)

Query: 260 FFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           F  ++D +I+  I +++A EF E  +   + +++LL+N   Q                  
Sbjct: 44  FIGSLDGTIVANIMNRVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRRFALLT 103

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A F F LG  L+  +     F  AR + G GGG + A  S  ++      +       + 
Sbjct: 104 AHFFFGLGCLLTCFAQSVEQFALARAICGIGGGGINACSSIAVSDICTAKERGSYQGYAN 163

Query: 380 ITFAMGVVI-GPFMMNLFDSSHGSGWRNAFLIPVP---FC 415
           I F  G ++ GP    L D+    GWR  F + VP   FC
Sbjct: 164 IVFGTGQMLGGPIGGLLIDT---IGWRAIFAVQVPIIMFC 200

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 53/141 (37%), Gaps = 2/141 (1%)

Query: 285 RLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFW-TFIFA 343
           R  L+ S + +  AIG                  +A F FI+G  +  +S   W  ++  
Sbjct: 112 RTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIG 171

Query: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGSG 403
           R V G G G +  L   +++  S KN     +S   +   +G+ +G          H S 
Sbjct: 172 RIVAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDST 231

Query: 404 -WRNAFLIPVPFCLVNASIML 423
            WR    +   +CL     ML
Sbjct: 232 QWRVGLGLQFAWCLCMIVAML 252

>TBLA0D05230 Chr4 complement(1285787..1286980) [1194 bp, 397 aa]
           {ON} Anc_1.322 YJL059W
          Length = 397

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%)

Query: 337 FWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFM 392
           FW  IF       GG S +     IM+  + K D  ++L A+ I  A+G++I   +
Sbjct: 319 FWILIFMFYQGFMGGASYVNTFLNIMDDITNKRDQEFALGATSIADALGILIAALI 374

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 36/155 (23%), Positives = 63/155 (40%), Gaps = 2/155 (1%)

Query: 259 LFFIAMDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXC 318
           LF  A+D  I+      I+ +F++  +   ++S Y L  A+                   
Sbjct: 51  LFLAALDILIMSASIEVISEQFNDYSKSGWIVSGYSLPEALLTLLWGRFATIFGFKLSLL 110

Query: 319 IAQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSAS 378
           ++   F  G  +S  S      I  R V G GG  + +L   I +  + +     ++S  
Sbjct: 111 LSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIASTLTTERSRGVAISVL 170

Query: 379 MITFAMGVVIGPFMMNLFDSSHGSGWRNAFLIPVP 413
              +A+  V  PFM + F ++H + WR  F I +P
Sbjct: 171 SCAYAVAAVASPFMGSAF-TTHVT-WRWCFYINLP 203

>SAKL0G19426g Chr7 complement(1670664..1671386) [723 bp, 240 aa]
           {ON} similar to uniprot|P40576 Saccharomyces cerevisiae
           YIR024C (putative) involved in cell cycle control
          Length = 240

 Score = 32.7 bits (73), Expect = 3.0,   Method: Composition-based stats.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 4/78 (5%)

Query: 3   KKDRQRKKLREFAKLKNRQRNLRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINENS 62
           +KD  RK + +    K  Q    +S+Q L N++ ++ +    + Q   G +K E  N NS
Sbjct: 124 RKDYSRKDIIDSLNFKPDQEE-EESLQALFNDIMKDIE---ETGQHLKGEEKQEGKNSNS 179

Query: 63  PLLSAPSKQEEVSIPKAV 80
             L  PS +EE+   + V
Sbjct: 180 SGLQQPSPKEEIVTDRKV 197

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 56/220 (25%), Positives = 88/220 (40%), Gaps = 16/220 (7%)

Query: 210 TSYGYGS---IPQ-SIGDVENGLNPPYVENTSSDELVH--DLTRRRIFSSCMCTYLFFIA 263
           TSYG  S   IP+ S+ ++EN      +     DE +   D+    I  + + T +F   
Sbjct: 16  TSYGSISETRIPENSLEELEN------IHGADEDEDIKLSDIPNLWIIEAALFTNVFLSG 69

Query: 264 MDSSIILVIASKIASEFHELWRLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFS 323
            D ++       I +EF+ +   S + +AYL+++   Q                  A  S
Sbjct: 70  FDGTVTASTYQTIGNEFNHMNISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTS 129

Query: 324 FILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSA-SMITF 382
           F +G      S +     F R +TG  GG  +   STI+N     +  R    A   +  
Sbjct: 130 FTIGCLACGLSPNIVVLSFMRALTG-IGGGGLITLSTIVNSDMIPSSKRGIFQAFQNLLL 188

Query: 383 AMGVVIGPFMMNLFDSSHGSGWRNAFLIPVPFCLVNASIM 422
            +G + G        SS   GWR  F + VP C+ N+ IM
Sbjct: 189 GLGAICGASFGGSIASS--IGWRWCFFVQVPICITNSLIM 226

>KAFR0G01580 Chr7 complement(348320..350839) [2520 bp, 839 aa] {ON}
           Anc_3.323 YBR086C
          Length = 839

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 24  LRKSVQTLKNEVQREAKVPRTSNQIALGNDKIEEINE 60
           LRK + TL N++  E  +P T N   LGN+ I +INE
Sbjct: 567 LRK-LYTLSNDMTPEGIIPMTENATLLGNENITKINE 602

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 52/141 (36%), Gaps = 2/141 (1%)

Query: 285 RLSLVISAYLLSNAIGQXXXXXXXXXXXXXXXXCIAQFSFILGGYLSWSSAHFW-TFIFA 343
           R  L+ S + +  AIG                  +A   FI+G  +  +S   W  ++  
Sbjct: 119 RTGLLTSMFNVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIG 178

Query: 344 RCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSHGS- 402
           R + G G G +  L   +++  S KN     +S   +   +G+ +G          H S 
Sbjct: 179 RIIAGLGCGLIAILSPMLISEVSPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKKYHNSR 238

Query: 403 GWRNAFLIPVPFCLVNASIML 423
            WR    +   +CL     ML
Sbjct: 239 QWRIPLGLQFAWCLFMIGAML 259

>KLLA0F18106g Chr6 (1657556..1659325) [1770 bp, 589 aa] {ON} similar
           to uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton-motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 589

 Score = 32.0 bits (71), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 9/148 (6%)

Query: 262 IAMDSSIILVIASKIASEFHELWRLS--LVISAYLLSNAIGQXXXXXXXXXXXXXXXXCI 319
           I M SSI     + I SE +E+  +   L I+ Y+L  A                    I
Sbjct: 160 ITMGSSIFASAVTTI-SEIYEVANVVSILGITLYVLGFAASPVIYAPLSELYGRQGVLLI 218

Query: 320 AQFSFILGGYLSWSSAHFWTFIFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASM 379
           A F F L  +   ++ +  T +  R   GF G + +A+   +   FS   D+    +A +
Sbjct: 219 ASFGFALFQFAVATAENLQTILICRFFGGFIGAAPLAV---VPASFSDMFDNTQRGTA-V 274

Query: 380 ITFAMGVVIGPFMMNLFDSS--HGSGWR 405
             FA+GV +GP +  +F S     + WR
Sbjct: 275 TMFALGVFVGPILAPVFGSYIVQYTSWR 302

>YOR092W Chr15 (495127..496968) [1842 bp, 613 aa] {ON}
           ECM3Non-essential protein of unknown function; involved
           in signal transduction and the genotoxic response;
           induced rapidly in response to treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 613

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 97  DDSPQDEVNSIKGKPADKANEDDLKPPSQHEACGNSALQSSITDFSDRSVSPLQSITSCN 156
           DDS Q     I+G  +  +N+D LK P++     NS+  S I++ + +  + L      +
Sbjct: 185 DDSAQQPTQPIEGNSSSSSNQDILKEPNE-STVPNSSQASYISEKNKKEKTEL------S 237

Query: 157 TPMSEHELPVSSSNSFERADDMPVVQADNQTSSSKSLHIVAPS 199
            P   H  P +  +    ++   VV  D+ T S ++ H+ A S
Sbjct: 238 VPKPTHTAPPAIDD--RSSNSSAVVSIDSITHSLRTNHVDAQS 278

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 31.6 bits (70), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 34/73 (46%), Gaps = 2/73 (2%)

Query: 341 IFARCVTGFGGGSLIALKSTIMNRFSQKNDSRYSLSASMITFAMGVVIGPFMMNLFDSSH 400
           I  R + G GG  + +L   I +         + ++    +F +  VIGPF+   F +SH
Sbjct: 151 IGGRVIAGIGGSGIQSLSFVIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAF-TSH 209

Query: 401 GSGWRNAFLIPVP 413
            + WR  F I +P
Sbjct: 210 VT-WRWCFWINLP 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,015,151
Number of extensions: 3283130
Number of successful extensions: 13640
Number of sequences better than 10.0: 324
Number of HSP's gapped: 14083
Number of HSP's successfully gapped: 354
Length of query: 768
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 651
Effective length of database: 40,065,477
Effective search space: 26082625527
Effective search space used: 26082625527
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)