Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR115W8.267ON1051054368e-57
Suva_2.2748.267ON1051053845e-49
Smik_4.3598.267ON1051053761e-47
Skud_4.3758.267ON1051053585e-45
Kpol_543.428.267ON112842353e-26
ZYRO0C01540g8.267ON97712311e-25
Kwal_56.237768.267ON130792304e-25
KAFR0B054908.267ON85732264e-25
TPHA0A017708.267ON104622241e-24
NDAI0J013408.267ON141532262e-24
KLTH0G13574g8.267ON112682223e-24
Ecym_43038.267ON109672214e-24
NCAS0B038208.267ON115762172e-23
TBLA0E044708.267ON94712134e-23
SAKL0H16918g8.267ON111522145e-23
AGR081C8.267ON130622079e-22
TDEL0F039408.267ON110742069e-22
CAGL0B01793g8.267ON98502031e-21
KNAG0H032208.267ON86702022e-21
KLLA0F19250g8.267ON116581972e-20
Suva_14.1752.92ON111082642.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR115W
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...   172   8e-57
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...   152   5e-49
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...   149   1e-47
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...   142   5e-45
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    95   3e-26
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    94   1e-25
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    93   4e-25
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    92   4e-25
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    91   1e-24
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    92   2e-24
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    90   3e-24
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    90   4e-24
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    88   2e-23
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    87   4e-23
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    87   5e-23
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    84   9e-22
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    84   9e-22
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    83   1e-21
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    82   2e-21
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    80   2e-20
Suva_14.175 Chr14 complement(322909..326241) [3333 bp, 1110 aa] ...    29   2.0  

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score =  172 bits (436), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 90/105 (85%)

Query: 1   MPLFARLCQPQXXXXXXXXXXXXXXXVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60
           MPLFARLCQPQ               VLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK
Sbjct: 1   MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  152 bits (384), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 81/105 (77%)

Query: 1   MPLFARLCQPQXXXXXXXXXXXXXXXVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60
           M LF RL Q Q               VLRPQT MLLNSSPLKT S TP GFG IGQRRWK
Sbjct: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  149 bits (376), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 80/105 (76%)

Query: 1   MPLFARLCQPQXXXXXXXXXXXXXXXVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60
           M LFARL Q Q               VLRPQT M++NSSPLKT S T  GFG I QRRWK
Sbjct: 1   MTLFARLYQLQSRRMISSISSFSALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  142 bits (358), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 78/105 (74%)

Query: 1   MPLFARLCQPQXXXXXXXXXXXXXXXVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60
           M L   L Q Q               VLRPQ+ MLLNS P+KT S T LGFG IGQRRWK
Sbjct: 1   MTLLTSLYQLQSKRMLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 95.1 bits (235), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 62/84 (73%), Gaps = 7/84 (8%)

Query: 27  VLRPQTGMLLNSSPL----KTPSFTPLGFGLIG-QRRWKSRGNTYQPSTLKRKRTFGFLA 81
           + RP  G  LNS  L     T +F     GL+G QRRWKSRGNTYQPSTLKRKR FGFLA
Sbjct: 31  IFRPFAG--LNSVGLFPGTATNTFGSAITGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLA 88

Query: 82  RAKSKQGSKILKRRKLKGRWFLSH 105
           RA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 89  RARSRSGSKILERRKAKGRWYLSH 112

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 93.6 bits (231), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 58/71 (81%), Gaps = 7/71 (9%)

Query: 35  LLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94
           LL  SPL +      GFG+ GQRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 34  LLGPSPLSS------GFGM-GQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86

Query: 95  RKLKGRWFLSH 105
           RK KGRWFL+H
Sbjct: 87  RKHKGRWFLTH 97

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 93.2 bits (230), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 57/79 (72%), Gaps = 1/79 (1%)

Query: 27  VLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSK 86
           V +    +   SS    PS+    FGL  Q+RWKSRGNTYQPSTLKRKR  GFLAR KSK
Sbjct: 53  VSQVNNSIATGSSSSAMPSYLSSLFGLT-QKRWKSRGNTYQPSTLKRKRRVGFLARVKSK 111

Query: 87  QGSKILKRRKLKGRWFLSH 105
           QGSKILKRR+ KGRW+L+H
Sbjct: 112 QGSKILKRRREKGRWYLTH 130

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 55/73 (75%), Gaps = 2/73 (2%)

Query: 35  LLNSSPLKTPSFTPLGFGL--IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKIL 92
           +  S  L T   T + F L   GQ+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ SKIL
Sbjct: 13  IFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKIL 72

Query: 93  KRRKLKGRWFLSH 105
           K RK KGRW+LSH
Sbjct: 73  KDRKEKGRWYLSH 85

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 90.9 bits (224), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 45/62 (72%), Positives = 50/62 (80%)

Query: 44  PSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFL 103
            S   L   L  QRRWKSRGNTYQPSTLKRKR  GFLARA+SKQG+KIL+RRK KGRW+L
Sbjct: 43  ASILGLNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYL 102

Query: 104 SH 105
           +H
Sbjct: 103 TH 104

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 91.7 bits (226), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (90%)

Query: 53  LIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           +I Q+RWKSRGNTYQPSTLKRKR +GFL+R + +Q SKILKRRKLKGRWFLSH
Sbjct: 89  MINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 90.1 bits (222), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 55/68 (80%), Gaps = 2/68 (2%)

Query: 38  SSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKL 97
           SS   +P F+ L FG   QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ 
Sbjct: 47  SSQGSSPLFSAL-FGFT-QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRRE 104

Query: 98  KGRWFLSH 105
           KGRW+L+H
Sbjct: 105 KGRWYLTH 112

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 89.7 bits (221), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 53/67 (79%), Gaps = 1/67 (1%)

Query: 39  SPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLK 98
           S  + PS   L FGL  QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK K
Sbjct: 44  STFQRPSVISLVFGL-NQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEK 102

Query: 99  GRWFLSH 105
           GRW+L++
Sbjct: 103 GRWYLTY 109

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 88.2 bits (217), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 56/76 (73%), Gaps = 4/76 (5%)

Query: 30  PQTGMLLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89
           P    +L+ SP+   S  P G   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 44  PMGSNVLSQSPM-MGSLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99

Query: 90  KILKRRKLKGRWFLSH 105
           KILKRR+LKGRW+L+H
Sbjct: 100 KILKRRRLKGRWYLTH 115

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 86.7 bits (213), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 51/71 (71%)

Query: 35  LLNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94
           LLN S L   +       +I  RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKR
Sbjct: 24  LLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKR 83

Query: 95  RKLKGRWFLSH 105
           RK KGRWFLSH
Sbjct: 84  RKAKGRWFLSH 94

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 87.0 bits (214), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 84.3 bits (207), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 44  PSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFL 103
           PS   +  GL  Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L
Sbjct: 70  PSMLSMLLGLT-QKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYL 128

Query: 104 SH 105
           +H
Sbjct: 129 TH 130

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 84.0 bits (206), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 56/74 (75%), Gaps = 4/74 (5%)

Query: 33  GMLLNSSPLKTPSFT-PLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKI 91
           G+    SPL + S   P G   I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++
Sbjct: 40  GVPETHSPLSSISLLFPFG---IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRV 96

Query: 92  LKRRKLKGRWFLSH 105
           L+RRK KGRW+L++
Sbjct: 97  LQRRKAKGRWYLTY 110

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 82.8 bits (203), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 49  QRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 82.4 bits (202), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%)

Query: 36  LNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRR 95
           + +S L T    P    +   RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRR
Sbjct: 17  VGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRR 76

Query: 96  KLKGRWFLSH 105
           K KGRW+LSH
Sbjct: 77  KEKGRWYLSH 86

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 49/58 (84%), Gaps = 3/58 (5%)

Query: 51  FGLI---GQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           FG++    QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 59  FGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>Suva_14.175 Chr14 complement(322909..326241) [3333 bp, 1110 aa]
           {ON} YNL163C (REAL)
          Length = 1110

 Score = 29.3 bits (64), Expect = 2.0,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 36/82 (43%), Gaps = 9/82 (10%)

Query: 28  LRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWKSRGN------TYQPSTLKRKRTFGFLA 81
           + P+T  ++NS  LK  S TPL   LI +  WK   N      +     + +      L 
Sbjct: 272 MDPKTKKIINSKGLKGRSLTPLFTSLILENIWKIYQNVIISRDSNMVEKIAKTLNIKLLP 331

Query: 82  R-AKSKQGSKILKRRKLKGRWF 102
           R  +SK   ++L  R + G+W 
Sbjct: 332 RDLRSKDDKQLL--RTIMGQWL 351

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,423,611
Number of extensions: 340623
Number of successful extensions: 855
Number of sequences better than 10.0: 22
Number of HSP's gapped: 854
Number of HSP's successfully gapped: 22
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)