Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR113C (PDS1)8.265ON37335915310.0
Smik_4.3588.265ON37135611611e-159
Skud_4.3748.265ON37336011241e-153
Suva_2.2738.265ON37636510321e-139
TDEL0F039208.265ON3223393832e-42
ZYRO0C01584g8.265ON2823192501e-23
SAKL0H16962g8.265ON3363452399e-22
Kpol_543.418.265ON3061701646e-12
KLTH0G13618g8.265ON3023191592e-11
NCAS0B038308.265ON325741592e-11
Kwal_56.237818.265ON2932991531e-10
NDAI0J013508.265ON422771372e-08
Ecym_43058.265ON3111801291e-07
KLLA0F19206g8.265ON263611228e-07
AGR083W8.265ON2953351113e-05
KNAG0H032308.265ON2811771103e-05
TPHA0A017808.265ON35226990.001
KAFR0B055108.265ON275124950.003
CAGL0L12298g8.265ON28689920.006
TBLA0E044608.265ON27730677.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR113C
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   594   0.0  
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   451   e-159
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   437   e-153
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   402   e-139
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   152   2e-42
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   100   1e-23
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    97   9e-22
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    68   6e-12
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    66   2e-11
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    66   2e-11
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    64   1e-10
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    57   2e-08
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    54   1e-07
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    52   8e-07
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    47   3e-05
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    47   3e-05
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    43   0.001
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    41   0.003
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    40   0.006
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    30   7.4  

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/359 (84%), Positives = 303/359 (84%)

Query: 1   MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNT 60
           MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNT
Sbjct: 1   MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNT 60

Query: 61  LKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL 120
           LKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL
Sbjct: 61  LKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL 120

Query: 121 SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXXX 180
           SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLA   
Sbjct: 121 SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADSG 180

Query: 181 XXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNST 240
                             LGKKLQSALLKQDSSD                     IKNST
Sbjct: 181 KNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNST 240

Query: 241 KNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED 300
           KNEQ              IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED
Sbjct: 241 KNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED 300

Query: 301 EDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMELVYS 359
           EDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMELVYS
Sbjct: 301 EDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMELVYS 359

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  451 bits (1161), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 237/356 (66%), Positives = 269/356 (75%), Gaps = 5/356 (1%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           MPANEDKENNIVY+GN SS +NFPQTPAHLLKRSHSN+LKPP RLDQLK+D NSNN N L
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIF-PETSNQSKDAD-LPQLQNT 119
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNR+KSFIF PE SNQSKDAD +PQ QNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXX 179
           LSIRKNDQLRKLSQISR+R+R NH+DLL+N+RKLQKYGSVLGYNALPKMKSLVLKDL   
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180

Query: 180 XXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNS 239
                              L KKLQ+ALL+Q SSD                     IKNS
Sbjct: 181 GKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240

Query: 240 TKNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299
            +NE               IEIAPQR +PLPYVP+GYSPF+Q+DI+KLK+FNSPY+LDLE
Sbjct: 241 VQNE---SKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLE 297

Query: 300 DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTME 355
           D+  + DKVDLLPLE I+EE E+DE   I  ++EEG  LPLLSKN +++ A+PT+E
Sbjct: 298 DDGGSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIE 353

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  437 bits (1124), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 238/360 (66%), Positives = 266/360 (73%), Gaps = 3/360 (0%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSN+LKPPVRLDQLK+D NSNNG  L
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIF-PETSNQSKDAD-LPQLQNT 119
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSF+F  ET+N SKD++ +PQ QNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXX 179
           LSIRKNDQLR+LSQISR+R+RAN+N+LL+NSRKLQKYGSVLGYNALPKMKSLVLKDLA  
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180

Query: 180 XXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNS 239
                              LG KLQ+A L+Q SSD                     IKN+
Sbjct: 181 AKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240

Query: 240 TKNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299
           TK +Q               EIAPQRQEPLPYVP+GY  FQ++DIEKL+TFNSPY+LDLE
Sbjct: 241 TKGKQGSKEEDDDDDDYEI-EIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLE 299

Query: 300 DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTMELVYS 359
           D  D+ D+V LL LE IDEE E+D T   T + E  AA PLLSK  KE  A PT+ L+ S
Sbjct: 300 DHGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTINLLCS 359

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 221/365 (60%), Positives = 259/365 (70%), Gaps = 10/365 (2%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           MPANEDKENNIVYTGNESS  +FPQTPAHLLKRSHSN+LKPPVRLDQLK+D NSN+G  L
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFP-ETSNQSKDADL-PQLQNT 119
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNRSKSF+F  ET+NQ+KDA++ PQ QNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXX 179
           LS RKNDQLRKLSQ+SR+R+R N+N +L+NSRKLQKYGSVLGYNALPKMKSLVLKDLA  
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180

Query: 180 XXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNS 239
                              L +KLQSA  +Q SS+                     IKN+
Sbjct: 181 AKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240

Query: 240 TKNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299
            K ++              IEIAPQRQEPLPYVP+GY PFQQ+DI KLKTFNSPY LDLE
Sbjct: 241 AKGKE---GPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLE 297

Query: 300 ---DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFK--EVAAVPTM 354
              +  ++ DKV LL L +++EE EKD T     +Q+E A L L  +N +  + AA+P +
Sbjct: 298 GNSNNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLI 357

Query: 355 ELVYS 359
           E +Y+
Sbjct: 358 ESLYN 362

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  152 bits (383), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 123/339 (36%), Positives = 163/339 (48%), Gaps = 53/339 (15%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           MP NE+KEN++V    ES G++FPQTPAHLLKRS S ++KP          +   N + L
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKP----------SGEENPSNL 50

Query: 62  KYIQGG---KEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQN 118
            Y       K  SP++R+     QQGR PLA+KDNNRS  F+      Q + +       
Sbjct: 51  TYRDCDAPVKRASPSRRV-----QQGRPPLASKDNNRSTGFLPQLQKLQQQPS------- 98

Query: 119 TLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAX 178
                     R LSQ  +  +      LL+N R+L+KYGSVLGYNALPKMKSLVLKD+  
Sbjct: 99  --------LKRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDV-- 148

Query: 179 XXXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKN 238
                               L  KL +A+ + D                        +++
Sbjct: 149 -DQVGEQGEDENDDEDEDHILRLKLHNAIDRSDEE------GEEVGGLFDKSGLLHLVRD 201

Query: 239 STKNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDL 298
           S K+E               IE  PQR EPLPY+PEG+    Q+D +KLKTF SPY ++ 
Sbjct: 202 SKKDED--------DWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIED 253

Query: 299 EDEDDTPDKVD-LLPLEQIDEEGEKD--ETECITRNQEE 334
           +  D   DK D  L LE+I   G+ +  E E +T  Q E
Sbjct: 254 DYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVKQRE 292

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  100 bits (250), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 133/319 (41%), Gaps = 96/319 (30%)

Query: 6   EDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTLKYIQ 65
           ++KENN+V    E+  +  PQTP HLLKRS  N+LKP                NT   ++
Sbjct: 7   DNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKP--------------EENT--PVK 50

Query: 66  GGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKN 125
             + VSP +        Q RLPLA+KD+N+S S   P    Q      P LQ        
Sbjct: 51  KSRSVSPVR-------GQRRLPLASKDHNKS-SAAGPVKKRQ------PTLQ-------- 88

Query: 126 DQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXXXXXXXX 185
                              +LLSN RKLQKYGSVLGY  LP+ KSLVLKD          
Sbjct: 89  ------------------GELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD---------G 121

Query: 186 XXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNSTKNEQX 245
                        L KKLQ A+ +++ S                            NE  
Sbjct: 122 DDEDDDEEEENSELQKKLQDAMNRREDS----------------------------NEGL 153

Query: 246 XXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLED-EDDT 304
                        IE AP R  PL Y P+G++ ++ +DI KLK  +   + D +D ED+ 
Sbjct: 154 GGLAKLVRDTKDDIEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNE 213

Query: 305 PDKVD--LLPLEQIDEEGE 321
           P + D  LLPL  I+   E
Sbjct: 214 PQENDDGLLPLMSIESNNE 232

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 96.7 bits (239), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 107/345 (31%), Positives = 143/345 (41%), Gaps = 72/345 (20%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M  +E+KEN I       S  N P TP+HLLKRS S  +KP            SN     
Sbjct: 1   MRTHENKENVIF------SSENLPTTPSHLLKRSQS-FMKPLA----------SN----- 38

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121
                    SPTK+         RLPLA+KDNN+S + I     N  + + L  L    S
Sbjct: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLI-----NNGQKSALVNLAPNNS 78

Query: 122 IRKNDQL-RKLSQISRSRSRANHND------LLSNSRKLQKYGSVLGYNALPKMKSLVLK 174
           +    +L R    +S + S  N N       LL +SR L+KYGSVLGYN LP++KSLVLK
Sbjct: 79  LLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSR-LKKYGSVLGYNGLPRVKSLVLK 137

Query: 175 D-----LAXXXXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXX 229
           D     +                      L  KL  AL   +  D               
Sbjct: 138 DVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNEDD-------------KE 184

Query: 230 XXXXXXIKNSTKNEQXXXXXXXXXXXXXXIEI--APQRQEPLPYVPEGYSPFQQDDIEKL 287
                 + ++T  +Q               EI   P   E LP+VP GYSPF++ D+ KL
Sbjct: 185 EGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKL 244

Query: 288 KTFNSPYKLDLEDED--DTPDKVDLLPLEQIDEEGEKDETECITR 330
            TF SP+ +  ED D  +  D   LL +  +  E E+ + +   R
Sbjct: 245 NTFTSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDR 289

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 67.8 bits (164), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 91/170 (53%), Gaps = 34/170 (20%)

Query: 5   NEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTLKYI 64
           +++KENNI      +   + PQTP +LLKR+HS  LK  +  D                I
Sbjct: 2   DQNKENNIFR---HAMLKDMPQTPNNLLKRTHSK-LKTGIAKD----------------I 41

Query: 65  QGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRK 124
           QGG  ++ +         Q RLPLA+KDNNRS SF+     N + + +     N  +I  
Sbjct: 42  QGGNVINTS--------PQKRLPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINN 93

Query: 125 NDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLK 174
           N+  +      +   + N + +L++ RKL+KYGSVLGYNALPK+KSLVLK
Sbjct: 94  NNIKK------QHIFQQNKSGILADDRKLKKYGSVLGYNALPKVKSLVLK 137

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 39/62 (62%), Gaps = 1/62 (1%)

Query: 271 YVPEGYSPFQQDDIEKLKTFNSPYKLDLEDEDDTPDKVDLLPLEQI-DEEGEKDETECIT 329
           Y+P+ + PF ++DI KLKTFNSP+KL+  + DD  D  +LL L    D+EG  ++     
Sbjct: 206 YIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLLLANTSDDEGTHNDKITTN 265

Query: 330 RN 331
           +N
Sbjct: 266 KN 267

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/319 (26%), Positives = 119/319 (37%), Gaps = 86/319 (26%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121
                 K  SP +        + R PLA+KDNNRS S++                     
Sbjct: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLG-------------------- 59

Query: 122 IRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKD-LAXXX 180
               + LRK     R+R   NH      + +L      L  +  PK+KSLVLKD +    
Sbjct: 60  --TKEPLRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEEEG 111

Query: 181 XXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNST 240
                             L  KL++ LL +D                        +  S 
Sbjct: 112 SQSEGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKL--SQ 169

Query: 241 KNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFN-SPYKLDL- 298
           + E+              +E+ P R EPLP+VPEGY+PF + +I KL+  + SP++L+  
Sbjct: 170 RAEESDSDQE--------VEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFS 221

Query: 299 ---EDED-DTPDKVDLLPL 313
              EDED ++ D   L  L
Sbjct: 222 GVDEDEDINSQDSTQLFTL 240

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 45/74 (60%), Gaps = 12/74 (16%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLD-----LEDEDDTPDKVDLLPL 313
           IE AP R+EPLP+VP GY+PF  +DI KLKTF+S YKLD     +ED D       LL L
Sbjct: 215 IEYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD------KLLAL 268

Query: 314 EQIDEEGEKDETEC 327
           E I E    DE E 
Sbjct: 269 ETI-ETSVDDEAEW 281

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 76/177 (42%), Gaps = 64/177 (36%)

Query: 2   MPANEDKENNIVYTGNESSGIN---FPQTPAHLL-KRSHSNILKPPVRLDQLKRDANSNN 57
           +  NEDKEN   Y  +  S       P+TPAHLL KRS S +LKP               
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP--------------- 47

Query: 58  GNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQ 117
            N++        +SP +R     Q Q RLPLA KDNN S                     
Sbjct: 48  -NSVNATDELGNISPRRR--QLLQLQNRLPLAKKDNNNS--------------------- 83

Query: 118 NTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLK 174
            + S RKN                     L+N +KL+KYGSVLG +ALP+ KSL+LK
Sbjct: 84  -SFSSRKNG--------------------LNNIKKLKKYGSVLGMDALPRTKSLILK 119

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 109/299 (36%), Gaps = 84/299 (28%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121
                 K +SP +     A+Q  R PLA+KDNN+S  F+                     
Sbjct: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLG-------------------- 59

Query: 122 IRKNDQLRKLSQISRSRSRANH-NDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLAXXX 180
               + LRK     R+R   NH    + N+R       +L  N  P++KSLVLKD     
Sbjct: 60  --AKEPLRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKD--DIE 108

Query: 181 XXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXIKNST 240
                             L  KL+  L  +D  D                     + + T
Sbjct: 109 EEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHSET 168

Query: 241 KNEQXXXXXXXXXXXXXXIEIAPQRQEPLPYVPEGYSPFQQDDIEKLK-TFNSPYKLDL 298
            +                +E+ P R EPLP++P GY+PF  +DI KL+ T  SP++L+ 
Sbjct: 169 LDSDSDLE----------VEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNF 217

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKL--DLEDEDDTPDKVD----LLP 312
           IE AP R++ LPY+P+GY+PF  +DI KLK ++SP+ +  D  D   +P  +     LL 
Sbjct: 276 IEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDPEMLLS 335

Query: 313 LEQIDEEGEKDETECIT 329
           L+  D +     + C +
Sbjct: 336 LQSFDTQTATTSSSCAS 352

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 62/190 (32%), Positives = 83/190 (43%), Gaps = 71/190 (37%)

Query: 5   NEDKENNIVYTGNES---SG--INFPQTPAHLLKRSHSNIL---KPPVRLDQLKRDANSN 56
           +EDKEN   +  +     SG  I FPQTPAHLLKRS S+IL   KP ++   L+    S+
Sbjct: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRS-SSILSKQKPDIKPGNLELQLQSD 71

Query: 57  NGNTLKYIQGGK---EVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADL 113
            G        G     +SP ++L    Q Q R PL+ KDNN   SFI  +   Q      
Sbjct: 72  AG-------AGAVPPNISPRRQL---LQLQNRFPLSKKDNNN--SFILKQQQQQ------ 113

Query: 114 PQLQNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLG-------YNALP 166
                                              + ++L+KYGSVLG       +N L 
Sbjct: 114 ----------------------------------FDHKRLKKYGSVLGLGTDGNNHNNLT 139

Query: 167 KMKSLVLKDL 176
           ++KSLVLKD+
Sbjct: 140 RIKSLVLKDI 149

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 54.3 bits (129), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/180 (31%), Positives = 72/180 (40%), Gaps = 61/180 (33%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M  +EDKEN  + TG+E SG   P+TP H LKRS SN+                      
Sbjct: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLS 121
                            H +   RLPLA+KD NRS+S             +L Q      
Sbjct: 37  -----------------HLKNNSRLPLASKDRNRSQSGF-----------NLKQ-----Q 63

Query: 122 IRKNDQLRKLSQISRSRSRANHNDLLSN--SRKLQKYGSVLGYN--ALPKMKSLVLKDLA 177
           + +      +        R   N  + N    KL+KYGSVLG N   L K KSLVLKD +
Sbjct: 64  LVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 6/66 (9%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLEDEDDTPDKVD----LLPLE 314
           IE AP++   L ++P GY  F+ ++I KL T+ SP+    + E+D  D  +    L+PL+
Sbjct: 194 IETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERLLIPLD 253

Query: 315 --QIDE 318
              IDE
Sbjct: 254 FGGIDE 259

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 38/61 (62%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLEDEDDTPDKVDLLPLEQIDE 318
           IE AP+RQ+ LPY+P GY PF ++ IEKL+   SP++++    D      +L+ L   DE
Sbjct: 157 IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDE 216

Query: 319 E 319
           +
Sbjct: 217 D 217

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 47/92 (51%), Gaps = 23/92 (25%)

Query: 85  RLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKNDQLRKLSQISRSRSRANHN 144
           R PLA+KDNNR++S                     LS++ N  L K     +  + +   
Sbjct: 39  RRPLASKDNNRTQSI--------------------LSVKNNAALGKSDHPLKRPASSFMK 78

Query: 145 DLLSNSRKLQKYGSVLGYNA-LPKMKSLVLKD 175
           ++  N  KL+KYGSVLG N  +P+ KSLVLKD
Sbjct: 79  NMPEN--KLKKYGSVLGMNTFMPRTKSLVLKD 108

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 83/335 (24%), Positives = 112/335 (33%), Gaps = 118/335 (35%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M  +EDKEN +   G    G   P+TP H LKRS SN+                      
Sbjct: 1   MKKHEDKENLVTSAGR---GAMMPRTPIHQLKRSSSNLA--------------------- 36

Query: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQN--- 118
                              +   R+PLA+KD N+S+     +TS                
Sbjct: 37  ------------------GRNSTRMPLASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPA 78

Query: 119 TLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLG--YNALPKMKSLVLKDL 176
           + SI KN                     + +S KL+KYGSVLG  Y +L K KSLVLKD 
Sbjct: 79  SSSIAKN---------------------MPDS-KLKKYGSVLGVGYGSLAKAKSLVLKDT 116

Query: 177 AXXXXXXXXXXXXXXXXXXXXXLGKKLQSALLKQDSSDXXXXXXXXXXXXXXXXXXXXXI 236
           +                     L  KL+S L   +                         
Sbjct: 117 S-----DCESANEESEEEEGNPLAAKLKSRLCSAEEGG---------------------- 149

Query: 237 KNSTKNEQXXXXXXXXXXXXXXIEIAPQRQE---PLPYVPE----------GYSPFQQDD 283
                NE               +  A + QE   P+ Y PE          GY   +  D
Sbjct: 150 -----NEDDGSSGLLLGEALSQLAAAGETQEDVPPVEYAPEKLPELPHVPNGYESLKSAD 204

Query: 284 IEKLKTFNSPYKL--DLEDEDDT--PDKVDLLPLE 314
           + KL  ++SP+    D EDE++T   D   L+PLE
Sbjct: 205 LAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLE 239

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 74/177 (41%), Gaps = 69/177 (38%)

Query: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61
           M  NEDKEN +            PQTPA       SNIL                +G  L
Sbjct: 1   MQDNEDKENAVA----------VPQTPA-------SNIL--------------DGSGVVL 29

Query: 62  KYIQG-GKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL 120
           K +   GK+    ++  T     GRLPLA+KDNN S   +  +   Q             
Sbjct: 30  KPVGSRGKQSFSVRKSPTRG---GRLPLASKDNNASGLVVSGKLGRQPA----------- 75

Query: 121 SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYN--ALPKMKSLVLKD 175
                DQ+R+          AN      +SRKL++YGS+LGY+   L + KSL+LKD
Sbjct: 76  -----DQVRE----------AN------SSRKLKRYGSLLGYDNRQLTRSKSLILKD 111

 Score = 37.0 bits (84), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 22/32 (68%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTF 290
           +EI PQ Q+ LPY+P+G+    + DI KL+ +
Sbjct: 171 LEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 269 LPYVPEGYSPFQQDDIEKLKTFNSPY 294
           L Y PEGY PF  +DI+KL TF SPY
Sbjct: 244 LSYSPEGYIPFNNEDIKKLNTFKSPY 269

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 75/194 (38%), Gaps = 70/194 (36%)

Query: 2   MPANEDKENNIVYTGNES-------SGINFPQTPA-HLLKRSHSNILKPPVRLDQLKRDA 53
           +  N DKEN+I Y  N+        S    PQTP   LLKR+HS  L   V         
Sbjct: 7   LNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVF-------- 58

Query: 54  NSNNGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RSKSFIFPETSNQSKD 110
                         K+   +K  + +  +  RLPLA+KDNN   RS SFI          
Sbjct: 59  --------------KDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFILQNNK----- 99

Query: 111 ADLPQLQNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPK--- 167
                L   LS+  N+Q                      S KL+KYGS+LG N       
Sbjct: 100 ---LVLNKQLSLLNNNQT---------------------SNKLRKYGSILGVNNNGNNTN 135

Query: 168 -----MKSLVLKDL 176
                +KSL+LKD+
Sbjct: 136 KTLNPVKSLILKDI 149

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 48/124 (38%), Gaps = 52/124 (41%)

Query: 57  NGNTLKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQL 116
           N N +K       +SP KRL    QQQG+LPL +K+ N+S S +     N ++       
Sbjct: 23  NTNFVKKNTTSTRISPLKRL----QQQGKLPLQSKNGNKSNSILISHKGNNTR------- 71

Query: 117 QNTLSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYN-----ALPKMKSL 171
                                               ++KYGS+LG        LPK KSL
Sbjct: 72  ------------------------------------IKKYGSILGLENPGNFKLPKTKSL 95

Query: 172 VLKD 175
           +LKD
Sbjct: 96  ILKD 99

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 46/89 (51%), Gaps = 21/89 (23%)

Query: 259 IEIAPQRQEPLPYVPEGYSPFQQDDIEKLK--------TF--NSPYKLDLEDEDDTPDKV 308
           IE+A  R+   PY PEGY P    D+EKLK        TF  +SP  + +   DD+P   
Sbjct: 161 IEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIMDSPRAISIVG-DDSP--- 216

Query: 309 DLLPL---EQIDEEG---EKDET-ECITR 330
            LLPL   E   EEG   +K+ T E ITR
Sbjct: 217 QLLPLDLEESKLEEGVLNDKNTTDEVITR 245

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 21/40 (52%), Gaps = 4/40 (10%)

Query: 1  MMPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNIL 40
          M     DKENN+V T  E      P TP  LLKR+ S +L
Sbjct: 1  MGAVETDKENNVVGTLREKG----PATPTQLLKRTRSTLL 36

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 22/30 (73%), Gaps = 4/30 (13%)

Query: 152 KLQKYGSVLGY--NALPK--MKSLVLKDLA 177
           +L+KYGSVLGY  N +     K+L+LKD+A
Sbjct: 102 RLKKYGSVLGYSNNTINSNASKTLILKDIA 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.128    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,613,108
Number of extensions: 1700322
Number of successful extensions: 7341
Number of sequences better than 10.0: 87
Number of HSP's gapped: 7513
Number of HSP's successfully gapped: 111
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)