Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR117C (TMA64)8.269ON56555726730.0
Skud_4.3778.269ON56256422570.0
Suva_2.2768.269ON56555722540.0
Smik_4.3618.269ON56555721810.0
NCAS0B038008.269ON56555916630.0
TDEL0F039608.269ON55855816390.0
ZYRO0C01496g8.269ON56755915780.0
NDAI0J013108.269ON57957615110.0
TPHA0J007808.269ON58357014980.0
KAFR0B054708.269ON56256114710.0
CAGL0B01837g8.269ON56956414700.0
Kpol_392.28.269ON56656514620.0
KLTH0G13530g8.269ON57456314460.0
SAKL0H16874g8.269ON56355814420.0
Kwal_56.237718.269ON56255814080.0
TBLA0I032008.269ON56357112371e-164
Ecym_43018.269ON56457211761e-155
KLLA0F19294g8.269ON57056311661e-153
KNAG0H032008.269ON56156811481e-151
AGR079W8.269ON54256810851e-142
Kpol_1060.75.10ON146088780.82
NCAS0A029304.25ON22654722.7
NDAI0G010903.454ON45664723.3
Smik_5.3468.240ON24433704.2
Kwal_0.701.343ON772134698.8
TBLA0A082504.207ON1357142699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR117C
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...  1034   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   874   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   872   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   844   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   645   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   635   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   612   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   586   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   581   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   571   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   570   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   567   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   561   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   560   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   546   0.0  
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   481   e-164
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   457   e-155
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   453   e-153
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   446   e-151
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   422   e-142
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...    35   0.82 
NCAS0A02930 Chr1 complement(566085..566765) [681 bp, 226 aa] {ON...    32   2.7  
NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454     32   3.3  
Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}...    32   4.2  
Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON} YJL...    31   8.8  
TBLA0A08250 Chr1 (2029817..2033890) [4074 bp, 1357 aa] {ON} Anc_...    31   9.8  

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score = 1034 bits (2673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/557 (91%), Positives = 508/557 (91%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           LEPPFVLSTQSKD               AVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TIVGKNTDKDELKNFVPYKLGC                  GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540
           MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540

Query: 541 DHLNKLGIPSKWIDFEN 557
           DHLNKLGIPSKWIDFEN
Sbjct: 541 DHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/564 (75%), Positives = 466/564 (82%), Gaps = 3/564 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT +KQTNN+EY+F TSTIKQTNF  QKSVG VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKH EQLFPTVYSCWE P LLPI+LTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R K+GTLCG+AS++AP+ VLAIGIVE+DLPS+D+V+GETGVAVK+IHHFNDGLSK  K+K
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           L+PP     +S D                VE  QE++++A V VEE+AEVLDHF+VSDVD
Sbjct: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           YFITRALYYTLTQDK L LPIS SNFISNHIMRNLPPIDHNEVNVKKTSW+KSAKFLKH 
Sbjct: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHF 297

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TIVGK  DKDELKNFVPYK+G                   GMMYS
Sbjct: 298 EKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           +TLYKPF++AKD LKE NL   TYYTSQDIRSA+SQYIS  NLADTKDKGKV+MDDLLF+
Sbjct: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           MVNKKKK LNA+RI+ R +IL PLL NNFTEFYQIFK+DD+LLFKAP+KGS P IKI TE
Sbjct: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540
           MKIGRKVITRVSNFEVFQ+DPESLA DLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537

Query: 541 DHLNKLGIPSKWIDFENKLKKKKR 564
           DHLN LG+P+KWIDFENKLKKKKR
Sbjct: 538 DHLNNLGVPNKWIDFENKLKKKKR 561

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  872 bits (2254), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/557 (75%), Positives = 462/557 (82%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT +KQTNNEEY+F TSTIKQTNF+GQKS+GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NNTPILFKEKH EQLFPTVYSCWE   LLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RCKIGTLCG+AS+QAP+ VLA+GIVE+DLPS+ +VIGETGVAVKI+HHFNDGLSK FK+K
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           LEPP      S+D                 EK +E+V+EA++++EEIAEVLDH +VSDVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           YFITRALYYTLTQDK L LPISASNFISNHIMRNLPPIDHNEVNVK+TSWKKSAKFLKH 
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TIVGKNTDKDELKNFVPYKLG                   GMMYS
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           LTLYKPFNLAKDL+KE NL   TYYTSQDIRSA++QYIS+KNL D KDKGKV+MDDLL++
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           MVNKKKK  + +R+I R +IL PLL NNFTEFYQI+K+DDTLL + PMKGS P IKIITE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540
           MKIGRKVIT+VSNFE  Q+DPE LAADLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540

Query: 541 DHLNKLGIPSKWIDFEN 557
           DHLNK G+P+KWIDFEN
Sbjct: 541 DHLNKSGVPNKWIDFEN 557

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/557 (75%), Positives = 463/557 (83%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT  KQTNNEEY+F TS IKQTNF GQKSVGTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PILFKEKH EQL+PTVYSCW+ P+LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RC +GTLCG+A KQ+P+ VLAIG+VELDLPS+D+VIGETGVAVK+IHHFNDGL K FK+K
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           LEPP VL+T+S+D               + +K QE +K+ + D+EE+AEVLDH TVSDVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           YFITRALYY+LTQDKGL LPISAS FISNHIMRNLPPIDHNEVNVKK+SWKKSAKFLKH 
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TIVGKNTDKDELKNFVPYKLGC                  GMM+S
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           LTLYKPF+LAKDLL+E  L   TYYTSQD+R+AVS+YISVKNLAD KDK KV+MDDLLF+
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           MVNKKKK  + +RIIAR EIL PLL+NNFTEFYQIF++DDTLLF+ PMKG  P IKI+TE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540
           MKIGRKVIT+VSNFEVF +DPE LAADLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540

Query: 541 DHLNKLGIPSKWIDFEN 557
           D+LNK GIPSKWIDFEN
Sbjct: 541 DYLNKSGIPSKWIDFEN 557

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/559 (58%), Positives = 393/559 (70%), Gaps = 5/559 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++Y+   S +KQTNF    ++GT+YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTC-PSIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH  +L+ TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCKIGTLCGIASKQAP-ETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179
           + K+GTLCG+AS Q P   V AIGIV +DLP F+KV+GE+GVAV+IIHHF D L K FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDV 239
            L+PP V   +                    E E       + +VE++AEVLDH +V DV
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQDV 239

Query: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 299
           DYFITRALYYT+T D  L LPISASNFIS HI +NLP +DHNEVN+KK+SWKK+AKFLKH
Sbjct: 240 DYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLKH 299

Query: 300 XXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMY 359
                           T+VG N  KDELKNFVPYKLG                   GMMY
Sbjct: 300 FEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQS--GMMY 357

Query: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419
           S+T YKP NLAKDL+KE  +     Y   +IR  V+ YI++KNL D K+K  V++DDLLF
Sbjct: 358 SITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLF 417

Query: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479
            MVNKK+     SR I+R +IL P L NNFTE +QI+ S  T LFK+PM+GS P IKI+T
Sbjct: 418 GMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKILT 477

Query: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538
           EMKIGRKVIT+VSNFE F ++PE+LAADLRK+CSGSTTI E+ T  K AEVQVQGPHGQ 
Sbjct: 478 EMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQI 537

Query: 539 IIDHLNKLGIPSKWIDFEN 557
           IIDHLNKLG+P+KWID+EN
Sbjct: 538 IIDHLNKLGVPTKWIDYEN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/558 (56%), Positives = 396/558 (70%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQ+ ++QT   +Y+F TS +KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FKEKH E LFPTVYSCW  P LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RC    +CGIAS+  P+ +LAIG+V+L+LPS+  VIG+ G+AVK++H+F DGL + FK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           +EP  VLS++                    E  + +     + +E++A+VLD  +V DVD
Sbjct: 181 IEPA-VLSSEPV-----EEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDVD 234

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           +F TRALYYT T D GL +PI+ASNFISNHI+ NLPP+D ++VN+KKTSWKK+AKFLKH 
Sbjct: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                           IVG N +KDELKNFVPYK                     GMMYS
Sbjct: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK----TSGQTASKKNSNKDSSPGMMYS 350

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
             LYKP NL KD ++  +L     YT  +++ +V+QYI+ K L D+K+K  V++DDLLFD
Sbjct: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFD 410

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           M  +KKK     R ++R +I+ P + NNFTEFYQ+FK +DT LFK P++G LP +KI+TE
Sbjct: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQSI 539
           MKIGRKV+TRVS+FE F++DPE LAA+LRK+CSGSTTI E+ T  K AEVQVQG HG  I
Sbjct: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530

Query: 540 IDHLNKLGIPSKWIDFEN 557
           ID+LNK GIP+KWIDFE+
Sbjct: 531 IDYLNKQGIPTKWIDFES 548

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/559 (54%), Positives = 395/559 (70%), Gaps = 5/559 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK+PH+KALSNLKNSE KKLL T + QT N+EYSF T  IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH   L+PTV++CW +P LLP+VLTHGFV+EE LFNGANLM++G++ PFD 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R K GT+CGIASK AP+ V+A+G+V+LDLPS+D V+G+TGVAV+++H+  DGLSKVFK+ 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
            EPP  L    ++               +   ++   +E +VD+++IAEVLD F + DVD
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPS--SQEIPSQEKAVDIDDIAEVLDEFRLEDVD 238

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
            F+TRALYYTLT D  LELPISASNFISNHI  NLP +DH +VNVKK+SWKK+AKFLK+ 
Sbjct: 239 QFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLKNF 298

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TI+G N  K EL+NF PY++                      +  
Sbjct: 299 EKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQLRC 358

Query: 361 LTLYKPFNLAKDLLKEVNLASH-TYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419
            TLYKP NLAKD +++ +L      YT+Q++++A++ YI+  NLAD+K+K  VI+DDLL+
Sbjct: 359 ETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDLLY 418

Query: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479
            +VNKK+K   A R+++R  I+ PLL N+FT  +QI+K  D  LFK P +G+LP+I+I+T
Sbjct: 419 HLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEIVT 477

Query: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538
           EMKIGRKVITRVS FE+F +D + LAA LR++CSGSTTI E+ T  K  EV VQGPHG  
Sbjct: 478 EMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHGPL 537

Query: 539 IIDHLNKLGIPSKWIDFEN 557
           IIDHLN LGIP+KWI F+N
Sbjct: 538 IIDHLNSLGIPTKWIKFDN 556

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/576 (55%), Positives = 395/576 (68%), Gaps = 29/576 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTI-KQTNFN--GQKSVGTVY 57
           MFKKEPHIKALSNLKNS+RKKLLQT + QTN E Y+F  S I KQTNF      S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDENNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
           T+++N PI FK KH + L+PTV++CW    +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDPRCKIGTLCGIASKQAPETVL-AIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKV 176
           FD R   GTLCGIAS Q P+ ++ AIG+V++++PSFDKV+GETGVAV++IHHF D L K+
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKMK-LEP-PFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHF 234
           FK   L+P  FV     K+                  +++E+ +E++   E   EVLDHF
Sbjct: 181 FKCNDLKPDEFV-----KEQLNTEHPQDNDVADEDTTRKKEENRESN---EPDFEVLDHF 232

Query: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSA 294
              DVDYFITR+LYYT+TQD  +ELPISASNFIS HI +NLP I HNEVN+KKTSWKK+A
Sbjct: 233 KTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKTA 292

Query: 295 KFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLG--CXXXXXXXXXXXXXXX 352
           KFLKH                T+VG N  KDELKNFVPYK+G                  
Sbjct: 293 KFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDKS 352

Query: 353 XXXGMMYSLTLYKPFNLAKDLLKEV-NLASHTYYTSQDIRSAVSQYISVKNLADTKDKGK 411
              GMMYS T YKP N AKDLLK V  + +   YT Q+IR  V+ YI+ KNL D K+K  
Sbjct: 353 DTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKKM 412

Query: 412 VIMDDLLFDMVNKKKKVLNAS-RIIARGEILHPLLTNNFTEFYQIFK---------SDDT 461
           +++DDLLF+MV+K++   NA+ R + RG IL P+L NNFTE YQI++          D  
Sbjct: 413 ILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDVE 472

Query: 462 LLFKAPMKGSLPHIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISES 521
            LFK+P +G LP I I+TEMKIGRKVIT+VSNFE+F +  + LAADLRK+CSGSTTI E+
Sbjct: 473 PLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGET 532

Query: 522 QTF-KCAEVQVQGPHGQSIIDHLN-KLGIPSKWIDF 555
            T  K  EVQVQGPHGQ IIDHLN K G+P+KWI++
Sbjct: 533 MTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/570 (50%), Positives = 388/570 (68%), Gaps = 7/570 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+ ++Q N+ +Y+F +S IKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH + LFP+VY+CW+ P LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R   G LCGIAS + P  V+AIGIV+LDL S+ KV+GETGVAV ++H+  DGLS  FKM 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           LEPP     +  +                +    +D+   +   +++AEVL+   V  +D
Sbjct: 181 LEPPET-GAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDIID 239

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
            FIT++LYY+LT D  LE PISASNFISN+IM NLPP+D++ VN+KK+SWKK+AKFL+H 
Sbjct: 240 DFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRHF 299

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                           I G N +K ELK+FVPY+ G                    MM S
Sbjct: 300 EKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQS 359

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           ++ YKP +L KDL++E      + YT+ ++R  +++YI+ KNL D+K+K  ++MDDL++ 
Sbjct: 360 VSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMYS 419

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDT----LLFKAPMKGSLPHIK 476
           +V KKK      R+I+R +++ P+  NNF E +QI+K  D      LFK P++GS+P ++
Sbjct: 420 LVYKKKNSAEP-RLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478

Query: 477 IITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPH 535
           I+TEMKIGRKVITRVSNFEVF +D E+LAADLRK+C+G+TTI E+ T  K AEVQVQGPH
Sbjct: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538

Query: 536 GQSIIDHLNKLGIPSKWIDFENKLKKKKRK 565
            Q II HLN L IP+KWIDF+N +K K++K
Sbjct: 539 SQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  571 bits (1471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/561 (51%), Positives = 375/561 (66%), Gaps = 12/561 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQ-TNNEEYSFRTSTIKQTNFNGQKSVGTVYTD 59
           MFKKEP IKALS LKNS+RKKL+Q+ + Q  ++E+ S    +I QTNF    + GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  ENNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
            N+ PI+FK KH + L+PT +  W    LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179
               IGT+C +A+K+AP+  +A+GIV+L+LP + +V+G+TGVAV+I+HHF D L   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKE---ASVDVEEIAEVLDHFTV 236
           KLE P  + +  ++                 E+E + V E    S   ++IAEVLD  TV
Sbjct: 181 KLEIPASVKSILQEETTADVAKESD-----AEQESQSVTEPPSGSEGPDDIAEVLDELTV 235

Query: 237 SDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKF 296
            DVDYFI RALY+T+ QD  L LP+ AS F+SNHIMRNLP +DH +VN+K+TSWKK+AKF
Sbjct: 236 EDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKF 295

Query: 297 LKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXG 356
           LK+                 IVG N DKDELKNFVPYK+G                    
Sbjct: 296 LKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGVS- 354

Query: 357 MMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDD 416
            + S+ LYKP NL +  +KE N++    YTS +IR+ ++ YI  KNL D KDK  V++DD
Sbjct: 355 -VSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLDD 413

Query: 417 LLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIK 476
           LLF MVN+K +     RII R  IL PL+ NNF E++Q++K D+T LFK P+KG  P I 
Sbjct: 414 LLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPKID 473

Query: 477 IITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHG 536
           I+TEMKIGRKV+TRVSNFE F++ PE LAADLRK+CSGSTTISE+   K +EVQVQGPHG
Sbjct: 474 IVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQGPHG 532

Query: 537 QSIIDHLNKLGIPSKWIDFEN 557
           Q IIDH NK GIPSK+I FEN
Sbjct: 533 QLIIDHFNKSGIPSKFIQFEN 553

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  570 bits (1470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/564 (53%), Positives = 385/564 (68%), Gaps = 13/564 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKL +  + QT+NEEYSF ++TIKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH E+L+PTV +CW  P L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R  +GT+CGIA K+ P  ++A+GIV+++LPSF +VIGETGVAV+I+HH  D L KVFK+K
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LEPPF-VLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDV 239
            EPP  +L TQS                  VE   +  KE S +++++AEVLD   + D+
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKS-NLDDMAEVLDELRLEDI 239

Query: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPP-IDHNEVNVKKTSWKKSAKFLK 298
           DYFITRALYYT++QD  LE P SASNF+SNHI  NLP   +  EVN+KK+SWKK+AKFLK
Sbjct: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLK 299

Query: 299 HXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMM 358
           H                TIV  N DKDE+K F+PY +                      +
Sbjct: 300 HFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPV----IGNQGSNTGSEGGNAKTTI 355

Query: 359 YSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLL 418
             +TLYKP NLAKD +    +     Y   +I+  +++YI++K+L D KDK  V++DD+L
Sbjct: 356 KIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDML 415

Query: 419 FDMVNKKKK-VLNASRIIARGEILHPLLTNNFTEFYQIFK---SDDTLLFKAPMKGSLPH 474
             M+ KKK+     SR+I R  IL P+L NNF + Y +F+   ++ T L K P+KG  P 
Sbjct: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475

Query: 475 IKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISE--SQTFKCAEVQVQ 532
           I I+TEMKIGRKVIT+VSNFEVFQ+DPE  AAD+RK CSGSTTI E  S   K AEVQVQ
Sbjct: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQ 535

Query: 533 GPHGQSIIDHLNKLGIPSKWIDFE 556
           GPHGQ I+ +LN LGIP+KWIDFE
Sbjct: 536 GPHGQLIMSYLNDLGIPNKWIDFE 559

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/565 (53%), Positives = 381/565 (67%), Gaps = 4/565 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+ + QT + +Y+F TS IKQTNFN Q SVG +YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
             +P+ FKEKH E LFPTVY+CWE P LLPIVLTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R    T+CGIA++  P T++A+G+V+LD+PS+  VIG+TGVAV ++H++ DG+S  FKMK
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKE-ASVDVEEIAEVLDHFTVSDV 239
            + P ++  + K                  + E + + E +S DV E+A+     TV D+
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 299
           D+FITR+LYYTLT D  L  PI +S+FISNHIMRNLPP+DHN VN+KKTSWKKS+KFLKH
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 300 XXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMY 359
                           TIVG N +K+ELK F PY++                     MMY
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRI-SNSSSNSGKKINSNRQESENMMY 359

Query: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419
           SL  Y P   AK  +    L    +YT+ ++++AV++YI  K L D K+     +DD L+
Sbjct: 360 SLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLY 419

Query: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479
           DM   KK   N  R I R  ++    TNNFTE YQ+FK+DDT L K P++GS P IKI+T
Sbjct: 420 DMCYTKKST-NPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVT 478

Query: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538
           EMKIGRK++TRVSNFE F +D ++LA DLR++CSGSTTI E+ T  K  EVQVQGPH + 
Sbjct: 479 EMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKI 538

Query: 539 IIDHLNKLGIPSKWIDFENKLKKKK 563
           IIDHLN L IP+KWIDFENKLK KK
Sbjct: 539 IIDHLNSLSIPTKWIDFENKLKPKK 563

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/563 (50%), Positives = 373/563 (66%), Gaps = 8/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEP IKALSNLKNSERK +    ++QT + EY+F +  IKQT F    + GTV+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK  + L+PTV++CW    LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RC    +  +AS  AP+ V AIGIV+++LP + +VIGE+GVAV+I+H F D L KVFK+K
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LEPP----FVLSTQSKDXXXXX--XXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHF 234
           L+PP     +L ++S++                 A  K  +DV+E  V+VE+I+E L   
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSA 294
            V DVD+F TR+LYY+L  D  LE PISASNF+SNHI+RNLPPIDH +VN+KKTSWKK+A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 295 KFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKL-GCXXXXXXXXXXXXXXXX 353
           KFLK+                TI+G +  K ELKNF PY++ G                 
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 354 XXGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVI 413
              +M +++LY+P +  K  L   +L  +  +T QDI+SAV +YIS KNL    +K  V 
Sbjct: 361 QASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAVR 420

Query: 414 MDDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLP 473
           +DDLL+D+VN+  K  NA R IAR +I+ P+L  NF+E + I K+D T LFK P+KGS+P
Sbjct: 421 LDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSIP 480

Query: 474 HIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQ 532
            ++I+TEMKIGRKV+T+VSNFE FQVD + LA  LRK CSGSTTI E+ T  K  EV VQ
Sbjct: 481 QVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTVQ 540

Query: 533 GPHGQSIIDHLNKLGIPSKWIDF 555
           GPHG ++I+ LN+ GIP+KWI+F
Sbjct: 541 GPHGPAVIELLNESGIPTKWINF 563

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/558 (51%), Positives = 377/558 (67%), Gaps = 9/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL + ++Q    +Y F T  +KQT F GQ S GTVYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEKH   +FPTV++CW  P +LP+V TH  V+EE L  GA+LM+ G +PPF  
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           +C  G+L G+AS ++P  + AIGIV+LDLPS+ +VIGETGVAV IIH F+DGL K FKMK
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LEPPFVLS-TQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDV 239
           LEPP  +  T SK                A+       +   V+ E+ +E L+  +  D+
Sbjct: 181 LEPPEAIEDTSSKTEEQEEEHVDSADEAKAIAT---TTQARMVNTEDASEQLNELSAEDI 237

Query: 240 DYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKH 299
           D+F+TR+LYYTLTQD  L+LP++ASNF+SNHI+ NLPP+DHN++N+KK+SWKKSAKFLKH
Sbjct: 238 DHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFLKH 297

Query: 300 XXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMY 359
                            +VG N DKDELK FVPY++G                    MM 
Sbjct: 298 FEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGS---HGEPTQTKAKAQENSNMMQ 354

Query: 360 SLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419
           +++LYKP + AK+  K V+L  +  +T+Q++++A+  YI  KNL +  DK  V++DD LF
Sbjct: 355 AVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTLF 414

Query: 420 DMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIIT 479
            M+N+  K  NA R I+R +I+ P L NNFTE +QI K  D  LFK  +KG++P I+I+T
Sbjct: 415 PMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIVT 473

Query: 480 EMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQS 538
           EMKIGRKV+T+VSNFE FQ+D E+LAA+LRK CSGSTTI E+ +  K  EV VQGPHG  
Sbjct: 474 EMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGAI 533

Query: 539 IIDHLNKLGIPSKWIDFE 556
           +I  LN+ GIP+KWI+F+
Sbjct: 534 VIGMLNEYGIPTKWINFQ 551

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  546 bits (1408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/558 (49%), Positives = 362/558 (64%), Gaps = 6/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEP IKALSNLKNSERKKL    ++Q    +YSF +  IKQT F    + GTVYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
            N PI FKEK  + L+PTV+SCW    L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           RC    + G+AS  +P+ V AIGIV+L+LP + +VIGE+GVAV+I+H F+D L K FK+K
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
           L+PP      ++                   K    ++E  V++++ AE L   +V DVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           +F TRALYYTLTQD  LE+P SASNF+SNHI+RNLPP+DH +VN+KKTSWKK+AKFLKH 
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          TIVG +  KDELK+FVPY+                      MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYR-----TGGNSGGSTGSESEQNSMMKA 355

Query: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420
           L +YKP + AK  L   +L+ ++ ++ Q+++ AV  YI+ K L    +K  V +DDLLF 
Sbjct: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415

Query: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480
           +VN+  K  NA R I R +I+ P+L  NF E + + K D T LFK P+KG +P I+I+TE
Sbjct: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475

Query: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTF-KCAEVQVQGPHGQSI 539
           MKIGRKV+T+VSNFE FQVD + LA  LRK CSGSTTI E+ T  K  EV VQGPHG ++
Sbjct: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAV 535

Query: 540 IDHLNKLGIPSKWIDFEN 557
           I+ LN+L IP+KWI+F N
Sbjct: 536 IELLNQLAIPTKWINFVN 553

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  481 bits (1237), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 247/571 (43%), Positives = 352/571 (61%), Gaps = 15/571 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK   I  LSNLKNSE + + QT +   +N EY F  S +KQT F    + G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN PI FK+K+   + PTVY+ WEYP  +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
           R K G +CGIAS + P T+LAIG+   D+ + D  +G+TGVAV+++H ++D L+ +FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEA------SVDVEEIAEVLDHF 234
           L PP +++T   +                 E E E   +A      + + +++AE L+  
Sbjct: 181 LNPPTIMNTS--NLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQL 238

Query: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSA 294
            V D+D F+T++LYYT+TQ+  L+LPI +S F+S ++M+NLP +DHN+VN+KK+SWKK+A
Sbjct: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298

Query: 295 KFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXX 354
           KFLKH                TI G N +K +LK FVPY++G                  
Sbjct: 299 KFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIG----KPAGALPSKDKQDN 354

Query: 355 XGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIM 414
              +  +TLY P          + L S +Y+TS +I SA+  YI+ KNLA+ KDK K+ M
Sbjct: 355 KNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISM 414

Query: 415 DDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPH 474
           DD+LFD+V    K  NA+R I R +++ P+L NNF  ++Q+F  D+  L K P KGS P 
Sbjct: 415 DDVLFDLVITNNKA-NANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPT 473

Query: 475 IKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGP 534
           +K++TE     KVITRVSNFEVF +D + ++ +L+ +CSGST+I E      +EVQVQGP
Sbjct: 474 VKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEVQVQGP 531

Query: 535 HGQSIIDHLNKLGIPSKWIDFENKLKKKKRK 565
           HG  ++++  K GIP KW D+ NK+K KKR+
Sbjct: 532 HGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  457 bits (1176), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 240/572 (41%), Positives = 353/572 (61%), Gaps = 16/572 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK+P IK+ SNLKNSERKKLL   + Q  N+E+ F T+ +KQ  F    + GT++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           +N PI FKEKH E L PT+ +CW+YP LL +VLTH  V++  L NGA+LM+ G+IPPF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
            C  G L G+AS + P  V AIG+ +L+L    KV+GETGVAVK++H  NDGL +VFKM 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LEPPF-VLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVE------EIAEVLDH 233
           +EPP  +L +Q  +                 +++    K AS  +E      E+AE L+ 
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 234 FTVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKS 293
            ++  VD+F+T+A+YYTL  D  L+LPI ASNFI+NH+M+NLP I   +V++K++SW ++
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 294 AKFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXX 353
           +KFLK+                T+V  N DK E+K+F PY+                   
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR------TIQKSVSTSSKNN 354

Query: 354 XXGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVI 413
               +  +  Y+P N AK  L  +    +    ++DI++ +++Y++ K L +  D+  ++
Sbjct: 355 DKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIIL 414

Query: 414 MDDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLP 473
           +DD LF +   KK   +++R + R ++   +L+ +FTE + IFK D   L   P+K    
Sbjct: 415 LDDTLFSLA-YKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKNR 472

Query: 474 HIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKC-AEVQVQ 532
           ++ ++TEMKI RK++TR+SNFE++ VDPE L+ +LRK CSGS+T+ E  T +   EVQVQ
Sbjct: 473 NVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQ 532

Query: 533 GPHGQSIIDHLNKLGIPSKWIDFENKLKKKKR 564
           GPHG + I+ LN+ GIPSK+IDF+NKL KKK+
Sbjct: 533 GPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  453 bits (1166), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 245/563 (43%), Positives = 340/563 (60%), Gaps = 9/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MF KEPHIK LSNLKNS+RKKL  T ++Q N EEY+  T+ IKQT+F      G++YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPA-LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
           +N PI FK K ++QL+PT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179
              K G++ GIAS + P  V AIGI E+DL     VIG  G+AV+++H+ +DGL K FK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVD--VEEIAEVLDHFTVS 237
           +LEPP V+   S+                 +++E   ++ +S    V EIA+ L+  ++ 
Sbjct: 180 ELEPPAVV-YNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238

Query: 238 DVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFL 297
           DVD+ + RA+ Y++  D  + LPI AS FISNH+M+NLP +D N VN+KK+SWKK+ K L
Sbjct: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298

Query: 298 KHXXXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGM 357
           K+                T++  N +  +L N   YK                       
Sbjct: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358

Query: 358 MYS-LTLYKPFNLAKDLLKEVNL-ASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMD 415
            YS   LYKP +  +  +  +      +YYT Q+++  +  Y++  NL D ++K  V  D
Sbjct: 359 AYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYD 418

Query: 416 DLLFDMVNKKKKVLNASRIIARGEILHP-LLTNNFTEFYQIFKSDDTLLFKAPMKGSLPH 474
           D L+ M N+  +     +I ARG I+ P  L+ NF  ++QI+K +   L K P KG +P 
Sbjct: 419 DTLYQMSNRAPQNGGIQKI-ARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477

Query: 475 IKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGP 534
           ++I+TE KIGRKVITRV+NFE F++D E LAA LRK CSGSTTI ES++ K AEVQVQGP
Sbjct: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537

Query: 535 HGQSIIDHLNKLGIPSKWIDFEN 557
           HG  +I  LN  GIP+KWI FEN
Sbjct: 538 HGSIVISILNDYGIPTKWISFEN 560

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  446 bits (1148), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 250/568 (44%), Positives = 342/568 (60%), Gaps = 27/568 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKK PHIK LSNLKNSE++KL Q  QKQ   +E+ F  +T+KQTNF    SVGT+Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NNTPI--LFKEKHKE-QLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
              P+   FKEKH    L+P+VY+CW +P LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKI--IHHFNDGLS 174
           FD      G  CGIA+ ++P+ ++A+G +++DL  F+         V +   HHF DGL+
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KVFKMKLEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHF 234
             F++KL+ P  L + +                  VE +        V V+++AEVL+  
Sbjct: 181 DAFRLKLDIPDKLESAT---------TQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLETL 231

Query: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPP-IDHNEVNVKKTSWKKS 293
           +V DVDYF+TRALYYTLTQ+  L LPI+ASNF+S H+M+ LP  ID  EVNVKK+SWKK+
Sbjct: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291

Query: 294 AKFLKHXXXXXXXXXXXXXXXXTIVGKNTDKDE--LKNFVPYKLGCXXXXXXXXXXXXXX 351
           AK+LKH                 +VG    K    LK+FVPY +G               
Sbjct: 292 AKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVG----NSIAESGPKSQ 347

Query: 352 XXXXGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGK 411
                +M+++T ++P + A+  L    L    Y++  +IR  +++YI+   LA   +   
Sbjct: 348 TTNGPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404

Query: 412 VIMDDLLFDMVNK-KKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKG 470
           V+++D LF MV K  ++     RI+AR EIL  ++  +F   YQ+FK  DT L K P KG
Sbjct: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKG 464

Query: 471 SLPHIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISES-QTFKCAEV 529
             P + IITEMKIGRKV+TRV NF+   +     AADLRK+CS STTI ++  T   +E+
Sbjct: 465 EPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEI 524

Query: 530 QVQGPHGQSIIDHLNKLGIPSKWIDFEN 557
           QVQG HG  IIDHL +LG+PS W+ FEN
Sbjct: 525 QVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  422 bits (1085), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 227/568 (39%), Positives = 328/568 (57%), Gaps = 29/568 (5%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60
           MFKKEP++   SN KNSERK+L  + ++Q   E Y F ++ IK   F  Q +VGTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120
           NN P+ F+ KH +   PTVYSCW++P LLP+V TH  V+E  L  GA+LM+ G++PPF  
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180
             + G + GIAS +AP  V A+GI E+DL     V   TGVAV+++H + DGL +VFK++
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LEPPFVLSTQSKDXXXXXXXXXXXXXXXAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240
            E P     +                  A E E E  K A    E +AE L+  T+ DVD
Sbjct: 181 REAPEASEAKG-------------ASPEAREPEAEPPKTAP--GEGLAEELERLTMEDVD 225

Query: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHX 300
           + +TRA+YYT+  D  L+LP++AS FI+ H+++NLPP+D ++V VK++SW K+AK LKH 
Sbjct: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285

Query: 301 XXXXXXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCXXXXXXXXXXXXXXXXXXGMMYS 360
                          T+V  N+  + LK+F PY+                         S
Sbjct: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYR--------TVSDKASTGSKNSSTTQS 337

Query: 361 LTLYKPFNLAKDLLKEVN---LASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDL 417
           L +   +   + LL ++N   ++     +++DIR  + QY++ +   D  DK  + +DD 
Sbjct: 338 LEIVYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDT 397

Query: 418 LFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKI 477
           L  +++K     +  R + R E L  LL+ +F+E++ + + D  L    P KG  P IK+
Sbjct: 398 LAQLLHKNVNA-DTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKV 454

Query: 478 ITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQ 537
             E KI +KV+T+VSNFEV+ VDPE LAA+LR  CSGSTTI++    K  EVQVQGPH  
Sbjct: 455 TNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEA 514

Query: 538 SIIDHLNKLGIPSKWIDFENKLKKKKRK 565
           +I+  LNK GIPSK+I  + K++ KK+K
Sbjct: 515 TIVSILNKHGIPSKYITLDCKVQPKKKK 542

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
           complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score = 34.7 bits (78), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 25/88 (28%)

Query: 365 KPFNLAKDLLKEVNLASHTY-----YTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLF 419
           +  NL+      +NLA   Y     Y   D+ SAV   +           GK+IMD+ L 
Sbjct: 706 RGINLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRV-----------GKLIMDECLL 754

Query: 420 DMVNKKKKVL---------NASRIIARG 438
            ++N K +VL         NASR+I  G
Sbjct: 755 GLLNGKTRVLATHQLSLVENASRVIVLG 782

>NCAS0A02930 Chr1 complement(566085..566765) [681 bp, 226 aa] {ON}
           Anc_4.25 YLL033W
          Length = 226

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 242 FITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAK 295
           F+T+A+ + + + KG++L I+  N I   IM+NL  I++ +  V +  W+K+ +
Sbjct: 114 FVTKAVSF-IPERKGMKLCIARDNTICRQIMKNLLTIEYFKEEVSR--WQKTKR 164

>NDAI0G01090 Chr7 (230932..232302) [1371 bp, 456 aa] {ON} Anc_3.454
          Length = 456

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 2/64 (3%)

Query: 471 SLPHIKIITEMK--IGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAE 528
           ++P ++IIT +     R +   + ++++FQ DPE L  DL K     +  ++ +T K  +
Sbjct: 74  AIPLLRIITSLPKLFPRSIKQSIQDYKIFQKDPERLQIDLLKTLPFFSNGAKFKTGKILK 133

Query: 529 VQVQ 532
            Q++
Sbjct: 134 TQIE 137

>Smik_5.346 Chr5 complement(538041..538775) [735 bp, 244 aa] {ON}
           YER174C (REAL)
          Length = 244

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 211 EKEQEDVKEASVDVEEIAEVLDHFTVSDVDYFI 243
           E  Q+DV+  S+D ++  E+ DHF ++ V YF+
Sbjct: 50  EVNQKDVRFLSIDADKHPEITDHFEITAVPYFV 82

>Kwal_0.70 s0 complement(30290..32608) [2319 bp, 772 aa] {ON}
           YJL047C (RTT101) - Regulator of Ty1 Transposition
           [contig 76] FULL
          Length = 772

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 10/134 (7%)

Query: 356 GMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMD 415
           GM Y   +  P N+ K L+  + L   ++     ++   S     KN+ D +   +    
Sbjct: 467 GMKYLKYMNHPDNVEKILMDLLELRQTSWEFLPQLKGLRSNLTETKNIND-RFHSETTEH 525

Query: 416 DLLFDMVNKKKKVLNASRIIARGE--ILHPL--LTNNFTEFYQIF--KSDDTLLFKAPMK 469
            +L  M+ ++K V +A +  + G+  I  PL  L NNFTEFY     K+D  LL    ++
Sbjct: 526 IMLVPMIFERKNVPSAFQDQSLGDLNISKPLQALWNNFTEFYARSEPKADKKLL---TLQ 582

Query: 470 GSLPHIKIITEMKI 483
            +L H+++ T  K+
Sbjct: 583 NTLHHLEVETNFKL 596

>TBLA0A08250 Chr1 (2029817..2033890) [4074 bp, 1357 aa] {ON}
           Anc_4.207 YGR061C
          Length = 1357

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 65/142 (45%), Gaps = 15/142 (10%)

Query: 358 MYSLTLYKPFNLAK----DLLKEVNLASHTYYTSQDIRSAVSQYISVK-NLADTKDKGKV 412
           M  LTL  P  L++    +L+  +NL +++    +DI+S    YI +K N+  T D+ ++
Sbjct: 1   MNVLTLPGPIALSQFRTDNLINNLNLTANSVNIIKDIKSCYIHYIDLKENVTLTSDEKQI 60

Query: 413 IMDDLLFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSL 472
           + + L +D    K+ + +   +  +   L+  + N++    +    +DT L +      L
Sbjct: 61  LTNLLDYDQTFSKQNISSDDSLSIQ---LYDSVINDWIS--KDLNDNDTYLIRI-----L 110

Query: 473 PHIKIITEMKIGRKVITRVSNF 494
           P I  I+        I  V NF
Sbjct: 111 PRIGTISPWSSKATNILNVCNF 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,863,175
Number of extensions: 2452903
Number of successful extensions: 8216
Number of sequences better than 10.0: 44
Number of HSP's gapped: 8348
Number of HSP's successfully gapped: 45
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)