Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR116C (MRPL1)8.268ON28528514960.0
Smik_4.3608.268ON28528513680.0
Skud_4.3768.268ON28528512821e-180
Suva_2.2758.268ON28528512731e-178
KLLA0F19272g8.268ON2662428861e-120
SAKL0H16896g8.268ON2852828621e-116
Kpol_392.38.268ON2812728561e-115
NCAS0B038108.268ON3142678561e-114
Kwal_56.237758.268ON2812428391e-112
KLTH0G13552g8.268ON2812718361e-112
TPHA0J007708.268ON2782698341e-112
TDEL0F039508.268ON2762698311e-111
ZYRO0C01518g8.268ON2772718251e-110
NDAI0J013308.268ON3142467861e-104
AGR080W8.268ON2752687601e-100
CAGL0B01815g8.268ON2902787601e-100
Ecym_43028.268ON2752517479e-99
KNAG0H032108.268ON2852447244e-95
KAFR0B054808.268ON2802496922e-90
TBLA0I031908.268ON2412134693e-57
CAGL0J00473g5.278ON36562790.15
Kwal_27.116388.446ON723103770.38
Smik_12.595.213ON617125721.3
AAR073Wna 1ON1208102669.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR116C
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   580   0.0  
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   531   0.0  
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   498   e-180
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   494   e-178
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   345   e-120
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   336   e-116
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   334   e-115
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   334   e-114
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   327   e-112
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   326   e-112
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   325   e-112
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   324   e-111
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   322   e-110
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   307   e-104
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   297   e-100
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   297   e-100
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   292   9e-99
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   283   4e-95
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   271   2e-90
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   185   3e-57
CAGL0J00473g Chr10 (39305..40402) [1098 bp, 365 aa] {ON} similar...    35   0.15 
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    34   0.38 
Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W...    32   1.3  
AAR073W Chr1 (475533..479159) [3627 bp, 1208 aa] {ON} NOHBY109; ...    30   9.2  

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60
           MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR
Sbjct: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60

Query: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP
Sbjct: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180
           KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA
Sbjct: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240

Query: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/285 (89%), Positives = 271/285 (95%)

Query: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60
           MLSVVAIPKIC+    RRC  HTAKKLYA++YKP AMSSNAPSLTKDQAKKRELKRL QR
Sbjct: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           KAEAKRPA  +PLYMPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP
Sbjct: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180
           KPLRYIK+AAFTNDE+KLEELR+KYPNHLIGGADLVA+IKSGEI VDFDKAFATPDIVP 
Sbjct: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI+SLL+ESLGSMPFRQRGNSIS+GVGKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240

Query: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           ILQNIISAR+AFK AV+NQKSKKPN+LSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  498 bits (1282), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 246/285 (86%), Positives = 265/285 (92%)

Query: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60
           MLSV+A PKICV    RRC  HTA KLYA++YK  AMSSNAPSLTK+QAKKRELKRL QR
Sbjct: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60

Query: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           +AEAKRPA  +PLYMPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSV FP
Sbjct: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120

Query: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180
           KPLRYIK+A FTNDE+KL+ELREKYPNHLIGGADLV++IK+GEI VDFDKA+AT DIVPA
Sbjct: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDI+SLLQESLGSMPFRQRGNSIS+G+GKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240

Query: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           +LQNII+ARAAFK AV +QKSKKPNILSKTTLSSTHGPGIVIDFA
Sbjct: 241 VLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  494 bits (1273), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 236/285 (82%), Positives = 260/285 (91%)

Query: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60
           ML   AIPKIC+  P RR   HTA++LYA++YK AAMSSNAPSLTKDQAKKRELKRL QR
Sbjct: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           +AEAKRPA  SPL+MPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+VTF 
Sbjct: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120

Query: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180
           KPLRY+K+A FTNDE KL+ELREKYPN ++GG DLVAKIK+ E  VDFDKAFATPDIVP 
Sbjct: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240
           LQSQVARILGPRGVLPSVKKGTVSDDI+SLLQESLGSMPFRQRGN+IS+G+GKCYFTDRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240

Query: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           +LQNIISAR AF+ AVDNQK+KKP++LSKTTLSSTHGPGIVIDFA
Sbjct: 241 LLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  345 bits (886), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 210/242 (86%)

Query: 44  LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTL 103
           LTK+Q +KREL+++VQR+ +AK PA+  PLYMPV++ALRYLRA EVG+P SQQTI LTTL
Sbjct: 25  LTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTL 84

Query: 104 VVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGE 163
           VV ERG  PL+G+V+F KPL+ +K+A FTNDE++   +++KY  HL+GG+DLV++IK+GE
Sbjct: 85  VVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGE 144

Query: 164 ISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQR 223
           +S+DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGTV++D+  L+++S+ S+PFRQR
Sbjct: 145 VSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQR 204

Query: 224 GNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVID 283
           GNSIS+GV K +FTD+E+L+N+++ + AFK ++ NQ++KKP+ILS+TTL+STHGPGIVID
Sbjct: 205 GNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVID 264

Query: 284 FA 285
           FA
Sbjct: 265 FA 266

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  336 bits (862), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 166/282 (58%), Positives = 225/282 (79%), Gaps = 9/282 (3%)

Query: 4   VVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAE 63
           ++ +P  C     R   FHT   L +++      S+ A  L+KDQ K+REL+RLVQRKA 
Sbjct: 13  IITLPISCT----RTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAA 63

Query: 64  AKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPL 123
           A++PA   PLYMPVT+ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL
Sbjct: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123

Query: 124 RYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQS 183
           + +KIA FTNDE KL+  R+++  HL+GG++L+ KIK GE+ +DFDKAFATPDI  +L S
Sbjct: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183

Query: 184 QVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQ 243
           Q+ RILGPRG+LP+ KKGTV++DISSL+++S+G++PFRQRGN ISI V KC FTD ++L+
Sbjct: 184 QLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243

Query: 244 NIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           NI++A+ +FK A+ NQK+KKP+IL +TTL++THGPG+VIDFA
Sbjct: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  334 bits (856), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 216/272 (79%), Gaps = 2/272 (0%)

Query: 16  ARRCFFHTAKKLYADDYKPAAMSSNAP--SLTKDQAKKRELKRLVQRKAEAKRPATASPL 73
           +RRC +H+ + L A+    +  +S  P     KD+ K+REL+R  +RKA+A++PA++ PL
Sbjct: 10  SRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69

Query: 74  YMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTN 133
           YMP+++ALRYLRAAEVG+P SQQ I +TT VV ERG   L+G++++  P++ +KIA F+N
Sbjct: 70  YMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129

Query: 134 DESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRG 193
           D  KL +++E++  HLIGG DLV KIKSG+  VDFDKAFATPDI P L SQ+AR+LGPRG
Sbjct: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189

Query: 194 VLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFK 253
           VLP++KKGTVS+D+SSL++ S+G MPFRQ GNSIS+ VG+C F+D++IL+NII+ R+A+ 
Sbjct: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249

Query: 254 TAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           T + +QKSKKP++L KTT++STHGPGI IDFA
Sbjct: 250 TTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  334 bits (856), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 204/267 (76%), Gaps = 3/267 (1%)

Query: 21  FHTAKKLYADDYKPAAMSSN---APSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPV 77
            H+   + A++      S+     P+L+K+Q KKREL+RL QRK EAKRPA+  PLYMPV
Sbjct: 47  IHSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPV 106

Query: 78  TKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESK 137
            +ALRY+RAAEVGRP  QQTI LT+LVV E+G APL+G ++ P+PL+ +K+A F+ +E  
Sbjct: 107 VEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALKVAVFSQNEEL 166

Query: 138 LEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPS 197
           L  ++EKY  HL+GG +L+ KIK+GE+  DFDKAFA+ D+   L +Q+ + LG RG+LP+
Sbjct: 167 LTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGKTLGRRGLLPN 226

Query: 198 VKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVD 257
            KKGTVSDD+ SLL + +GS+PFRQ GN ISIG+GKC+F+D EIL+NII+AR+A   A+ 
Sbjct: 227 AKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIAARSAVMKALS 286

Query: 258 NQKSKKPNILSKTTLSSTHGPGIVIDF 284
            QKSKKP+IL KTTLSSTHGPGIVIDF
Sbjct: 287 EQKSKKPSILGKTTLSSTHGPGIVIDF 313

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  327 bits (839), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 147/242 (60%), Positives = 201/242 (83%)

Query: 44  LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTL 103
           L+KDQ +KRE+++L Q+KA A+RPAT  PLYMPV KALR+LRAAE G+P SQQT+++TT+
Sbjct: 40  LSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTTI 99

Query: 104 VVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGE 163
           V+ ERG  PLSG+++FPKPL+ +KIA FTNDE + +  REK+  HL+GG+DLV KIK G 
Sbjct: 100 VISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEGA 159

Query: 164 ISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQR 223
           +S+DFDK+FATP+I   L SQ+ RILGPRG+LP+ KKGTV++++  LL+ S+G++PFRQR
Sbjct: 160 VSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPFRQR 219

Query: 224 GNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVID 283
           GN +S+ VGKC FTD+++L+NI++A+   K A+  QK+KKP++L +TTL+STHGPGIVID
Sbjct: 220 GNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVID 279

Query: 284 FA 285
           FA
Sbjct: 280 FA 281

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  326 bits (836), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/271 (56%), Positives = 214/271 (78%), Gaps = 6/271 (2%)

Query: 15  PARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLY 74
           P RR   H +  L A++    A S     L+KDQ KKRE++R  Q+KA A+RPA+  PLY
Sbjct: 17  PVRR--LHVSASLRAEEPVGNATSK----LSKDQLKKREVRRFAQKKAAARRPASEHPLY 70

Query: 75  MPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTND 134
           MPV KALR+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +KIA FTND
Sbjct: 71  MPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTND 130

Query: 135 ESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGV 194
           E + +  REK+  H++GG++LV KIK G++ +DFDK+FATP+I   L SQ+ RILGPRG+
Sbjct: 131 EQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGL 190

Query: 195 LPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKT 254
           LP+ KKGTVS+++ SL+++S+G++PFRQRGN+ISI VG+C FTD+++L+NI++A+ + K 
Sbjct: 191 LPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKE 250

Query: 255 AVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
           A+ NQK+KKP++L +TTL+ST GPGIVIDFA
Sbjct: 251 ALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  325 bits (834), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 157/269 (58%), Positives = 208/269 (77%), Gaps = 1/269 (0%)

Query: 17  RRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMP 76
           R+  FH ++ +  +        +    L+KDQ KKREL+R   RK EAK PAT+ PLYM 
Sbjct: 11  RKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQ 70

Query: 77  VTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDES 136
           V +ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G + F  PL+ +KIA FTNDE+
Sbjct: 71  VPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDET 130

Query: 137 KLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLP 196
           +++  +EK+  +++GG++L++KIK+GEI VDFDKAFATPDIV  L S VARILGPRGV P
Sbjct: 131 QMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVFP 189

Query: 197 SVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAV 256
           S+KKGTVS+++  L++ +LGS+PFRQ GN IS+ +GKC F+DR+IL+N+IS R AFK +V
Sbjct: 190 SIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDSV 249

Query: 257 DNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
             QK+KKP+IL KT LS+THGPGIVIDF+
Sbjct: 250 STQKTKKPSILGKTILSTTHGPGIVIDFS 278

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  324 bits (831), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 170/269 (63%), Positives = 210/269 (78%), Gaps = 5/269 (1%)

Query: 17  RRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMP 76
           RR F HT   L A++      ++N   L+KDQ KKRE++RL QRKA AK+  +  PLYM 
Sbjct: 13  RRSFLHTGNVLRAEEA-----AANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMS 67

Query: 77  VTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDES 136
           +  ALR+LRAAEVG+PQ+QQTI LTT VV ERG   L+GSV+FPKPL+ +KIA F+ DE 
Sbjct: 68  IPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDED 127

Query: 137 KLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLP 196
           +L+  REK+  HL+GG +++ KIKSGEI VDFDKAFATPDI PAL SQ+ARILGPRGVLP
Sbjct: 128 QLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLP 187

Query: 197 SVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAV 256
           +VKKGTV+ D+S L+Q+S+GSMPFRQRGN+ISI VGK  F+DR+IL+N I+   A K A+
Sbjct: 188 TVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEAL 247

Query: 257 DNQKSKKPNILSKTTLSSTHGPGIVIDFA 285
            NQ SKK ++L KTTLSSTHGPGIVIDFA
Sbjct: 248 ANQVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  322 bits (825), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 151/271 (55%), Positives = 200/271 (73%), Gaps = 8/271 (2%)

Query: 14  GPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPL 73
           G   RC FHTA  L A++            LTK+Q +KRE++R  +RK EAK+PA   PL
Sbjct: 14  GSTSRCLFHTAALLRAEEA--------GSKLTKEQLRKREVRRAARRKVEAKKPAHTHPL 65

Query: 74  YMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTN 133
           YMP   ALRYLRA EVG P SQQ I +TT VV +RG  P++G+V+ P PL+ + +A F+N
Sbjct: 66  YMPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSN 125

Query: 134 DESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRG 193
           DE +L   R+K+  HL+GG+D++AKIK GEI VDFDKAFATPDI   L SQVARILGP+ 
Sbjct: 126 DEQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQ 185

Query: 194 VLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFK 253
           VLP  K+GTV+ D+  L+++S GS+PFRQ+GNSIS+ V KC F+DR++L+N+++ + AFK
Sbjct: 186 VLPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFK 245

Query: 254 TAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284
            AV NQK+K+P+IL +TTL++THGPGIVID 
Sbjct: 246 EAVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  307 bits (786), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 195/246 (79%)

Query: 39  SNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTI 98
           +NA  L+K+Q KKRE++RL QRK +A++PA + PLYM V  ALR++RAAEVGRP+ QQTI
Sbjct: 68  ANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTI 127

Query: 99  NLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAK 158
            LTTL+V E+GT+ L+G++   +PL+ +KIA F+ D+  LEE++ ++   L+GG + V  
Sbjct: 128 TLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEG 187

Query: 159 IKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSM 218
           IK G I  +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTVSDD+ +L+   +G++
Sbjct: 188 IKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNI 247

Query: 219 PFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGP 278
           PF+Q GN+ISI +GKCYF+D++IL NII+AR AFK A+ NQK+K+P+ILSKTTLSSTHGP
Sbjct: 248 PFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGP 307

Query: 279 GIVIDF 284
           GIVIDF
Sbjct: 308 GIVIDF 313

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 209/268 (77%), Gaps = 6/268 (2%)

Query: 17  RRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMP 76
           RR    TA +L     + AA SS    L+KDQ KKREL+RL QRKA A+RPA+ASPLYMP
Sbjct: 12  RRGLHLTAVQL---SQEAAATSSK---LSKDQLKKRELRRLAQRKAAARRPASASPLYMP 65

Query: 77  VTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDES 136
           V +ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+VT P P+R  K+A FTND  
Sbjct: 66  VQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPE 125

Query: 137 KLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLP 196
           + E  R KY  +L+GGA+LV ++KSGE+ VDFDKAFATPDI P + +++ R+LGP+G+LP
Sbjct: 126 QAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLP 185

Query: 197 SVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAV 256
           SVKKGTV+ D+S LL + + S PF+QR N IS+ +GKC+F+DR+I++N+++ +AAF+ A+
Sbjct: 186 SVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAM 245

Query: 257 DNQKSKKPNILSKTTLSSTHGPGIVIDF 284
            +QK+KK ++   TTL+STHGPGIVIDF
Sbjct: 246 TSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 148/278 (53%), Positives = 209/278 (75%), Gaps = 10/278 (3%)

Query: 16  ARRCFFHTA---KKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASP 72
           A R  F++A   ++L A +  P   ++   +LTK+QAKKRE+KRL  +KAEAK+PA   P
Sbjct: 13  ANRVIFNSALFGRRLLATEAAPIPQAAAP-TLTKEQAKKREMKRLALKKAEAKKPANIHP 71

Query: 73  LYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFT 132
           LYMP+  ALRYLR+AEVGRP   QTI +TTLVV ++G A L+G++ FP PL+ +KIA F+
Sbjct: 72  LYMPIPLALRYLRSAEVGRPTQHQTITVTTLVVADKGNAALAGNILFPHPLKQMKIAIFS 131

Query: 133 NDESKLEELREKYPNH--LIGGADLVAKIKSGEISVD-FDKAFATPDIVPALQSQVARIL 189
           +++ KL+EL+ KY     + GG D++A IKSG+I VD  +K FATP+I P + SQ+ R+L
Sbjct: 132 SNKEKLDELKSKYSKQVKIAGGEDMIADIKSGKIKVDGVNKVFATPEIFPTIASQLGRVL 191

Query: 190 GPRGVLPSVKK---GTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNII 246
           GP+G++P++KK    TV +D+ SL++E+LG + FRQRGNS+S+ VG+C F+DR+IL+NII
Sbjct: 192 GPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVSFRQRGNSLSVSVGRCNFSDRDILENII 251

Query: 247 SARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284
           + R AFK +V +Q +KKP+IL KTT+S+T GPGIVIDF
Sbjct: 252 AVRNAFKQSVSSQVAKKPSILGKTTISTTAGPGIVIDF 289

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  292 bits (747), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 199/251 (79%), Gaps = 4/251 (1%)

Query: 38  SSNAPS----LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQ 93
           ++N+PS    L+K+Q KK+EL+ L+Q++A AK+     PLYMPV +A R+LRAAEVG+P 
Sbjct: 24  ANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPP 83

Query: 94  SQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGA 153
           SQQTI+LTT+VV ++G   LSG++ FP PLR +K+A FTN++ + E  RE++  HL+GG 
Sbjct: 84  SQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGT 143

Query: 154 DLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQE 213
           +L+  IK+G+  +DFDKA ATPD+V  L SQ+A +LGPR +LP+VKKGTVS++I++L++E
Sbjct: 144 ELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRE 203

Query: 214 SLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLS 273
           ++ ++PFRQRG  +S+ VGKC F+D+++LQNI++ + AFK A+ +Q+ KK +IL KTT++
Sbjct: 204 NMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVT 263

Query: 274 STHGPGIVIDF 284
           STHGPGIVIDF
Sbjct: 264 STHGPGIVIDF 274

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  283 bits (724), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 187/244 (76%)

Query: 42  PSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLT 101
           P LTK+Q ++REL+++++ K  AKRPA+   +Y+ V +A+R LRA EVG+P SQQTI LT
Sbjct: 42  PKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLT 101

Query: 102 TLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKS 161
           T+VV E+G  PL G V  P PL+ ++IAAF+ D   L+ L+E+    ++GGA+L+ ++KS
Sbjct: 102 TMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKS 161

Query: 162 GEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFR 221
           GE+ V FDKAFATPDI P L S++  +LG RG+LP++KKGTV  D+ ++++  +G+MPFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 222 QRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIV 281
           QR  +++ G+ KC+F+DR++L N+I+AR AF+ A+ NQKSKK +IL ++TLSSTHGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 282 IDFA 285
           ID A
Sbjct: 282 IDLA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  271 bits (692), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 130/249 (52%), Positives = 182/249 (73%), Gaps = 2/249 (0%)

Query: 38  SSNAPSLT-KDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQ 96
           +S APS T K QAKK+ L+  ++ + +A+ PA+  PLYM V  ALR+LRA EVG+P+SQQ
Sbjct: 31  ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQ 90

Query: 97  TINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPN-HLIGGADL 155
           TI LTTLV+ E+G  P+ G+V  P PLR  K+   ++D  KLEE+++ + N HL+GG +L
Sbjct: 91  TITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGREL 150

Query: 156 VAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESL 215
           V K K+ +I +DFDK  ATPDI+      + ++ GP+G+LP+VKKGTVS+++  L+ E++
Sbjct: 151 VDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENV 210

Query: 216 GSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSST 275
            SMPFRQR   IS+G+GK  F+D++IL+NII+ R AF   + NQK+KK + L KTTL+ST
Sbjct: 211 SSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTST 270

Query: 276 HGPGIVIDF 284
           HGPGIVIDF
Sbjct: 271 HGPGIVIDF 279

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  185 bits (469), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 136/213 (63%), Gaps = 2/213 (0%)

Query: 72  PLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAF 131
           PL M V  ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   IA F
Sbjct: 30  PLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVF 89

Query: 132 TNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGP 191
           T D  +  ++ ++    +IGG++L+ KI SGE  + F  AFAT D+V  L ++VA+ LG 
Sbjct: 90  TEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGK 147

Query: 192 RGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAA 251
           + VLP +KK TV D+I  LLQ+ L  +PF ++ + IS  VGKC FTD EIL+N+I AR  
Sbjct: 148 QKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREG 207

Query: 252 FKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDF 284
            + A+  Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 208 LQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>CAGL0J00473g Chr10 (39305..40402) [1098 bp, 365 aa] {ON} similar to
           uniprot|P38779 Saccharomyces cerevisiae YHR052w
          Length = 365

 Score = 35.0 bits (79), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 35/62 (56%), Gaps = 9/62 (14%)

Query: 215 LGSMPFRQ-RGNSISIGVGKC-YFTDREILQNIIS-ARAAFKTAVDNQKSKKPNILSKTT 271
           L  +P R  RGN +++ +G+  +FTD EI+ NI S A A  K A      K  NI+ KTT
Sbjct: 206 LHKLPVRAPRGNMLNVHLGRVNWFTDEEIIDNIESVADALIKDA------KIRNIMLKTT 259

Query: 272 LS 273
            S
Sbjct: 260 TS 261

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 25/103 (24%)

Query: 23  TAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALR 82
           +A  L AD  +P  ++       KDQ+ KR+L+RLV+R +E              T  L 
Sbjct: 644 SANMLSADALEPPTLA-QVLEFKKDQSDKRDLRRLVRRGSE--------------TVGLF 688

Query: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLS-GSVTFPKPLR 124
           Y +    G+  +           GE GT P + G  T P P R
Sbjct: 689 YDKVVHFGKSSNNN---------GEYGTLPNNEGPTTGPAPSR 722

>Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W
           (REAL)
          Length = 617

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 51/125 (40%), Gaps = 23/125 (18%)

Query: 141 LREKYPNHLIGGADL-------------------VAKIKSGEISVDFDKAFATPDIVPAL 181
           L E Y N LIG  D+                   +  I     ++D      T  I P+ 
Sbjct: 425 LIELYHNLLIGKLDIYLDRWPACKEHKDRLHFEPIDTIFQELFTLDNKSGLLTQSIFPSY 484

Query: 182 QSQVA-RILGPRGVLPSVKK---GTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFT 237
           +S +   +L    VLPS+ K   GT S+D+ +++   +G +    R  +++I +   Y  
Sbjct: 485 KSNLEDNLLSWEQVLPSLNKEVNGTASEDLDNIMAPVVGQLFKLYREANMTINIYDFYTA 544

Query: 238 DREIL 242
            RE L
Sbjct: 545 FRETL 549

>AAR073W Chr1 (475533..479159) [3627 bp, 1208 aa] {ON} NOHBY109; No
            homolog in Saccharomyces cerevisiae
          Length = 1208

 Score = 30.0 bits (66), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 14/102 (13%)

Query: 14   GPARRCFFHTAKKLYAD---DYKPAAMSSNAPSLTKDQAKKRELKRLVQRKAEAKRPATA 70
             PA    F   K+ Y D   +  P   S+ AP + +D    R +   ++R     +P T 
Sbjct: 1063 APADETLFERVKRYYEDSPFERVPTIRSATAP-VAEDSGVDRHVA--LERSPTTPKPLTP 1119

Query: 71   SPLYMPVTKALRY-----LRAAEVG---RPQSQQTINLTTLV 104
             PL  P  K L +     +R+AE G   R Q+  T ++ + V
Sbjct: 1120 GPLERPAVKRLSWSQESSVRSAERGALRRRQASWTYSMASTV 1161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,167,497
Number of extensions: 1150498
Number of successful extensions: 3935
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4039
Number of HSP's successfully gapped: 31
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)