Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR111C (ALT2)8.263ON50750726340.0
Smik_4.3578.263ON50750723540.0
Skud_4.3728.263ON50750723530.0
Suva_2.2718.263ON50750722890.0
TDEL0F039008.263ON55948917500.0
NCAS0B050208.263ON56848917500.0
NDAI0B019908.263ON58850517470.0
KNAG0G020408.263ON59149017200.0
YLR089C (ALT1)8.263ON59248917100.0
Suva_10.1738.263ON59248917050.0
Skud_12.1578.263ON59248917050.0
SAKL0H17006g8.263ON53148816950.0
KNAG0M012108.263ON52149516870.0
CAGL0L12254g8.263ON57449416890.0
Smik_12.1488.263ON59248916840.0
KLLA0F19162g8.263ON52848716760.0
NCAS0B038408.263ON49748916660.0
ZYRO0C01628g8.263ON53448616700.0
KAFR0B055308.263ON51449016520.0
KAFR0B05520singletonON51049016400.0
Kpol_392.58.263ON51248616250.0
KAFR0B027308.263ON53949116130.0
NDAI0J013608.263ON50149015780.0
Kwal_56.237918.263ON51849615780.0
KLTH0G13662g8.263ON51951315710.0
TPHA0J007508.263ON52249815570.0
TPHA0A018008.263ON49849115520.0
Kpol_543.398.263ON49249115420.0
Ecym_43078.263ON53449115320.0
TBLA0E044408.263ON56248415250.0
AGR085W8.263ON52148815100.0
TBLA0F030608.263ON50049414720.0
TBLA0G01630singletonON50049714610.0
TDEL0D019001.321ON4432581242e-06
Kpol_480.11.472ON3802891222e-06
Kwal_34.160181.472ON3791061223e-06
CAGL0J05126g1.321ON4332561189e-06
Suva_6.1361.321ON4442561171e-05
Kwal_14.25741.321ON443701161e-05
NCAS0G040501.472ON3841601142e-05
KNAG0G005501.472ON3872871133e-05
Smik_10.1801.321ON4442561143e-05
AEL170C1.321ON4582611143e-05
YJL060W (BNA3)1.321ON4442561143e-05
KAFR0A017101.321ON4352551115e-05
TPHA0O014501.321ON4432581107e-05
Skud_10.1561.321ON4602561109e-05
KLTH0G09614g2.252ON3892231091e-04
Kpol_1035.231.321ON4442581081e-04
KLTH0G19646g1.472ON379931053e-04
ZYRO0G20636g1.321ON4532601053e-04
KNAG0B053201.321ON433721044e-04
NCAS0A092001.321ON4452621027e-04
SAKL0F02156g3.511ON498911010.001
SAKL0D06886g1.321ON4472581000.001
Kpol_1039.222.252ON386212990.002
Ecym_6319singletonON354224970.002
KLLA0F01617g1.321ON444258980.002
SAKL0D11528g1.472ON38391970.002
NDAI0G057601.321ON448262980.003
KLTH0H10648g1.321ON44372970.003
ZYRO0A01672g2.252ON386134950.005
KLTH0G19624gsingletonON46852950.005
Ecym_55428.204ON446110930.009
TBLA0B009902.102ON54644930.010
TPHA0F012602.252ON392193920.010
KLLA0E00969g8.204ON445131910.016
Kwal_23.48882.252ON389145900.020
KNAG0E018502.252ON384103900.020
KLTH0B00176g8.204ON44852900.023
Kwal_47.189823.511ON49691890.029
NCAS0B064402.252ON385103880.030
AGR141C8.204ON438107880.034
Smik_5.3198.204ON44360860.055
KLTH0G02002g3.511ON49691860.064
Ecym_62921.321ON43068850.085
TDEL0C040902.252ON38391840.10
Kwal_8.5858.204ON44685840.12
KLLA0F10021g3.511ON497291830.16
TPHA0D033703.511ON49759830.16
TDEL0A016008.204ON47550820.18
Kpol_278.23.511ON49884810.23
KNAG0B006603.511ON49659810.24
TDEL0D057903.511ON49759810.24
ADL249W2.252ON387174810.24
KLLA0F03509g2.252ON387149810.24
SAKL0E08492g2.252ON384128790.41
CAGL0C01243g2.252ON383104780.48
KLTH0E07678gna 1ON492180780.53
SAKL0H21824gna 1ON499198780.57
Kwal_47.17462na 1ON492179770.70
KAFR0J015802.252ON383106760.89
TBLA0H018905.367ON111246771.0
YER152C8.204ON44347761.0
Ecym_32902.252ON386172761.1
CAGL0G01254g3.511ON50459761.1
Kpol_1032.398.204ON45374761.1
Suva_5.2818.204ON45049751.2
NDAI0B037302.252ON386104751.2
YGL202W (ARO8)3.511ON50059751.5
KAFR0B023808.204ON443116741.8
ZYRO0B11088g8.204ON45047732.2
KNAG0G016808.204ON45247732.3
NCAS0E006703.511ON49779732.5
Skud_9.552.252ON385104713.3
KAFR0D014203.511ON49267723.4
YIL116W (HIS5)2.252ON385104713.5
Smik_9.532.252ON388104704.5
TBLA0B080808.204ON44474705.4
Skud_5.2908.204ON44356705.5
NDAI0I028303.511ON50059696.2
KLLA0A04906gna 1ON48043696.3
TPHA0A020808.204ON458205697.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR111C
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...  1019   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   911   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   910   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   886   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   678   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   678   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   677   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   667   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   663   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   661   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   661   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   657   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   654   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   655   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   653   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   650   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   646   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   647   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            640   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   636   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   630   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   625   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   612   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   612   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   609   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   604   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   602   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   598   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   594   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   592   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   586   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   571   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              567   0.0  
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    52   2e-06
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    52   2e-06
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    52   3e-06
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    50   9e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   1e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   1e-05
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    49   2e-05
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       48   3e-05
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    49   3e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    49   3e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    49   3e-05
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    47   5e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    47   7e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    47   9e-05
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    47   1e-04
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    46   1e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    45   3e-04
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    45   3e-04
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    45   4e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    44   7e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    44   0.001
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    43   0.001
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    43   0.002
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    42   0.002
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    42   0.002
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    42   0.002
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    42   0.003
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    42   0.003
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    41   0.005
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    41   0.005
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    40   0.009
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.010
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.010
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    40   0.016
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    39   0.020
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    39   0.020
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    39   0.023
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    39   0.029
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    39   0.030
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    39   0.034
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    38   0.055
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    38   0.064
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    37   0.085
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    37   0.10 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    37   0.12 
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    37   0.16 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    37   0.16 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    36   0.18 
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    36   0.23 
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    36   0.24 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    36   0.24 
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    36   0.24 
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    36   0.24 
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    35   0.41 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.48 
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    35   0.53 
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    35   0.57 
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    34   0.70 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   0.89 
TBLA0H01890 Chr8 complement(447319..450657) [3339 bp, 1112 aa] {...    34   1.0  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    34   1.0  
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    34   1.1  
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    34   1.1  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    34   1.1  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   1.2  
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    33   1.2  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    33   1.5  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    33   1.8  
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    33   2.2  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   2.3  
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     33   2.5  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    32   3.3  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    32   3.4  
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    32   3.5  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    32   4.5  
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    32   5.4  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    32   5.5  
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    31   6.2  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    31   6.3  
TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.2...    31   7.3  

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score = 1019 bits (2634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/507 (96%), Positives = 491/507 (96%)

Query: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60
           MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN
Sbjct: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60

Query: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120
           PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE
Sbjct: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120

Query: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXX 180
           RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIY            
Sbjct: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240
               CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK
Sbjct: 181 LSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240

Query: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300
           KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK
Sbjct: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300

Query: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360
           KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS
Sbjct: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420
           ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420

Query: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480
           PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480

Query: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507
           TTFLAPGTKWIQDWKEFHQDFFSKYRN
Sbjct: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/507 (85%), Positives = 463/507 (91%)

Query: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60
           M MTHQQDLK VFT KDL+FKPA KITKKDLN GVTKAEYAVRGAIPTRADELKEELK+ 
Sbjct: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60

Query: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120
           P VLPFDDIINANIGNPQQLDQKPLTFTRQVL+ILEYPEILRVG ++LASLNLF +DAL 
Sbjct: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120

Query: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXX 180
           RAE LL DIGGSIGAYSHSQGVPGIRQ+VA+FIT+RD GEPA PE+IY            
Sbjct: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240
               CKD QTGLLIPIPQYPLYTASASLFNAQVLPYYLDE SNWST SDEIEKVV+DAL+
Sbjct: 181 LSLLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240

Query: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300
           K I+PSVLIVINPGNPTGAVLSE+TIA+ICLIAAKYGI IISDEVYQEN+FN VKFHSMK
Sbjct: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300

Query: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360
           KVLRKLQ LYPGKFDNVQLASLHSISKGFM ECGQRGGYME++GFS++IRDALFKLMSIS
Sbjct: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420
           ICSVVTGQAVVDLMVKPPQPGDESY+QDH ER+KIFHEM TRA LL+ETF ELEGIECQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420

Query: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480
           PQGAMYLFPRLVLP+KAL ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480

Query: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507
           TTFLAPGT+WIQDWK FHQDFF+KYR+
Sbjct: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/507 (85%), Positives = 460/507 (90%)

Query: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60
           MTMTHQQDLK VF AKDLDFKPA KITKKDLN  VTKAEYAVRG+IPTRADELKEELKKN
Sbjct: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60

Query: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120
           P +LPFDDIINANIGNPQQLDQKPLTFTRQVL+ILEYPEIL+V H +LASLNLFS+DAL+
Sbjct: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120

Query: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXX 180
           RAE LL DIGGS+GAYSHSQGVPGIRQTVADFIT RDGGEPATPEDIY            
Sbjct: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240
               CKD++TGLLIPIPQYPLYTASASLFNAQVLPYYLDEE NWST SDEIEKVVQDAL+
Sbjct: 181 LSLLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240

Query: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300
           K IRPSVLIVINPGNPTGAVL+EETIARICLIAAKYGI +ISDEVYQEN+FND KFHSMK
Sbjct: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300

Query: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360
           KVLRKLQH YPGKFDNVQLASLHSISKGFM ECGQRGGYMEI+GFSQ+IRDALFKLMSIS
Sbjct: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420
           ICSVVTGQA+VDLMV PPQPGDESYEQD  ER KIF+EMRTRANLLYETF  LEGIECQ 
Sbjct: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420

Query: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480
           PQGAMYLFPRL+LP KA  ESERLG+EPDEFYC SLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480

Query: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507
           TTFLAPGT+WIQ+WK FHQ FF++YR+
Sbjct: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/507 (82%), Positives = 460/507 (90%)

Query: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60
           MTMT Q+DLK VFT KDLDFKPA K+TKKDLN  VTKAEYAVRGAIPTRA+ELKEELK++
Sbjct: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60

Query: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVL+ILEYPEILRV H++LASLNLF++DAL+
Sbjct: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120

Query: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXX 180
           RA+RLL+DIGGS+GAYSHSQGVPGIRQTVADFIT RDGGEPA PEDIY            
Sbjct: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240
               CKDSQTGLL+PIPQYPLYTASASL+NAQVLPYYLDEE++WST SDEIE+VV DALK
Sbjct: 181 LSLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240

Query: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300
           K IRPSVL+VINPGNPTGAVL+E TIA+ICLIAAKYGITIISDEVYQENIF DVKFHSMK
Sbjct: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300

Query: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360
           K+LRKLQ+L+PGKFDNVQLASLHSISKGFM ECGQRGGYMEI+GFSQ+IRDALFKLMSIS
Sbjct: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420
           ICSV TGQA++DLMVKPPQPGDESY+QD  ERLKI++EM TRANLLYETF ELEGI+CQK
Sbjct: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420

Query: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480
           PQGAMYLFP+L LP+KAL ESERL IEPD  YCTSLLESTGICTVPGSGFGQ+ GTYHVR
Sbjct: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480

Query: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507
           TTFL PGT+WIQDW++FHQDFF+KYR+
Sbjct: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/489 (64%), Positives = 386/489 (78%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           DF PA  +T +DLN  V KA+YAVRG+IP RA+EL+E+LK++P  LPFD I+NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL+QKPL+F RQVL+IL+YPE+L  G  EL S  +F RDA+ERA+R+L D+GGS+GAYS 
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR+TVADFIT RD GEPA PEDI+                C+  +TG+LIPIPQ
Sbjct: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+ VLPYYLDEES WSTN+ EIE VV ++++  IRPSVL+VINPGNPTG
Sbjct: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           +VLS E I +I  +AAKYGI +I+DEVYQENIF   +FHSMKKVLR+LQ  +PG +DNVQ
Sbjct: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           L SLHS SKG   ECGQRGGYME+ GF+ EIR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
           +PGDESYEQD  ER  I  E+  RA LL++TF  LEGIECQKP+GAMYLFP++ LP KA+
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
             ++ L   PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ W++FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 499 QDFFSKYRN 507
           + F+ +YR+
Sbjct: 551 KKFYDQYRD 559

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/489 (65%), Positives = 389/489 (79%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           +F PA ++T  +LN  V KA+YAVRGAIP RA+ELK +L+++P  LPFD I+NANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL+QKPL+F RQVL++L+YPEIL+   ++L +  LF +DALERA+ LL++IGG++GAYS 
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR+TVA+FIT+RD GEPA PEDI+                CK  +TG+LIPIPQ
Sbjct: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDE+S WSTN  EIE+VV  A  K+IRPSVL+VINPGNPTG
Sbjct: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLSE++I  I  IAAKYGI +I+DEVYQEN+FN+VKFHSMKKVLR LQ  +PG +D VQ
Sbjct: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG   ECGQRGGYME+ GF+ E+R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
           + GDES+EQD  ER  I  E+ TRA  LY+ F  LEGIECQKPQGAMYLFPRL LP KA+
Sbjct: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            +++ L + PDEFYC SLLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559

Query: 499 QDFFSKYRN 507
           QDF++ YR+
Sbjct: 560 QDFYNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/505 (63%), Positives = 391/505 (77%)

Query: 3   MTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPE 62
           MT       +  AK  DF PA ++T  DLN  V KA+YAVRG+IP RA+ELK +L+ NP 
Sbjct: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143

Query: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERA 122
            LPF  I+NANIGNPQQL QKPL+F RQVL+IL+YP+IL+     L    ++ RDA++RA
Sbjct: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203

Query: 123 ERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXX 182
           + LL++IGGS+GAYS SQGV GIR+TVA+FIT RDGGEPA PEDI+              
Sbjct: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263

Query: 183 XXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQ 242
             C+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE+S WSTN  EIE+VVQDA+++ 
Sbjct: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKV 302
           I PSVL+VINPGNPTGAVL+EE+I  I  IAAKYGI +I+DEVYQENI + VKF+SMKKV
Sbjct: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383

Query: 303 LRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISIC 362
           LRKLQ  +PGKFDNVQLASLHS SKG   ECGQRGGYME+IGF+ E+R  + KL SIS+C
Sbjct: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443

Query: 363 SVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQ 422
            VVTGQA+VDLMV PP+ GD SYEQD  ER  I  E+  RA+ LYETF  LEGIECQKPQ
Sbjct: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503

Query: 423 GAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTT 482
           GAMYLFP+L LP KA+ E++ L + PDEFYC SLL++TGICTVPGSGFGQ PGTYH+RTT
Sbjct: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563

Query: 483 FLAPGTKWIQDWKEFHQDFFSKYRN 507
           FLAPGT+WI+ W+ FH++F+  YR+
Sbjct: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/490 (64%), Positives = 386/490 (78%), Gaps = 2/490 (0%)

Query: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79
           F PA ++   DLN  V KA+YAVRG+IP RA++L+ +L+++P  LPFD IINANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 80  LDQKPLTFTRQVLAILEYPEILR-VGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           L+QKPL+F RQVL++L++PE+L  +  N  A+ +L+  DA+ RAE+LL DIGGS+GAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR+TVADFITRRD  EPA PEDI+                CK  +TG+LIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+  LPYYLDE+S WSTN+ EI+ VV DA+ + I+PSVL+VINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFN-DVKFHSMKKVLRKLQHLYPGKFDNV 317
           AVLSE+ IA I  IAAKYGI +I+DEVYQENIF+ DVKFHSMKKVLRKLQ  +PGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 318 QLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKP 377
           QLASLHS SKG   ECGQRGG+ME+ GFS EIR  + KL SIS+C VVTGQA+VDLMV P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 378 PQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKA 437
           PQ G+ESYE D  ER  I  E+  RAN L+ETF  LEGI+CQKPQGAMYLFPRL LP KA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 438 LCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEF 497
           + +++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W++F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 498 HQDFFSKYRN 507
           H++F++KYR+
Sbjct: 582 HKEFYNKYRD 591

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 383/489 (78%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           +F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPFD IINANIGNPQ
Sbjct: 104 EFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLS E+IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
             G+ES+E D  ER  I  ++ TRA  LYETF  LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 464 VEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            E+  L + PDEFYC  LLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFH 583

Query: 499 QDFFSKYRN 507
           ++FF +YR+
Sbjct: 584 KEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 382/489 (78%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           +F PA ++T  D+N  V KA YAVRGAIP RA+ELK +L+K+P+ LPF+ IINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL QKPLT+ RQVL++L+YPE+L     EL    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR++VADFIT+RDGGE A PEDI+                C+  +TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLS E+IA+I  +AAKYG  +I+DEVYQENIF   +F+SMKKVLR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQ 403

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
             G+ES+E D  ER  I  ++ TRA  LYETF  LEGIECQKPQGAMYLFP++ +P KA+
Sbjct: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            E+  L + PDEFYC  LLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +W++ W+ FH
Sbjct: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583

Query: 499 QDFFSKYRN 507
           ++FF +YR+
Sbjct: 584 KEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/489 (63%), Positives = 385/489 (78%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           DF PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPFD IINANIGNPQ
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ DIGGS+GAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+LIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE+S WSTN +EIE VV++A++ +I+P+VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLS E++++I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
             G+ES+E D  ER  I  ++ TRA  LY+TF  LEGIECQKPQGAMYLFP++ LP KA+
Sbjct: 464 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            E+  L + PDEFYC SLLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 524 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583

Query: 499 QDFFSKYRN 507
           ++FF +YR+
Sbjct: 584 KEFFDQYRD 592

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/488 (63%), Positives = 382/488 (78%), Gaps = 1/488 (0%)

Query: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79
           F+PA K++ +DLN  V +A+YAVRG IP +A+ELK +L ++P+ LPFD IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139
           LDQKPLTF RQVL++L+ P++L     E  S  ++  DA++RA RLL++IGGS+GAYSHS
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS-QIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 140 QGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQY 199
           QGV G R+TVADFIT+RDGGE A  EDI+                C+  QTG+LIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 200 PLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGA 259
           PLYTAS +L N+  LPYYLDEESNWSTN +EIEKVV +++ K + P  L+VINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 260 VLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQL 319
           +LS E+I +I  +AAKYGI +I+DEVYQEN+FN  +FHSM+KVL+ LQ  + GKFDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 320 ASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379
           ASLHS SKG   ECGQRGGYME++GFS ++R    KL SIS+C VVTGQA+VDLMV PP+
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 380 PGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALC 439
           PGD SYEQD  ER +I   +  RA++LYETF  LEGIECQKPQGAMYLFPRL L  KA+ 
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQ 499
           ++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+EFH+
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 500 DFFSKYRN 507
            F+++YR+
Sbjct: 524 KFYNEYRD 531

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/495 (61%), Positives = 391/495 (78%), Gaps = 2/495 (0%)

Query: 14  TAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINAN 73
           T   L F+PA K+   DLN  +  AEYAVRGAIP +A+EL+ +L + P++LPF+ I  AN
Sbjct: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87

Query: 74  IGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSI 133
           IGNPQQLDQKPLTF+RQV++IL+YP +L     +L +   + RDA +RA  LL  IGGS+
Sbjct: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 134 GAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLL 193
           GAYS +QGV GIR++VADFITRRD GE A+P+DI+                C+DS TG++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 194 IPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINP 253
           IPIPQYPLYTAS +++N+ +LPYYLDEES WST ++EIE+ V D++K+ + P V++VINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 254 GNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYP-G 312
           GNPTGAVLS +TIA+I  IAAKYGI +++DEVYQ NI+  VKFHSMKKVLR LQ  +P G
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 313 KFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVD 372
           ++DNVQLAS+HS SKG   ECGQRGGYME++GFS E+R  + KL SISICSVVTGQA+VD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 373 LMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLV 432
           LM+ PP+ GD+SYE D  ER +I + M+TR  LLY+TF++LEGIECQ+PQGAMYLFP+L+
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 433 LPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQ 492
           L KKA+ E++ LG++PDEFYC  LL++TGICTVPGSGFGQ+ GTYHVRTTFLAPGT+WI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 493 DWKEFHQDFFSKYRN 507
           DW+ FH+ F+ KYR+
Sbjct: 507 DWETFHKAFYDKYRD 521

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/494 (62%), Positives = 385/494 (77%), Gaps = 2/494 (0%)

Query: 14  TAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINAN 73
           +  +L F PA + T KD+N  V  A+YAVRGAIP RA+ELK +L +NP  LPF+DIINAN
Sbjct: 83  SHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINAN 142

Query: 74  IGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSI 133
           IGNPQQL QKPL+F RQVL++L+YPE++    N   ++    +DA++RA+RLL+DIGGS+
Sbjct: 143 IGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSV 200

Query: 134 GAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLL 193
           GAYS SQGV GIR+TVADFIT RD G  A PEDI+                C+  +TG+L
Sbjct: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260

Query: 194 IPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINP 253
           IPIPQYPLYTA+ +L N+  LPYYL+EE+ WST+ +E+E ++ D+++  I+PSVL+VINP
Sbjct: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINP 320

Query: 254 GNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGK 313
           GNPTGAVLSEE I +I  +AAKYGI +I+DEVYQEN+F DVKFHSMKKVLR+LQ   PG 
Sbjct: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGL 380

Query: 314 FDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDL 373
           +DNVQLASLHS SKG   ECGQRGGYME++GF+ +IR  + KL SIS+C VVTGQA+VDL
Sbjct: 381 YDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDL 440

Query: 374 MVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVL 433
           MV PPQ G+ESYEQD +ER  I  E+  RA LL++ F +L+GI CQKPQGAMYLFP+L L
Sbjct: 441 MVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLEL 500

Query: 434 PKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQD 493
           P KA+ E+    + PDEFYC SLLE TGICTVPGSGFGQ PGTYH+RTTFLAPGTKWI+D
Sbjct: 501 PYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIED 560

Query: 494 WKEFHQDFFSKYRN 507
           W +FHQ+F++K++N
Sbjct: 561 WVDFHQEFYNKFKN 574

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 380/489 (77%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           +F PA ++T  D+N  V KA+YAVRGAIP RA+ELK +L+K+P+ LPF+ IINANIGNPQ
Sbjct: 104 EFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQ 163

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL QKPLT+ RQVL++L+YPE+L     +L    LF  DA++RA+ L+ +IGGS+GAYS 
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSS 223

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR++VA+FIT+RD GE + PEDI+                C+  +TG+LIPIPQ
Sbjct: 224 SQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L N+Q LPYYLDE S WSTN +EIE VV++A++ +I+ +VL+VINPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTG 343

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLS E+IA+I  +AAKYG  +I+DEVYQENIF   KFHSMKK+LR LQ  +PGKFDNVQ
Sbjct: 344 AVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQ 403

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG   ECGQRGGYME+ GFS E+R  + KL SIS+C VVTGQA+VDLMV+PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
             G+ES+E D  ER  I  ++ TRA  LY+TF  LEGIECQKPQGAMYLFP++ LP +A+
Sbjct: 464 LEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAV 523

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            E+  L + PDEFYC  LLESTGICTVPGSGFGQ PGTYH+RTTFLAPG +WI+ W+ FH
Sbjct: 524 QEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583

Query: 499 QDFFSKYRN 507
           ++FF  YR+
Sbjct: 584 KEFFDHYRD 592

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  650 bits (1676), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/487 (62%), Positives = 383/487 (78%), Gaps = 2/487 (0%)

Query: 21  KPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQL 80
           KPA K++  D+N  V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103

Query: 81  DQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQ 140
           DQKPLTF R+VL++L++PE+L      L +L  +  D+++RA+RLL+++GGS+GAYS SQ
Sbjct: 104 DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 161

Query: 141 GVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYP 200
           GV GIR+TVADFIT+RD GE + PEDIY                CK   TG+LIPIPQYP
Sbjct: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221

Query: 201 LYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260
           LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++K I+P+ L+VINPGNPTGA+
Sbjct: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281

Query: 261 LSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLA 320
           LSE++I +I  +AAKYGI +I+DEVYQEN+F   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 341

Query: 321 SLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQP 380
           SLHS SKG   ECGQRGGYME++GF+ +IR    KL SIS+C VVTGQA+VDLMV PPQP
Sbjct: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401

Query: 381 GDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCE 440
           GDESYEQD  ER  I   +  RA+ L+ETF  LEGIEC+KPQGAMYL+P+L LP K + E
Sbjct: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461

Query: 441 SERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQD 500
           ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W++FH+ 
Sbjct: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521

Query: 501 FFSKYRN 507
           FF KYR+
Sbjct: 522 FFDKYRD 528

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/489 (60%), Positives = 382/489 (78%), Gaps = 1/489 (0%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           DF+PA K++ KD+N  V  A++A+RG+I  +A++L+ +L KNP  LPFD+I  ANIGNPQ
Sbjct: 10  DFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQ 69

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           +L+QKPLTF RQV++IL+YPE+L    + L    +F+ D+ +RAERLL DIGGS+GAYS 
Sbjct: 70  ELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSA 128

Query: 139 SQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQ 198
           SQGV GIR+T A++IT+RDGGEP+ PEDI+                C+  QTG+LIPIPQ
Sbjct: 129 SQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQ 188

Query: 199 YPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTG 258
           YPLYTA+ +L  + ++PYYLDEES WSTN+ EIEK+V D++KK I+PSV++VINPGNPTG
Sbjct: 189 YPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTG 248

Query: 259 AVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQ 318
           AVLSE  IA+I  IAAKYGI +++DEVYQENIF+ V+FHS KKVLR LQ  YPGKFDN+Q
Sbjct: 249 AVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQ 308

Query: 319 LASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LAS+HS SKG   ECGQRGGYME++GF+ E+R  L KL  +++CSVVTGQA+VDLM+ PP
Sbjct: 309 LASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPP 368

Query: 379 QPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKAL 438
           + GD SYE D  ER +IF  M  RA  LY  F +L+GIECQKPQGAMYL+P L+L KKA+
Sbjct: 369 KKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAI 428

Query: 439 CESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFH 498
            ++E L + PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +WI  W++FH
Sbjct: 429 AKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFH 488

Query: 499 QDFFSKYRN 507
           + F+ KY++
Sbjct: 489 KHFYEKYQD 497

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/486 (63%), Positives = 368/486 (75%)

Query: 22  PAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLD 81
           PA K+   ++N  V KA+YAVRGAIP  A EL  +LKK+P  LPFD+I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 82  QKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQG 141
           QKPLTF RQVL++L+YP +L      L    L+ +DA+ RA RLLNDIG S+GAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 142 VPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPL 201
           + GIR+TVA FIT RDGGE A  EDI+                CK  +TG+LIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 202 YTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVL 261
           YTAS +L N+  LPYYLDE+S WSTN  EIE VV +A+++ I+PSVL+VINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 262 SEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLAS 321
           SEE I++I  IAAKYGI +I+DEVYQEN+F+  +FHSMKK+LRKLQ   PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 322 LHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381
           LHS SKG   ECGQRGGYMEI GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP+PG
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 382 DESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCES 441
           DESYE D  ER  I   +  RA  L+ TF  LEGIECQKP+GAMYLFPRL+LP KA+  +
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDF 501
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI+ W+ FH+ F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 502 FSKYRN 507
           + +YR+
Sbjct: 529 YEEYRD 534

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/490 (62%), Positives = 379/490 (77%), Gaps = 4/490 (0%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN--PEVLPFDDIINANIGN 76
           +FKPA KIT  DLN  V K+EYAVRG+IP RA+EL+ EL  N   + L F++I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136
           PQQLDQKPLTF+RQV++IL+YPE+L    N L S  +F  DA+ERAE LL  IGGS+GAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           S SQGV GIR+TVA++IT RD GE A+P+DI+                CKD  TG+LIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           PQYPLYTA+ +L +A++LPYYL+EES WSTN++EIEKVV DA+   ++PSV++VINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316
           TG+VLS++ I  I  I AKYGI +I+DEVYQENIF D +FHSMKKVLR LQ  YPGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIF-DGEFHSMKKVLRSLQKQYPGKYDA 324

Query: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG   ECGQRGGYME++GF  EIR A+ KL SIS+CSV+TGQA+VDLMV 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436
           PP+ GDESYE D+ ER  I   ++ RA  LY  F +L+G+ECQKPQGAMYLFP+L  P+ 
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496
            + E+    + PDEFYC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W + WK 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 497 FHQDFFSKYR 506
           FH++FFSKY+
Sbjct: 505 FHEEFFSKYQ 514

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 378/490 (77%), Gaps = 4/490 (0%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEEL--KKNPEVLPFDDIINANIGN 76
           DF+PA KI+  DLN  +  AEYAVRG+I  RA+EL+ EL  K  P   PF+ II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136
           PQQLDQKPLTF+RQV++ILEYP +L+   + L S  ++ +DALERAE L + IG S+GAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKF-KDVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           S +QGV GIR+T A FI++RD  E A+ +DI+                C++  TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           PQYPLYTAS  + NA++LPYYLDEES WST  +EIE  V +A++  I+PS ++VINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316
           TGAVLS + I RI  +AAKYGI +I+DEVYQ+NIFN  +FHSMKK+LR+LQ  YPGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG   ECGQRGGYMEI+GFS E+R  L KL SI+ICSVVTGQA+VDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436
           PP  GDESYE+D +ER +I   ++ RA+ LY+TF  LEGIECQKPQGAMYLFPRL+LP +
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496
           A+ E+++L +E DEFYC  LLE+TGICTVPGSGFGQR GTYHVRTTFL+PGT+WI DWK+
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 497 FHQDFFSKYR 506
           FH+ F  +Y+
Sbjct: 501 FHEKFMKEYQ 510

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/486 (60%), Positives = 373/486 (76%), Gaps = 8/486 (1%)

Query: 22  PAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLD 81
           PA K+   DLN  V KA+YAVRG+IP RA+ELK  L+   + LPFD +INANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLK 93

Query: 82  QKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQG 141
           QKPLTF RQVL+IL+YPE+L  G N      +F +DA+ERA +LL +IG S+G+YS SQG
Sbjct: 94  QKPLTFYRQVLSILQYPELLESGSN------IFKKDAIERARKLLKEIG-SVGSYSSSQG 146

Query: 142 VPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPL 201
           +P IR+TVA+FIT+RD GE +TP DI+                CK+ ++G+LIPIPQYPL
Sbjct: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPL 206

Query: 202 YTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVL 261
           YTA+ +L NA  LPYYLDE   WST+ +EIE+V+ D+L K I+P+ L++INPGNPTG++L
Sbjct: 207 YTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266

Query: 262 SEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLAS 321
           S E++ +I  +AA +GI II+DEVYQEN+FN+ KFHSMKKVLR LQ  +PG++D VQLAS
Sbjct: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326

Query: 322 LHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381
           LHS SKG   ECGQRGGYME+ GF+ EI+  + KL SIS+C VVTGQA+VDLMV PPQ G
Sbjct: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386

Query: 382 DESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCES 441
           DESYEQD  ER  I +++  RA LL+E F  +EG+ CQKP+GAMYLFP++ LP K L +S
Sbjct: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446

Query: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDF 501
           + L I PDEFYC +LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI  W +FH +F
Sbjct: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506

Query: 502 FSKYRN 507
           + KYR+
Sbjct: 507 YDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/491 (61%), Positives = 374/491 (76%)

Query: 17  DLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGN 76
           +L+FKPAG++T  DLN  V KA+YAVRG IPTRA+ELK +L + P  LPFD IINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 77  PQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136
           PQQL Q+PL+F RQVL++L+YP +L     +  S  ++ +DA+ RA+++L DIGGS+GAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           S SQGV GIR+TVA+FIT RDGGEPA PEDI+                CK  +TG+LIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           PQYPLYTA+ +L N+  LPY+LDE + WS N  EIE V++ A++  I+P VL+VINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316
           TGAVLS+E I  I  IAAKYGI +I+DEVYQENIF+ +KFHS+K VLR+LQ   PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG   ECGQRGGYMEIIGF+ E+R  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436
           PP+ G+ES+  D  +R  I  ++  RA LL++TF  L+GIECQKP GAMYLFP+L LP +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496
           A+ E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI  WK+
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 497 FHQDFFSKYRN 507
           FH +F  KY +
Sbjct: 529 FHIEFMEKYNS 539

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 374/490 (76%), Gaps = 4/490 (0%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           DF+PA K++ KDLN  V KAE+AVRG IP +A EL+ +L KNP  LPF++I  ANIGNPQ
Sbjct: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLN--LFSRDALERAERLLNDIGGSIGAY 136
           +L QKPLTF RQV++IL+YPE+L    NEL S    +++ D+ +RAE+LLN+IGGS+GAY
Sbjct: 72  ELHQKPLTFARQVVSILQYPELLN-RRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           S SQGV GIR+T+A++IT+RD GE A+P DI+                    QTG+L+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQ-DALKKQIRPSVLIVINPGN 255
           PQYPLYTA  +L NA +LPYYL+EES WS +++EIEK ++ +A+ K I+P V+++INPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFD 315
           PTG++LSE+++ +I  IAAKYGI II+DEVYQEN+FN  KFHS KKVLR LQ  +P +++
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 316 NVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMV 375
           NVQLASLHS SKG   ECGQRGGYMEIIGF+ ++R+ + KL  I +C VVTGQA++DLM+
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 376 KPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPK 435
            PP+ GD+SY+ D  ER +I ++M  RA  LY+ F  +EGI+CQKPQGAMYLFPRL+L  
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 436 KALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWK 495
           K + E+++  +EPDEFYC  LL  TGICTVPGSGFGQ+P TYH+RTTFLAPG +WI  W+
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 496 EFHQDFFSKY 505
           +FH+ F  +Y
Sbjct: 491 KFHKAFLKRY 500

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/496 (59%), Positives = 373/496 (75%), Gaps = 9/496 (1%)

Query: 16  KDLDFKPAG-KITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANI 74
           KD   KP G K T +D+N  V  A+YAVRG IP RA+ELK++L + P  LPFD IINANI
Sbjct: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87

Query: 75  GNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNL---FSRDALERAERLLNDIGG 131
           GNPQQLDQKPLTF RQVLA+L+ P+++    ++L+S  L   F  DA+ERA+++L  +GG
Sbjct: 88  GNPQQLDQKPLTFYRQVLALLQNPDLI----SDLSSGELHKFFKPDAVERAKKMLKQVGG 143

Query: 132 SIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTG 191
           S+GAYS+SQGV G R++VA+FI  RDG EPA+ +DI+                C   + G
Sbjct: 144 SVGAYSNSQGVAGFRESVAEFIEERDG-EPASAQDIFLTTGASGAVSYILSLFCNGPENG 202

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVI 251
            LIPIPQYPLYTAS +L N+  LPYYLDEES WS ++++IEKVVQD++KK IRP+ L+VI
Sbjct: 203 ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVI 262

Query: 252 NPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYP 311
           NPGNPTGA+L+ +TI  +  +AAKY + II+DEVYQEN FND +F SMKKVLR LQ   P
Sbjct: 263 NPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP 322

Query: 312 GKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVV 371
           GK+DNVQLASLHS SKG   ECGQRGGYME++GFS+E++    KL SIS+C VVTGQA++
Sbjct: 323 GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALI 382

Query: 372 DLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRL 431
           DLMV+PP+ GD SYEQD  ER  I   +  R+ LLY+ F+ +EG+ CQ+PQGAMYLFP+L
Sbjct: 383 DLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKL 442

Query: 432 VLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWI 491
            L  KA+ ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI
Sbjct: 443 ELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWI 502

Query: 492 QDWKEFHQDFFSKYRN 507
             WK+FH+ F   +R+
Sbjct: 503 DSWKKFHEKFTEDHRD 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/513 (57%), Positives = 376/513 (73%), Gaps = 10/513 (1%)

Query: 2   TMTHQQDLKGVFTAK-----DLDFKPAG-KITKKDLNTGVTKAEYAVRGAIPTRADELKE 55
           TM H + +    +AK     DL  K  G K T +D+N  V  A+YAVRG IP RA+EL+ 
Sbjct: 10  TMPHSRLILRRLSAKAAVKSDLSQKALGSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRH 69

Query: 56  ELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILR-VGHNELASLNLF 114
           +L + P  LPF+ IINANIGNPQQLDQKPLTF RQVL++L+ P ++  +   EL    LF
Sbjct: 70  KLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH--KLF 127

Query: 115 SRDALERAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXX 174
             DA+ERA+++L  +GGS+GAYS SQGV G RQ+VA+FI  RDG EPA+  DI+      
Sbjct: 128 KPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERDG-EPASANDIFLTAGAS 186

Query: 175 XXXXXXXXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKV 234
                     C  S+ G LIPIPQYPLYTA+ +L +A  LPYYLDE S WS +++++E+V
Sbjct: 187 SAVSAILSMFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQV 246

Query: 235 VQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDV 294
           V+DA++K +RP+ L+VINPGNPTGA+LS E I +I  +AAKY + +I+DEVYQEN F+D 
Sbjct: 247 VKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDA 306

Query: 295 KFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALF 354
            F SMKKVLR LQ   PGK+DNVQLASLHS SKG   ECGQRGGYME++GFS+E++    
Sbjct: 307 DFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFL 366

Query: 355 KLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELE 414
           KL SIS+C VVTGQA+VDLMV+PP+ GD SYE D  ER  I + +  ++ LLYETF+ LE
Sbjct: 367 KLASISLCPVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLE 426

Query: 415 GIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRP 474
           G+ CQKPQGAMYLFP+L L +KA+ ++E LG+ PDE+YC  LLE+TGICTVPGSGF Q P
Sbjct: 427 GVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVP 486

Query: 475 GTYHVRTTFLAPGTKWIQDWKEFHQDFFSKYRN 507
           GTYH+RTTFLAPGT+W+  WK+FHQ F  ++R+
Sbjct: 487 GTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/498 (60%), Positives = 375/498 (75%), Gaps = 7/498 (1%)

Query: 13  FTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINA 72
            + K  +FKPA K+T  DLN  V KA+YAVRG IP RA+ LK++L  NP  LPF  +INA
Sbjct: 29  ISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINA 88

Query: 73  NIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLN---LFSRDALERAERLLNDI 129
           NIGNPQQL+QKPLTF RQVL++L+YP +L    +E  S N   L+ +DA+ERA+R+LNDI
Sbjct: 89  NIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILNDI 144

Query: 130 GGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQ 189
           G S+G+YS SQGV G+R+TVA++I+RRDGGE A  EDI+                CK  +
Sbjct: 145 GSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKE 204

Query: 190 TGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLI 249
           +G+LIPIPQYPLYTA+ +L N   LPYYL+E S WSTN +EIE VV +A++++I P VL+
Sbjct: 205 SGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLV 264

Query: 250 VINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHL 309
           VINPGNPTGA+LS E+I +I  +AA +GI +I+DEVYQENIF   +FHSMKKVLR LQ  
Sbjct: 265 VINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRR 324

Query: 310 YPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQA 369
            PGK++NVQLASLHS SKG   ECGQRGGYME+ GFS EI+  + KL SIS+C VVTGQA
Sbjct: 325 VPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQA 384

Query: 370 VVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFP 429
           +VDLM  PP+ G+ SYEQD  ER  I  E+  RA  L++ F E+EG+ CQKPQG+MYLFP
Sbjct: 385 LVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFP 444

Query: 430 RLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTK 489
           ++ +P KAL +++ L I PDE YC  LLE+TGICTVPGSGFGQ+PGT+H+RTTFLAPGT 
Sbjct: 445 KIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTS 504

Query: 490 WIQDWKEFHQDFFSKYRN 507
           WI  W+EFHQ F +KYR+
Sbjct: 505 WIDQWREFHQIFCNKYRD 522

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/491 (56%), Positives = 367/491 (74%), Gaps = 2/491 (0%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           DF P  K+T KDLN+ + K +YAVRG IP RA+ELK +L+K+P+ LPF+ IINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 79  QLDQKPLTFTRQVLAILEYPEILR--VGHNELASLNLFSRDALERAERLLNDIGGSIGAY 136
           QL QKPL+F R+VL+IL+YP+IL        L  L ++ +D + RA +LL +IGGS+GAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           S SQGVPGI+QTVAD+IT+RD GE A PEDI+                C    TG+LIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           PQYPLYTA+ +L  A  + YYL+EE NWS N+ E+E  +Q+++K  I+P+ +++INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316
           TG++L+E+ IA I  I+AKYG+ II+DEVYQEN+F+  +FHS+KKVLRKLQ  Y G ++ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG + ECGQRGGYME+IG + ++R  + KLMSISICSVVTGQA++D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436
           PP+PGDESYE D  ER  I +++ +R+  L++ F  LEG+EC +PQGAMYLFP+ + P+K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496
            +  +++L  E D  YC  LLE TGICTVPGSGFGQ+P TYH+RTTFL PG  WI  W++
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 497 FHQDFFSKYRN 507
           FH +F  +YR+
Sbjct: 488 FHTEFCERYRS 498

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/491 (57%), Positives = 363/491 (73%), Gaps = 3/491 (0%)

Query: 18  LDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNP 77
           + F PA K++  DLN     A+YAVRG+IP RA++L  ++  +P  LPFD II ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 78  QQLDQKPLTFTRQVLAILEYPEILRVGH--NELASLNLFSRDALERAERLLNDIGGSIGA 135
           QQ+ QKPLTF RQVL+ILEYP IL       +L  L ++ RD +ERA ++L+ IGGS+GA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 136 YSHSQGVPGIRQTVADFITRRDG-GEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLI 194
           YS SQGV G RQTVADFI +RDG  + A+P DI+                C   + G+LI
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG 254
           PIPQYPLYTA+ +L N+  +PYYL E ++WSTN+ EIE  +++++   ++P  +++INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 255 NPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKF 314
           NPTGA+LSE  +A I  I+AKYGI II+DEVYQENIF   +FHSM+KVL  LQ  +PG +
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTY 300

Query: 315 DNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLM 374
           DNVQLASLHS SKGF+ ECGQRGGYME+IGF  E+   + KL SISICSVVTGQA++DL+
Sbjct: 301 DNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLV 360

Query: 375 VKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLP 434
             PPQPGD SY+ D +ER KI  ++  RA+ LY  F  LEG+ECQ+PQGAMYLFP+L+LP
Sbjct: 361 TCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILP 420

Query: 435 KKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDW 494
            KA+ ++ +L I PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ W
Sbjct: 421 DKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERW 480

Query: 495 KEFHQDFFSKY 505
           +EFHQ F+ ++
Sbjct: 481 REFHQQFYERF 491

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/491 (56%), Positives = 370/491 (75%), Gaps = 5/491 (1%)

Query: 18  LDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNP 77
           + F+P   +  +DLN+ V +A+YAVRG IP RA EL+ +L ++P+ LPF  II ANIGNP
Sbjct: 48  IRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNP 107

Query: 78  QQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSR-DALERAERLLNDIGGSIGAY 136
           QQL QKPL+F+R+VL++LE P +L++    +  LNL  + DA+ RA+R++ D+  SIGAY
Sbjct: 108 QQLGQKPLSFSREVLSLLESPNLLQM---PMEVLNLIYKPDAVRRAKRMMRDLQTSIGAY 164

Query: 137 SHSQGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPI 196
           SHSQGV G R+TVA++++ RDG EPA+ EDI+                CK  ++G+LIPI
Sbjct: 165 SHSQGVLGFRKTVAEYLSSRDG-EPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPI 223

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           PQYPLYTA+ +L N   LPYYLDEES WS N D++E+++ ++++K ++P+ L+VINPGNP
Sbjct: 224 PQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNP 283

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDN 316
           TGA+L  E++ RI +IAAKY I +I+DEVYQEN+F  +KF+SMKKVLR LQ  Y   F N
Sbjct: 284 TGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSN 343

Query: 317 VQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQL SLHS SKG   ECGQRGGYME++GFS +IR+ + K+ SI +CS V GQA+VDLM+ 
Sbjct: 344 VQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLS 403

Query: 377 PPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKK 436
            P+PGDESYE+D  ER  I + ++ R+  L+ETF  LEG+EC+KPQG+MYLFPRLVLP+K
Sbjct: 404 RPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQK 463

Query: 437 ALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKE 496
           A+  +E L ++PDEFYCT LL STGICTVPGSGFGQ P T H+RTTFL PGT+WI+ W+ 
Sbjct: 464 AIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWEL 523

Query: 497 FHQDFFSKYRN 507
           FH+ F+ KYR+
Sbjct: 524 FHKSFYDKYRD 534

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/484 (58%), Positives = 359/484 (74%), Gaps = 2/484 (0%)

Query: 23  AGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQ 82
           A ++  +DLN  V KA+YAVRGAIP+ AD+LK +L K+P  LPF+ +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 83  KPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQGV 142
           KPL+F RQVL+ILEYP +L      + S+  ++ D++ERA+ LL DIG SIGAYS+SQGV
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198

Query: 143 PGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPLY 202
            GIRQTVADFIT RD GE A P+DI+                CK  QTG+LIPIPQYPLY
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 203 TASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLS 262
           TA+ +L +A  LPYYLDE + WST+ +EI KV QD+L+  I+P+ L+VINPGNPTG+VL+
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 263 EETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASL 322
            E I  +  +AAKYG+ +I+DEVYQ+NIF   +FHSMKK+LR LQ   P K+DN+QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 323 HSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGD 382
           HS SKG + ECG RGGY E IGF+ E++  + KL SIS+CS V GQA+VDLM  PP+ G+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 383 ESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESE 442
            SYE D  ER  I    + R+N LYE F  LEG+ CQKPQGAMY+FP + LP  A+  ++
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 443 RLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDFF 502
            L I PDEFYC  LL++TGICTVPGSGFGQ+PGTYHVRTTFLAPG +W++ W++FH +FF
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 503 SKYR 506
            KYR
Sbjct: 559 EKYR 562

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/488 (58%), Positives = 355/488 (72%), Gaps = 3/488 (0%)

Query: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79
           F PA  +T  D+N  V KA+YAVRG IPTRA+EL+  L+++P  LPF  II ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139
           L QKPLTF RQV+++++ P++L +    L     F  D + RA R+L D GGS+GAYS S
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 140 QGVPGIRQTVADFITRRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQY 199
           QGV G R+TVA FI RRDG  PA P+++Y                CK  +TG+LIPIPQY
Sbjct: 155 QGVKGYRRTVAQFIERRDG-IPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 200 PLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGA 259
           PLYTA+ +  NA  LPYYL+E   WSTN DE+E+V+ D+ K+ I P  L+VINPGNPTG+
Sbjct: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 260 VLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQL 319
           VLS + +  I  +AAKYGI +I+DEVYQ+N+F D KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 320 ASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379
           ASLHSISKG   ECGQRGGYME+IGF +E+R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 380 PGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALC 439
            GD SYEQ   E   I+HE+  R+ LL++TF  LEGIEC  PQGA+YLFP+L LP+KA+ 
Sbjct: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQ 499
            +++LGI  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGTKWI+ WK+FH+
Sbjct: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 500 DFFSKYRN 507
            F+ KYR+
Sbjct: 514 KFYDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/494 (55%), Positives = 361/494 (73%), Gaps = 8/494 (1%)

Query: 20  FKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQ 79
           F PA K +  D+N  + KAEYA+RG IP RA+EL  +L +N + LPF  I+ ANIGNPQQ
Sbjct: 8   FLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQ 67

Query: 80  LDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHS 139
           LDQ+PLTF RQV++++++P++L+   + L +  ++S+D++ERA +LLN IGGS+GAYS S
Sbjct: 68  LDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 140 QGVPGIRQTVADFITRRD-GGEPA------TPEDIYXXXXXXXXXXXXXXXXCKDSQTGL 192
           QGV  IR+ VA FI +RD   +P       T  +++                 KD   G+
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVIN 252
           L+PIPQYPLYTA+ +L  +++LPYYL+E +NWST+  +IE++V DA+K+ I+P+ L+VIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 253 PGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPG 312
           PGNPTGA+L++++I  I  IAA+YGI II+DEVYQEN++   +FHS KKVL +L+  YP 
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 313 KFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVD 372
           K+DNVQLASLHSISKG   ECGQRGGYMEI GFS +++  L K+ SISICSVVTGQ +VD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 373 LMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLV 432
           LMV PPQPGDESYE D  ER  I   +  ++N LY+ F  L GI CQKPQGAMYLFPRL 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 433 LPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQ 492
           L + A+  +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL PG +WI 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 493 DWKEFHQDFFSKYR 506
            W++FH +F  KY+
Sbjct: 487 SWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/497 (54%), Positives = 352/497 (70%), Gaps = 10/497 (2%)

Query: 19  DFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQ 78
           D  PA K +  D++  +   EYA+RG IPTRADEL+E+L  +P  LPF  II ANIGNPQ
Sbjct: 5   DCTPAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQ 64

Query: 79  QLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSH 138
           QL+Q+PLTF RQVL+++EYP ++    N L    +++ DA++RAE +LN IGGS+GAYS 
Sbjct: 65  QLEQEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSS 123

Query: 139 SQGVPGIRQTVADFITRRDGGEPA---------TPEDIYXXXXXXXXXXXXXXXXCKDSQ 189
           SQG+  IR+ VA  I +RD  E           T  +I+                 KD  
Sbjct: 124 SQGILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDEN 183

Query: 190 TGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLI 249
            G+L+PIPQYPLYTA+ +L N+++LPYYL+E+ NWST+ +EIE +++DA+ + I+P+ L+
Sbjct: 184 CGVLLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLV 243

Query: 250 VINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHL 309
           +INPGNPTGA+LS E+I +I  IAAKYGI II+DEVYQ NI+ D KFHS KK+L  L+  
Sbjct: 244 IINPGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQ 303

Query: 310 YPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQA 369
           YP K+DNVQLASLHSISKG   ECGQRGGY E++GFS EI+  + KL SI ICSVVTGQ 
Sbjct: 304 YPKKYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQI 363

Query: 370 VVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFP 429
           +VDLM KPP+ GD SY+ D  ER  I   +  ++N LY+ F  L GI CQKPQGAMYLFP
Sbjct: 364 LVDLMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFP 423

Query: 430 RLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTK 489
           RL L    + E++   +EPDEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL  G +
Sbjct: 424 RLHLTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIE 483

Query: 490 WIQDWKEFHQDFFSKYR 506
           WI+ W++FH +F ++Y+
Sbjct: 484 WIKLWEKFHLEFMNQYK 500

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/258 (22%), Positives = 103/258 (39%), Gaps = 42/258 (16%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W+ + ++    + D  K       +I+  P NP G V + E + RI  I  K  + II
Sbjct: 181 TEWTVDYEQFANAITDKTK------AVIINTPHNPIGKVFTREELTRIGEICVKKNVVII 234

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           SDEVY+   F D  F  +  +  ++  L           S+ S  K F    G R G+  
Sbjct: 235 SDEVYEHLYFTD-SFTRIATLSPEIGQL---------TLSVGSAGKSFA-ATGWRVGW-- 281

Query: 342 IIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKI--FHEM 399
           ++  + E+   + K  +  IC               P P  E+     ++ L+I  F  M
Sbjct: 282 VVSLNPELLSYVSKAHT-RIC------------FASPSPLQEAVANSINDALEINYFENM 328

Query: 400 RT----RANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFY 452
           R     + ++    FKEL G+   +P+G  ++   F ++ +P+      E      D   
Sbjct: 329 RQEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDFRI 387

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 388 AYWLINELGVVAIPPTEF 405

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 121/289 (41%), Gaps = 51/289 (17%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L +E ++  N   ++ ++++  K      ++I+ NP NP
Sbjct: 110 PTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNNTK------LIIINNPNNP 163

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKK--VLRKLQHLYPGKF 314
            G+V+ ++ + +IC +  +  I + SDEVY+        FHS++   V      LY    
Sbjct: 164 LGSVIKKDLLKQICKLCEENDIYLHSDEVYRP------IFHSLEDEMVPPSACELYSKAI 217

Query: 315 DNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDAL----FKLMSISICSVVTGQAV 370
            +  ++  +S++       G R G++ +    Q +RDA     + ++S+S+      Q V
Sbjct: 218 VSGSMSKAYSVA-------GIRLGWL-VSKDKQFLRDAASRRDYNMISVSMIDDQIAQYV 269

Query: 371 VDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPR 430
           +D         +  Y    +  L   +  R   + + E   + E     KP  A      
Sbjct: 270 LD---------NREYVIKRNYEL-CLNNFRLLNDFMDEHSDKFEFY--HKPTAA------ 311

Query: 431 LVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHV 479
                  +C ++  G+     + T L E  G+  VPG  FG  PGT  +
Sbjct: 312 ------TVCLAKVKGVNDTMKFATFLAEKYGVLAVPGEAFGV-PGTIRI 353

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 55/106 (51%), Gaps = 14/106 (13%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVIN-PGN 255
           P Y   ++   +F A+V   +L +E+N+  N  E+E++++   K        IV+N P N
Sbjct: 113 PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK-------CIVLNTPNN 165

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKK 301
           P  +V+  ET+  I  +A K+GI +  DEVY         FHS +K
Sbjct: 166 PLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 56/256 (21%), Positives = 101/256 (39%), Gaps = 42/256 (16%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W  + D +EK   +  K       +I+  P NP G V +E+ + ++  +  ++   +ISD
Sbjct: 173 WQIDWDALEKTFNNKTK------AVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISD 226

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F +  F  +  +   + +L           ++ S  K F    G R      I
Sbjct: 227 EVYEHLYFTE-SFPRIANINEDIANL---------TLTVGSAGKSFA-ATGWR------I 269

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFH------ 397
           G+     D L   +S         +A   +    P P  E+     +  LKI +      
Sbjct: 270 GWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALKIDYFPKMRE 320

Query: 398 EMRTRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCT 454
           E R +  +L   F +L G+   +P+G  ++   F ++ +P+  +   E L    D     
Sbjct: 321 EYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISY 379

Query: 455 SLLESTGICTVPGSGF 470
            L+   GI  +P + F
Sbjct: 380 WLINEIGIVAIPPTEF 395

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 105/256 (41%), Gaps = 42/256 (16%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W+ + ++ EK +    K       +I+  P NP G V + + +  +  I  K+ + IISD
Sbjct: 184 WTIDFEQFEKAITSKTK------AVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISD 237

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F D  F  +  +  ++  L           ++ S  K F    G R G+  ++
Sbjct: 238 EVYEHLYFTD-SFTRVATLSPEIGQL---------TLTVGSAGKSFA-ATGWRIGW--VL 284

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKI--FHEMR- 400
             + E       L+S +       +A   +    P P  E+     ++ LKI  F  MR 
Sbjct: 285 SLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIGYFENMRQ 331

Query: 401 ---TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCT 454
              T+  +L   F EL G+    P+G+ ++   F ++ +P+      E +    D     
Sbjct: 332 EYITKFKILTSVFDEL-GLPYTAPEGSYFVLVNFSKVKIPEDYPYPQEIMDKGKDFRISH 390

Query: 455 SLLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 391 WLINELGVVAIPPTEF 406

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 6/70 (8%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W+ N DE+E  +    K       LI+  P NP G V + E + RI  I  K+ + II
Sbjct: 181 TEWTVNYDELEAAITPKTK------ALILNTPHNPVGKVFTREELLRIGEICVKHNVVII 234

Query: 282 SDEVYQENIF 291
           SDEVY+   F
Sbjct: 235 SDEVYEHLYF 244

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 75/160 (46%), Gaps = 25/160 (15%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L +E  +  N + ++K+++   K      ++I+ NP NP
Sbjct: 110 PTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNNP 163

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSM---KKVLRKLQHLYPGK 313
            G+ +S ET+  IC +  +  I +  DEVY+        FHSM   K V      LY   
Sbjct: 164 LGSAISTETLNDICQLCEENNIYLHCDEVYKP------IFHSMPEGKSVPLSGCQLYD-- 215

Query: 314 FDNVQLASLHSISKGFMDEC-GQRGGYMEIIGFSQEIRDA 352
               +  +  S+SK F   C G R G++ I   +Q +RDA
Sbjct: 216 ----KAITTGSMSKAF--SCAGLRLGWL-ISKDTQMLRDA 248

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/287 (24%), Positives = 119/287 (41%), Gaps = 46/287 (16%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           P Y    +   +F A+V    L E+ ++  N D ++K ++   K      ++I+ NP NP
Sbjct: 111 PTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDTLKKAIKSNTK------LIIINNPNNP 164

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVL---RKLQHLYPGK 313
            G V+S+E +  IC +  +  + +  DEVY+        FHS+   +   R    +Y   
Sbjct: 165 LGCVISDELLTSICELCKEKNVYLHCDEVYRP------IFHSLPSGVTTPRSAAQIY--- 215

Query: 314 FDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDL 373
            DN  ++   S+SK F    G R G++ +   ++ +RDA  +    +I   +   AV   
Sbjct: 216 -DNAVVSG--SMSKAF-SLAGIRLGWI-VSKNAKLLRDAASRRDYNTISVSMVDDAVAQY 270

Query: 374 MVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVL 433
            +K           + D  +K  +E      L  E  K L+        G   +F  +  
Sbjct: 271 ALK-----------NCDAIVKRNYE------LCLENLKILDKFM----DGNADIFQYVCK 309

Query: 434 PKKA-LCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHV 479
           P+   +C  +   IE    +   L E   + TVPG  F   PGT  +
Sbjct: 310 PQAGTVCLIKVSQIEDTLSFAKFLAEEYSVLTVPGETF-DFPGTLRI 355

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 100/256 (39%), Gaps = 42/256 (16%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W+ + ++ EK +    K       +I+  P NP G V + E +  +  I  K+ + IISD
Sbjct: 184 WTIDFEQFEKAITPKTK------AVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISD 237

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F D  F  +  +  ++  L           ++ S  K F    G R      I
Sbjct: 238 EVYEHLYFTD-SFTRIATISPEIGQL---------TLTVGSAGKLFA-ATGWR------I 280

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKI--FHEMR- 400
           G+   +   L   +S         +A   +    P P  E+     D+ LKI  F +MR 
Sbjct: 281 GWVVSLNADLLSYVS---------KAHTRICFSSPSPLQEACANSIDDGLKIGYFEKMRQ 331

Query: 401 ---TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCT 454
              T+  +    F EL G+    P+G  ++   F ++ +PK      E      D     
Sbjct: 332 EYITKFKIFTSIFDEL-GLPYTAPEGTYFVLVNFSKVKIPKDYSYPEEIRDKGKDFRISH 390

Query: 455 SLLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 391 WLINELGVVAIPPTEF 406

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 103/261 (39%), Gaps = 40/261 (15%)

Query: 218 LDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYG 277
           + E + W  + D + + + +  K       +I+ +P NP G V + E + ++  I  + G
Sbjct: 192 VTEGTEWVIDYDMLRQTINEKTK------AVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 278 ITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRG 337
           I IISDEVY+   F D +F  +  +  ++              S H+++ G   +     
Sbjct: 246 IYIISDEVYEHLYFTD-EFTRIATLSEEI--------------SQHTLTVGSAGKSFAAT 290

Query: 338 GYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFH 397
           G+   IG+       L  L S         +A V +    P P  E+     +  LK  +
Sbjct: 291 GWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTTY 339

Query: 398 EMRTRANLL--YETFK---ELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPD 449
              TRA     YE F+   +  G+   + +G+ +L   F RL LP       E      D
Sbjct: 340 YADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGRD 399

Query: 450 EFYCTSLLESTGICTVPGSGF 470
                 L+   G+  +P S F
Sbjct: 400 FRVAYWLINELGLVAIPCSSF 420

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 103/256 (40%), Gaps = 42/256 (16%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W+ + ++ EK +    K       +I+  P NP G V + E +  +  I  K+ + IISD
Sbjct: 184 WTIDFEQFEKAITSKTK------AVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISD 237

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F D  F  +  +  ++  L           ++ S  K F    G R G+  ++
Sbjct: 238 EVYEHLYFTD-SFTRIATLSPEIGQL---------TLTVGSAGKSFA-ATGWRIGW--VL 284

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKI--FHEMR- 400
             + E       L+S +       +A   +    P P  E+     ++ LKI  F +MR 
Sbjct: 285 SLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQ 331

Query: 401 ---TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCT 454
               +  +    F EL G+    P+G  ++   F ++ +P+      E L    D     
Sbjct: 332 EYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISH 390

Query: 455 SLLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 391 WLINELGVVAIPPTEF 406

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/255 (22%), Positives = 100/255 (39%), Gaps = 40/255 (15%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W  + D ++  +    K       +I+  P NP G V +E  + R+  I  K  + IISD
Sbjct: 175 WQIDWDSLQAAMNSKTK------AIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISD 228

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F D  F  +  +  ++  L           ++ S  K F    G R G+   +
Sbjct: 229 EVYEHLYFKD-SFTRIATLSPEIGQL---------TLTVGSAGKSFA-ATGWRIGWA--L 275

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHD--ERLKIFHEMRT 401
             +QE       L+S +       +A   +    P P  E+     +  E+++ F E R 
Sbjct: 276 SLNQE-------LLSYA------AKAHTRICFASPSPLQEAVANAFNDAEKVEYFKETRL 322

Query: 402 RANLLYETFKEL---EGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCTS 455
           +    YE F  +    G+   +P+G  ++   F ++ +P       E L    D      
Sbjct: 323 QYIRKYEIFTNVLNELGLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAKDFRISYW 382

Query: 456 LLESTGICTVPGSGF 470
           L+   G+  +P + F
Sbjct: 383 LMNELGVVAIPPTEF 397

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 102/258 (39%), Gaps = 42/258 (16%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W+ + ++ E V+ +  K       +I+  P NP G V + E + RI  I  K+ + II
Sbjct: 181 TEWTLDFEQFENVITNKTK------AIIINTPHNPIGKVFTREELKRIGDICVKHNVIII 234

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           SDEVY    F D +F  +  +  ++  L           S+ S  K F    G R G+  
Sbjct: 235 SDEVYDNLYFVD-EFTRIATLSPEIGQL---------TLSVGSAGKTFA-ATGWRIGW-- 281

Query: 342 IIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--IFHEM 399
           ++  + E+ +                +A   +    P P  E+  +  +  L+   F  M
Sbjct: 282 VVSLNPELLN-------------FASKAHTRICFASPSPIQEACAESINIALRNGYFENM 328

Query: 400 RT----RANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFY 452
           R     +  +    F EL G+   + +G  +L   F R+ +P+      E +    D   
Sbjct: 329 RNEYVKKYKIFTSVFDEL-GLPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINKGKDFRI 387

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 388 SNWLINELGVVAIPPTEF 405

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 57/256 (22%), Positives = 103/256 (40%), Gaps = 42/256 (16%)

Query: 224 WSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISD 283
           W+ + ++ E  +    K       +I+  P NP G V + E +  +  I  K+ + IISD
Sbjct: 200 WTIDFEQFENAITSKTK------AVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISD 253

Query: 284 EVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEII 343
           EVY+   F D  F  +  +  ++  L           ++ S  K F    G R G+  ++
Sbjct: 254 EVYEHLFFTD-SFTRIATLSPEIGQL---------TLTVGSAGKSFA-ATGWRIGW--VL 300

Query: 344 GFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKI--FHEMR- 400
             + E       L+S +       +A   +    P P  E+     ++ LKI  F +MR 
Sbjct: 301 SLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIDYFEKMRQ 347

Query: 401 ---TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFYCT 454
              T+  +    F +L G+    P+G  ++   F ++ +P+      E L    D     
Sbjct: 348 EYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEILDKGKDFRISH 406

Query: 455 SLLESTGICTVPGSGF 470
            L+   G+  +P + F
Sbjct: 407 WLINELGVVAIPPTEF 422

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/223 (22%), Positives = 103/223 (46%), Gaps = 25/223 (11%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEESNWSTNSDEIEKVVQDALKKQI 243
           C   +  +LI  P Y +Y+  A + + +++    + E++++  N+D++ + +Q     +I
Sbjct: 108 CVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNSFQMNTDKVIETLQGDSNIKI 167

Query: 244 RPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVL 303
                 V +PGNPTGA++   +I +I L   + GI  I DE Y       + F S     
Sbjct: 168 A----FVTSPGNPTGALIDIASIEKI-LSQWQSGIVAI-DEAY-------IDFCSTGGSA 214

Query: 304 RKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMS-ISIC 362
             L + YP       LA L ++SK F    G  G  + +   S+++   L  + +  +I 
Sbjct: 215 APLVNKYP------NLAVLQTLSKSF----GLAGVRLGVTFTSKDLSRVLNAMKAPYNIS 264

Query: 363 SVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANL 405
           S+ +   +  L  +  Q   ++ ++  +ER ++   + +  N+
Sbjct: 265 SMASNLVLKALSSESVQTMKDNVQEIVEERERVLKALTSMENV 307

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 99/258 (38%), Gaps = 42/258 (16%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W+ + DE  + +    K       +I+  P NP G V + E + ++  I  +  + II
Sbjct: 182 TEWTVDFDEFTRAITPKTK------AVIINTPHNPIGKVFTREELTKLGNICVENNVIII 235

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           +DEVY+   F D +F  +  +  ++  L           S+ S  K F    G R     
Sbjct: 236 ADEVYEHLYFVD-EFPRIATLSEEIGQL---------TLSVGSAGKSFA-ATGWR----- 279

Query: 342 IIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--SYEQDHDERLKIFHEM 399
            IG+       L +  S         +A   +    P P  E  SY  DH  ++  F  M
Sbjct: 280 -IGWVVSQNPDLLQYAS---------KAHTRICFASPSPIQEACSYSIDHALKIDYFENM 329

Query: 400 R----TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFY 452
           R     +  +    F EL G+    P+G+ ++   F ++ +P       E +    D   
Sbjct: 330 RQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRI 388

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 389 SNWLINELGVVAIPPTEF 406

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 10/93 (10%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSV--LIVINPG 254
           P Y   ++  S+F A V   +L+ E  ++ N   I+K     LK ++R +   +++ NP 
Sbjct: 113 PTYQQLSSVPSMFGADVELLHLEAEDGYTPN---IQK-----LKSKVRANTKYIVLNNPN 164

Query: 255 NPTGAVLSEETIARICLIAAKYGITIISDEVYQ 287
           NP G+V+S E +  I   A +  I I+ DEVY 
Sbjct: 165 NPLGSVISTEKMTEIIDYAERNEIFIVCDEVYS 197

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 104/260 (40%), Gaps = 42/260 (16%)

Query: 220 EESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGIT 279
           E  +W+ + +E+ K      K       LI+  P NP G V ++E + +I  +  +  + 
Sbjct: 187 EGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 280 IISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGY 339
           IISDEVY+   F D  +  +  +  ++  L           ++ S  K F    G R G+
Sbjct: 241 IISDEVYEFLYFTD-SYTRIATLSPEIGQL---------TLTVGSAGKTFA-ATGWRIGW 289

Query: 340 MEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--IFH 397
             +I  + E+   + K  +  IC               P P  E+     ++ LK   F 
Sbjct: 290 --VISLNPELLSYVSKGHT-RIC------------FSSPSPIQEAVANSIEDALKGDYFE 334

Query: 398 EMRT----RANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDE 450
            MRT    +  +    FKE+ G+    P+G  ++   F ++ +P+      E L    D 
Sbjct: 335 AMRTDYIRKFEIFTSVFKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKDF 393

Query: 451 FYCTSLLESTGICTVPGSGF 470
                L+   G+  +P + F
Sbjct: 394 RISYWLINELGVVAIPPTEF 413

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W  + D +EK +        R   +I+  P NP G V + E + R+  I     I II
Sbjct: 171 TEWEIDWDILEKTINS------RTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVII 224

Query: 282 SDEVYQENIFND 293
           SDEVY+   F+D
Sbjct: 225 SDEVYEHLYFSD 236

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 106/262 (40%), Gaps = 42/262 (16%)

Query: 218 LDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYG 277
           + E + W+ + ++ +  +    K       +I+  P NP G V + E + +I  I  +  
Sbjct: 179 VTEGTEWTVDMEQFKNAITSKTK------AVIINTPHNPIGKVFTREELLQIGNICVEKN 232

Query: 278 ITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRG 337
           + IISDEVY+   F D +F  +  +  ++  L           ++ S  K F    G R 
Sbjct: 233 VIIISDEVYEHLYFTD-EFTRIATLSPEIGQL---------TLTVGSAGKTFA-ATGWRI 281

Query: 338 GYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--I 395
           G+  +I  + E+   + K  +  IC               P P  E+     ++ L+   
Sbjct: 282 GW--VISLNSELLQYVSKAHT-RIC------------FASPSPLQEACANSINDALESNY 326

Query: 396 FHEMR----TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEP 448
           F +MR     +  +    F+EL G+   KP+G  ++   F ++ +P+      E L    
Sbjct: 327 FEKMRQEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKGK 385

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 386 DFRISHWLINELGVVAIPPTEF 407

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-N 255
           Y+ S+SL+ A+     V P  LDE   +    +++E ++ +   +  +P +L  I  G N
Sbjct: 165 YSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVY 286
           PTG+ LS++  A+I  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 103/258 (39%), Gaps = 42/258 (16%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W+ + DE+   +    K       LI+  P NP G V + E +  I  I  +  + II
Sbjct: 185 TEWTVDYDELRAAITPKTK------ALILNTPHNPIGKVFTREELLEIGNICVENNVVII 238

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           SDEVY+   F             ++  L P +  N+ L S+ S  K F    G R G+  
Sbjct: 239 SDEVYEHLYFTS--------EFTRIATLSP-EIGNLTL-SVGSAGKTFA-ATGWRIGW-- 285

Query: 342 IIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--IFHEM 399
           I+  + E    L K  S+         A   +    P P  E+  +  +  L+   F +M
Sbjct: 286 IVSQNAE----LLKYASM---------AHTRICFASPSPFQEACAKSIEIALQNNYFEKM 332

Query: 400 R----TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFY 452
           R     + ++    F EL G+   +P+G  ++   F ++ +P+      E L    D   
Sbjct: 333 RQEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSKAKDFRI 391

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 392 SYWLINELGVVAIPPTEF 409

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 92/212 (43%), Gaps = 24/212 (11%)

Query: 146 RQTVADFITRRD---GGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPLY 202
           +  +A F  R D   G EP T +++                 C+     +L   P Y +Y
Sbjct: 63  KTLLAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMY 122

Query: 203 TASASLFNAQVLPY-YLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVL 261
           +  A++ + +++    + E++++  N  E    V   LK   +  +L + +PGNPTG ++
Sbjct: 123 SVCANINDVEIVECPLITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLV 178

Query: 262 SEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLAS 321
           +++ I  I L     G+ ++ DE Y +    +   +SM K++ K    YP       L  
Sbjct: 179 NKKDIEFI-LENWTNGLVVV-DEAYIDFADAEGTTYSMAKLVTK----YP------NLTV 226

Query: 322 LHSISKGFMDECGQRGGYMEIIGFSQEIRDAL 353
           L ++SK F    G  G  + +   S+E    L
Sbjct: 227 LQTLSKSF----GLAGIRLGVTFASEEFSSVL 254

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 97/224 (43%), Gaps = 46/224 (20%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           S W+ + D+    + +  K       +I+ +P NPTG V + E +  +  I  +  + II
Sbjct: 166 SEWTLDFDQFRSAISEKTK------AVIINSPHNPTGKVFTREELLTLGNICVEKNVYII 219

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           SDEVY EN++             KL  L P +  N+ L ++ S  K F    G R G++ 
Sbjct: 220 SDEVY-ENLY-------FTPECVKLASLSP-EISNITL-TIGSAGKIFA-VTGWRIGWI- 267

Query: 342 IIGFSQEIRDALFKLMS---ISICSVVTGQAVVDLMVKPPQPG-----DESYEQDHDERL 393
               S+ +   L KL S   I IC              PPQ       D +   D+ +R+
Sbjct: 268 ---ISENVE--LLKLASSAHIKICFSSPS---------PPQLACAHAIDIALNSDYFDRM 313

Query: 394 KIFHEMRTRANLLYETFKELEGIECQKPQGAMYL---FPRLVLP 434
           +   +   +  +L   F+EL G+    P+G+ ++   F +L +P
Sbjct: 314 R--KDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 60/258 (23%), Positives = 100/258 (38%), Gaps = 42/258 (16%)

Query: 222 SNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITII 281
           + W  + D + K + +      R   +I+  P NP G V + E + ++  I  K  I II
Sbjct: 182 AEWKIDFDILNKTINE------RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYII 235

Query: 282 SDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYME 341
           SDEVY+   F D +F  +  + +++  L           S+ S  K F    G R G+  
Sbjct: 236 SDEVYEHLYFGD-EFTRIATISKEIGDL---------TLSVGSAGKSFA-ATGWRIGW-- 282

Query: 342 IIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--IFHEM 399
           ++  + E+   + K  +  IC               P P  E+     D  L    F  M
Sbjct: 283 VVSRNAELLSYVSKAHT-RIC------------FSSPSPFQEACAHSIDIGLHNGYFENM 329

Query: 400 R----TRANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEPDEFY 452
           R     +  +L   F EL G+   KP G  ++   F ++ +P +     E      D   
Sbjct: 330 REEYKEKFAILTRVFDEL-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFKL 388

Query: 453 CTSLLESTGICTVPGSGF 470
              L+   G+  +P + F
Sbjct: 389 SYWLVNELGVVAIPPTEF 406

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 48/91 (52%), Gaps = 6/91 (6%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNP 256
           P Y   ++   +F A+V    L+ E+++  +  +++ +++   K       +++ NP NP
Sbjct: 113 PTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKGNTK------CIVLNNPNNP 166

Query: 257 TGAVLSEETIARICLIAAKYGITIISDEVYQ 287
            G+V+   T+  I  +A K  I +I DEVY+
Sbjct: 167 LGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/262 (22%), Positives = 107/262 (40%), Gaps = 42/262 (16%)

Query: 218 LDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYG 277
           + E + W+ + ++    +    K       +IV +P NP G V ++E + ++  I  +  
Sbjct: 182 ITEGTEWTIDFEQFRNAITPKTK------AVIVNSPHNPIGKVFTKEELTKLGEICVENN 235

Query: 278 ITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRG 337
           + IISDEVY+   FND  F  +  +  ++  L           ++ S  K F    G R 
Sbjct: 236 VIIISDEVYEFLYFND-SFTRIATLSPEIGQL---------TLTVGSAGKTFA-ATGWRI 284

Query: 338 GYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLK--I 395
           G+  +I  + E+   + K  +  IC               P P  E+     ++ L+   
Sbjct: 285 GW--VISQNPELLQYVSKAHT-RIC------------FASPSPLQEACANSINDALESGY 329

Query: 396 FHEMRT----RANLLYETFKELEGIECQKPQGAMYL---FPRLVLPKKALCESERLGIEP 448
           F +MR     +  +    F+EL G+   KP+G  ++   F ++ +P+      E L    
Sbjct: 330 FEKMRKEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEILDKGK 388

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 389 DFRISHWLINELGVVAIPPTEF 410

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 220 EESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGIT 279
           E + W+ + DE+   +    K       LI+  P NP G V + E + +I  I  +  + 
Sbjct: 179 EGTEWTVDYDELRAAITPKTK------ALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 280 IISDEVYQENIF 291
           IISDEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 63/134 (47%), Gaps = 11/134 (8%)

Query: 156 RDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVLP 215
           +D  +P T E++                 C  ++  +L+  P Y +Y+  A + + +++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 216 YYL-DEESNWSTNSDEIEKVVQDALKKQIRPSV--LIVINPGNPTGAVLSEETIARICLI 272
             L   ++++  N+DE+ K  Q+       PS+  + + +PGNPTGA +    I +I L 
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQN------DPSIKLIFITSPGNPTGAKVETSRIEKI-LQ 190

Query: 273 AAKYGITIISDEVY 286
               G+ ++ DE Y
Sbjct: 191 NWDRGMVVV-DEAY 203

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%)

Query: 235 VQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
            QD  KK  R  + +V    NPTGA+ S  +  ++  +A KY I IISD+VY
Sbjct: 178 AQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSM 299
           KK  R  + +V    NP+G   S  T  ++  +A KY I +ISD+VY   ++ D    ++
Sbjct: 184 KKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVY-DQPCDAL 242

Query: 300 KKVLRKLQHLYPGKFDNVQLASLHSISKGFMDEC---GQRGGYMEIIGFS 346
            K L +L HL    ++  +    ++IS     +    G R GY E +  +
Sbjct: 243 PKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 244 RPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           RPS+L  I+ G NPTG  +S E  ARI  +A KY   I+ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 90/193 (46%), Gaps = 26/193 (13%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIR 244
           CK +   +++  P Y +Y+  A++ +  V+   L  E N S   D   K   + LKK   
Sbjct: 105 CKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDN-SFQMDV--KRTLETLKKDDL 161

Query: 245 PSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQE--NIFND----VKFHS 298
             +L + +PGNPTG +++ + I  + L   K G+ ++ DE Y +    FN+     ++ S
Sbjct: 162 IRLLFITSPGNPTGKIIAIKDIIYV-LEHWKNGLVVV-DEAYVDFSTYFNEETKKTEYFS 219

Query: 299 MKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMS 358
           + K++ K    YP       L  L ++SK F    G  G  + +   S+E+   L  + +
Sbjct: 220 VAKLVTK----YP------NLTVLQTLSKSF----GLAGIRLGVTFASEELARILNAMKA 265

Query: 359 -ISICSVVTGQAV 370
             +I S  +  A+
Sbjct: 266 PYNISSTTSNHAI 278

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 7/131 (5%)

Query: 217 YLDEESNWSTNSDEIEKVVQ-DALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAK 275
           Y D  SN   NS E++ +   +A KK  R  + +V    NP G   S ET  ++  +A K
Sbjct: 160 YFDSISN--DNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARK 217

Query: 276 YGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDEC-- 333
           + + I+SD+VY    ++D     +   L +L H+    + +      ++IS     +   
Sbjct: 218 HDMLIVSDDVYDLLRYDD-SLDELPHPLPRLTHVDRMSYKHGDSGYGNTISNATFSKIIA 276

Query: 334 -GQRGGYMEII 343
            G R GY E +
Sbjct: 277 PGLRFGYQETV 287

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 67/145 (46%), Gaps = 18/145 (12%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIR 244
           C   +  +LI  P Y +Y+    + + + +   L  E N  +   + EKV++  L+    
Sbjct: 108 CVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDN--SFQMDTEKVIE-TLQNDPS 164

Query: 245 PSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLR 304
             ++ + +PGNPTGA++  E I ++ L   + G  ++ DE Y       + F +    + 
Sbjct: 165 IKLVFITSPGNPTGALIKPENIEKL-LSQWQSGFVVV-DEAY-------IDFCTTGGSVA 215

Query: 305 KLQHLYPGKFDNVQLASLHSISKGF 329
            L + YP       LA L ++SK F
Sbjct: 216 PLVNKYP------NLAVLQTLSKSF 234

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEESNWSTNSDEIEKVVQDALKKQI 243
           C  ++  +L+  P Y +Y+  A + + +V+    + E++++  +SD+    V D L    
Sbjct: 108 CVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDK----VLDILNNDQ 163

Query: 244 RPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
              +L + +PGNPTGA +    I ++ L     G+ ++ DE Y
Sbjct: 164 EIKLLFITSPGNPTGAQIETARIEKV-LQNWDRGLVVV-DEAY 204

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 235 VQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
            Q   KK  R  + +V    NPTGA+ S  +  ++  +A KY I IISD+VY
Sbjct: 179 AQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD +       + +E ++ +      +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGINVFPVPLDADG---LIPERLEAILDNWNPDTAKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVY 286
           PTG+ LS++    I  IA K+ + II DE Y
Sbjct: 222 PTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 53/103 (51%), Gaps = 7/103 (6%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESN-WSTNSDEIEKVVQDALKKQI 243
           C  ++  +L+  P Y +Y+  A++ + +V+   L  E N +  NSD+    V D LK   
Sbjct: 108 CVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNSFQLNSDK----VLDILKNDP 163

Query: 244 RPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
              ++ + +PGNPTG  +  + I ++ L     G+ ++ DE Y
Sbjct: 164 LIKLVFITSPGNPTGVKIETKRIEKV-LQNWDNGLVVV-DEAY 204

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 4/107 (3%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSM 299
           K+  R  + ++    NP+G+  S ET  R+  +A +Y + +ISD++Y + +  D     +
Sbjct: 176 KRTYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIY-DLLAYDQPSDQL 234

Query: 300 KKVLRKLQHLYPGKFDNVQLASLHSISKGFMDEC---GQRGGYMEII 343
            + L  L H+     +  Q +  H+++     +    G R GY E +
Sbjct: 235 PRALPSLVHVDRATLNEEQDSWGHTVANASFSKIVAPGLRCGYQESV 281

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 34/60 (56%), Gaps = 2/60 (3%)

Query: 229 DEIEKVVQD-ALKKQIRPSVLIVI-NPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           D   +++Q  AL K+I   VL  I    NP+G   S ET  R+  IA KY + +ISD+VY
Sbjct: 168 DSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 37.7 bits (86), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD +       + +E ++ +   +  +P +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGVNVFPVPLDADG---LIPERLEAILDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVY 286
           PTG+ LS++    I  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 220 EESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGIT 279
           E ++W  + + +     D  K      ++I+ NP NP G V + + +  +  +    G  
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 280 IISDEVYQ 287
           II+DEVY+
Sbjct: 217 IIADEVYE 224

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIE-KVVQDALKKQIRPSVLIVINPGN 255
           P Y +Y+  AS+ + +++   L      S NS +++ + V D LKK     ++ + +PGN
Sbjct: 117 PTYGMYSVCASVNDVEIVKCPL----VTSDNSFQVDTEAVLDTLKKDPLIKLVFITSPGN 172

Query: 256 PTGAVLSEETIARICLIAAKYGITIISDEVY 286
           PTGA +    I +I L     GI ++ DE Y
Sbjct: 173 PTGAKIETSRIEKI-LQNWDQGILVV-DEAY 201

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 7/85 (8%)

Query: 237 DALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKF 296
           D  KK  R  + +V    NP+GA  S+E   ++  +A +Y I IISD+VY     + + F
Sbjct: 182 DDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY-----DLLGF 236

Query: 297 HSMK--KVLRKLQHLYPGKFDNVQL 319
           H  +    +RK  H    + D + +
Sbjct: 237 HGQRTDSGIRKPSHFRFPQLDRITV 261

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 65/291 (22%), Positives = 123/291 (42%), Gaps = 37/291 (12%)

Query: 202 YTASASLFNAQ---VLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-NPT 257
           +++S S   AQ   V P  LDE         ++E ++ +  +   +P +L  +  G NPT
Sbjct: 166 FSSSISAAEAQGVNVFPIPLDEHG---IIPSKLETILDNWTEGAAKPKLLYTVPTGQNPT 222

Query: 258 GAVLSEETIARICLIAAKYGITIISD--------EVYQENIFNDV--KFHSMKKVLRKLQ 307
           G+ LS +    I  IA K+   II D        E Y+++  N V   +   K+ ++ L+
Sbjct: 223 GSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLE 282

Query: 308 HLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTG 367
             +       ++  L S+SK      G R G+  I+G     +D L +++S+   ++   
Sbjct: 283 KSFVSIDTEGRVLRLDSLSKVLAP--GTRFGW--IVG----AKDILARILSLQEMTIQAP 334

Query: 368 QAVVDLMVKPP--QPGDESYEQDHDERLKIFHEMRTRANL----LYETFKELEGIECQKP 421
                 ++     + G E Y    D  + + HE   + +     LY+   +++ I+   P
Sbjct: 335 AGFTQSIIAGTMNRWGQEGY---LDWLIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPP 391

Query: 422 QGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLES--TGICTVPGSGF 470
              M+ F   +   K    + + G +P++        S  +G+  VPG+ F
Sbjct: 392 IAGMF-FTVNIDASKHPEFATKYGSDPEKVEKAIFDRSIASGVLVVPGNWF 441

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++E ++ +      +P +L  I  G NPTG+ LS+E    I  IA K+   II DE Y
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 238 ALKKQIRPSVLIVI-NPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           A+ K+I   V+  I    NPTG   S ET  ++  IA KY + II+D+VY
Sbjct: 184 AVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 4/84 (4%)

Query: 204 ASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLS 262
           ASA        P  +DE        +++E+++ +      +P +L  I  G NPTG  L+
Sbjct: 169 ASAEAQGITTFPIPIDEHG---IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLA 225

Query: 263 EETIARICLIAAKYGITIISDEVY 286
           +E    I  IA K+   II DE Y
Sbjct: 226 DERKVEIYRIACKHDFLIIEDEPY 249

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++E+++ +  +   +P +L  I  G NPTG+ LS++   +I  +A K+   II DE Y
Sbjct: 191 EKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++EK++ +      RP +L  I  G NPTG  L+++    I  IA K+   II DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 70/174 (40%), Gaps = 18/174 (10%)

Query: 155 RRDGGEPATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVL 214
           R +G  P T ++I                 C   +  +++  P Y +Y   A + +   +
Sbjct: 78  REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYV 137

Query: 215 PYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAA 274
              L    N S   DE   + Q  L K I+  V+ + +PGNPTGA +    + ++ L   
Sbjct: 138 EVPLISSDN-SFQIDEDRILEQLNLDKSIK--VVFITSPGNPTGACIEVGRVEKL-LRNW 193

Query: 275 KYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLASLHSISKG 328
             GI ++ DE Y       + F + K  L  L + +P       L  L ++SK 
Sbjct: 194 TAGIVVV-DEAY-------IDFSADKPSLSPLVNKHP------NLVVLQTLSKA 233

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 70/149 (46%), Gaps = 23/149 (15%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQ--VLPYYLDEESNWSTNSDEIEKVVQDALKKQ 242
           C  ++  +LI    Y +YT  + + + +   +P  L EE  +  + ++I + +Q+     
Sbjct: 108 CVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQN----- 162

Query: 243 IRPSVLIVI--NPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300
             PS+ +V   +PGNPTG  +    I +I L   + G+ ++ DE Y      D    S K
Sbjct: 163 -DPSIKLVFITSPGNPTGTFIDVNRIEKI-LSQWQTGLVVV-DEAYI-----DFVEGSDK 214

Query: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGF 329
             L  L      K++N+  A L ++SK F
Sbjct: 215 GSLAPLAT----KYENI--AVLQTLSKSF 237

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 53/128 (41%), Gaps = 9/128 (7%)

Query: 161 PATPEDIYXXXXXXXXXXXXXXXXCKDSQTGLLIPIPQYPLYTASASLFNAQVL--PYYL 218
           P T E+I                 C  S+  ++I  P Y +Y+  A + +   +  P   
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 219 DEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGI 278
           ++ S     S  +E + QD   K     ++ + +PGNPT A++    I ++  +    G 
Sbjct: 144 EDNSFQMDTSKVLETLAQDPTIK-----LIFITSPGNPTAALIDTAEIEKV--LNNWTGG 196

Query: 279 TIISDEVY 286
            ++ DE Y
Sbjct: 197 LVVVDEAY 204

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 49/104 (47%), Gaps = 9/104 (8%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVL--PYYLDEESNWSTNSDEIEKVVQDALKKQ 242
           C   +  +L   P Y +Y+  A++ + +VL  P   ++ S    +   I  +  D L K 
Sbjct: 107 CVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK- 165

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
               ++ + +PGNPTGA +    I +I  + +  G  ++ DE Y
Sbjct: 166 ----LVFLTSPGNPTGAKIDSNIIIKI--LESWDGGFVVVDEAY 203

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 73/180 (40%), Gaps = 21/180 (11%)

Query: 202 YTASASLFNAQVL---PYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-NPT 257
           Y++S    +AQ L   P  LD E    +  +E+         +   P +L  I  G NPT
Sbjct: 164 YSSSVEAADAQGLNCVPMPLDGEGIVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPT 223

Query: 258 GAVLSEETIARICLIAAKYGITIISDEVY-----QENIFNDVKFH-------SMKKVLRK 305
           G  LS+     I  +A +Y I II D+ Y        +  D +         S    +  
Sbjct: 224 GCTLSDNRKPHIYRLAQQYDIIIIEDDPYYFLQMDPYVSEDARLETAEASTMSQATFMNS 283

Query: 306 LQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVV 365
           L   +     + ++  L S+SK F   C  R G++  +G S+ + D  + L  +SI S  
Sbjct: 284 LNRSFLELDTDGRVVRLESVSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQSTC 338

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 52/198 (26%), Positives = 80/198 (40%), Gaps = 45/198 (22%)

Query: 187 DSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEE-SNWSTNSDEIEKVVQDALKKQIRP 245
           D+Q    IP+P          + N  ++P  L+E  SNW+           D       P
Sbjct: 173 DAQGLNCIPVP----------MDNQGIIPEKLEEMLSNWT-----------DRYPGIPMP 211

Query: 246 SVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY-------------QENIF 291
            +L  I  G NPTG  LSE     I  +A KY I I+ D+ Y             +E   
Sbjct: 212 KLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPYYFLQMGTYVSPDKRETDE 271

Query: 292 NDVKFHSMKK----VLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQ 347
            D+    +K+     ++ L   +     + ++  L S+SK F   C  R G+  I+G S+
Sbjct: 272 QDIVTQELKQNHGEFVKSLSRSFLDLDRDGRVVRLDSMSKTFAPGC--RLGW--IVG-SK 326

Query: 348 EIRDALFKLMSISICSVV 365
            + D  + L  +SI S  
Sbjct: 327 HLLDNYWNLHEVSIQSTC 344

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 74/179 (41%), Gaps = 21/179 (11%)

Query: 202 YTASASLFNAQ---VLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPG-NPT 257
           Y++S    +AQ    +P  LD E       +E+     D       P +L  I  G NPT
Sbjct: 164 YSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPT 223

Query: 258 GAVLSEETIARICLIAAKYGITIISDEVY---QENIFNDVKFHSMKKVLRKLQHL-YPGK 313
           G  LS+     I  +A KY + II DE Y   Q + +   +    +   R + H  + G 
Sbjct: 224 GCTLSDSRKPYIYHLAQKYDMIIIEDEPYYFLQMDQYEPEERRLEQPASRAMTHAEFIGS 283

Query: 314 FDNV--------QLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSV 364
                       ++  L S+SK F   C  R G++  +G S+ + D  + L  +SI S 
Sbjct: 284 LGKSFLELDVEGRVVRLDSVSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQST 337

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 56/106 (52%), Gaps = 13/106 (12%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEESNWSTNSDEIEKVV-QDALKKQ 242
           C  S+  +L+  P Y +Y+  A++ +  V+    + E++++  ++ EI  ++  D L K 
Sbjct: 107 CVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNSFQIDATEILNILANDPLIK- 165

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKY--GITIISDEVY 286
               ++ + +PGNPTGA +    I RI  +   +  G+ I+ DE Y
Sbjct: 166 ----LVFITSPGNPTGAKIE---IDRIEYLLKNWDQGLVIV-DEAY 203

>TBLA0H01890 Chr8 complement(447319..450657) [3339 bp, 1112 aa] {ON}
           Anc_5.367 YDR325W
          Length = 1112

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 85  LTFTRQVLAILEYPE-ILRVGHNELASLNLFSRDALERAERLLNDI 129
           LT  R +L+I+E P+ ++++G N L SL++  +D +     L+NDI
Sbjct: 438 LTVVRNMLSIIELPDSLIKIGFNVLKSLSINEKDFVTMGIELINDI 483

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           KK  R  +  +    NP+G   S ET  R+  IA KY + II+D+VY
Sbjct: 181 KKVYRYVMYCIPTFANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 76/172 (44%), Gaps = 29/172 (16%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEESNWSTNSDEIEKVVQ--DALKK 241
           C      +L+  P Y +Y+  A + + +V+    + E++++  + D + + +   D++K 
Sbjct: 108 CVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSNDDSIK- 166

Query: 242 QIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKK 301
                +L +  PGNPTGA +S + I  + L     GI ++ DE Y       + F S   
Sbjct: 167 -----LLFITTPGNPTGASISTQKI-EMLLNNWSAGIVVV-DEAY-------IDFSSSDS 212

Query: 302 VLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDAL 353
               L + YP       L  + ++SK F    G  G  + +   S++I   L
Sbjct: 213 A-APLVNKYP------NLVVIQTLSKSF----GLAGVRLGLTFASEDISKVL 253

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++E ++ +  +   +P +L  I  G NPTG+ L+ E    I  IA K+   II DE Y
Sbjct: 191 EKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 239 LKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY---QENIFNDVK 295
           LKK  +  + ++    NP+G   + ET  ++  +A KY + II+D+VY     +I ND  
Sbjct: 189 LKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDDVYDLLNYSINNDPD 248

Query: 296 FHSMKKVLRKLQHL 309
              +   +++  H+
Sbjct: 249 KFELPTPIKRFVHI 262

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 239 LKKQIRPSVLIVINP-GNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           L K+I   V+  I    NP+G   S ET  R+  IA KY + +I+D+VY
Sbjct: 186 LTKKIYKYVMYCIPTFANPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESN-WSTNSDEIEKVVQ-DALKKQ 242
           C   +  +L+  P Y +Y+  A + + +++   L  ++N +  +++ +  V+Q D L K 
Sbjct: 109 CVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKNNSFQMDTESVLTVLQNDPLIK- 167

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
               +L + +PGNPTGA +  E I  + L     G+ ++ DE Y
Sbjct: 168 ----LLFITSPGNPTGARIETERIETV-LQNWTDGLVVV-DEAY 205

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++ KV+++      +P +L  I  G NPTG  +++     I  IA KY   I+ DE Y
Sbjct: 193 EKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 52/116 (44%), Gaps = 5/116 (4%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVK-FHS 298
           KK  R  +  V    NP+G   S  T  R+  +A KY I II+D+VY  +I N V    +
Sbjct: 185 KKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDVY--DILNYVDPLDA 242

Query: 299 MKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIG--FSQEIRDA 352
           +    R+  HL      +    ++ + S   +   G R GY E +    SQ++ + 
Sbjct: 243 LPTPPRRFVHLDRETVMDPYGNTISNCSFSKLIAPGLRFGYQETVSSMLSQQLSNG 298

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 26/47 (55%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           KK  R  +  +    NP+G   + ET  R+  IA KY + I++D+VY
Sbjct: 190 KKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           KK  R  +  V    NP+G   S ET  ++  +A KY + II+D+VY
Sbjct: 191 KKVYRYVLYCVPTYANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 9/79 (11%)

Query: 230 EIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVYQE 288
           ++E ++ +      +P +L  I  G NPTG  L++E    I  IA K+   II D  Y  
Sbjct: 193 KLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY- 251

Query: 289 NIFNDVKFHSMKKVLRKLQ 307
                  F  M K  R LQ
Sbjct: 252 -------FLQMDKYERDLQ 263

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVL--PYYLDEESNWSTNSDEIEKVVQDALKKQ 242
           C   +  +L+  P Y +Y+  A++ + +V+  P  + + S        +  +  D L K 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNSFQMDTEAALTILKNDPLIK- 166

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
               ++ V +PGNPTGA +    I +I L   + G+ ++ DE Y
Sbjct: 167 ----LIFVTSPGNPTGAKIKTCLIEKI-LQNWENGLVVV-DEAY 204

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 244 RPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFND-VKFHSMKK 301
           +P +L  I  G NPTG+ L  E  +++  IA K+   I+ DE Y      D VK  S++K
Sbjct: 206 KPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYYFLQMEDYVKDPSLRK 265

Query: 302 VLRKLQH 308
            + KL H
Sbjct: 266 EV-KLSH 271

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 55/104 (52%), Gaps = 9/104 (8%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLD-EESNWSTNSDEIEKVVQ-DALKKQ 242
           C   +  +L+  P Y +Y+  A++ + +V+   L   + ++  +++ +  +++ D+L K 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIK- 166

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
               ++ V +PGNPTGA +    I ++ L     G+ ++ DE Y
Sbjct: 167 ----LMFVTSPGNPTGAKIKTSLIEKV-LQNWDNGLVVV-DEAY 204

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 50/104 (48%), Gaps = 9/104 (8%)

Query: 185 CKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESN-WSTNSDEIEKVVQ-DALKKQ 242
           C   +  +L+  P Y +Y+  A++ + +V+   L    N +  N++ +  ++  D L K 
Sbjct: 108 CVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNSFQMNTEAVLTILNNDPLIK- 166

Query: 243 IRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
               ++   +PGNPTGA +    I  + L     GI ++ DE Y
Sbjct: 167 ----IMFATSPGNPTGAKIKTCLIEEV-LQKWDNGIVVV-DEAY 204

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 38/74 (51%), Gaps = 2/74 (2%)

Query: 214 LPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVI-NPGNPTGAVLSEETIARICLI 272
           L Y+  E  +   NS +I +  ++ L+K+I   V   I    NP+G     ET  ++  I
Sbjct: 153 LEYFEQEIPDVPQNSTDIIQN-KNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKI 211

Query: 273 AAKYGITIISDEVY 286
           A KY + II D+VY
Sbjct: 212 AKKYDMLIICDDVY 225

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 232 EKVVQDALKKQIRPSVLIVINP-GNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           E +    L K+I   V+  I    NP+G   S ET  R+  IA +Y + +I+D+VY
Sbjct: 172 EIIQGSKLSKKIFKYVMYCIPTFANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVQDALKKQIRPSVLIVINPG-NPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           +++EK++ +      +P +L  I  G NPTG  L    +  I  IA K+   I+ D  Y
Sbjct: 192 EKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPY 250

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 31.2 bits (69), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 245 PSVLIVI-NPGNPTGAVLSEETIARICLIAAKYGITIISDEVY 286
           P +L  I N  NPTG  L EE    +  +A++Y   II D+ Y
Sbjct: 205 PKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPY 247

>TPHA0A02080 Chr1 (424056..425432) [1377 bp, 458 aa] {ON} Anc_8.204
           YER152C
          Length = 458

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 84/205 (40%), Gaps = 26/205 (12%)

Query: 240 KKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFN----DVK 295
           KK  R  + ++    NP+    + ET   +  +A KY + II+D+VY    +N     + 
Sbjct: 194 KKIYRYVIYLIPTYSNPSSHTYNMETRVALIDLARKYDMLIITDDVYDLLNYNISEGQIT 253

Query: 296 FHSMKKVLRKLQHL------YPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEI 349
            + +   +R+L HL       P  F N    S  + SK  +   G R GY E       I
Sbjct: 254 NNEIPTPMRRLVHLDRETNSDPISFGNT--ISNATFSK--LIAPGLRFGYQE------SI 303

Query: 350 RDALFKLMSISICSVVTGQ-AVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYE 408
            + L   +SI   +V  G  A ++ M+      +   E+     +K + +   RA +LY 
Sbjct: 304 NEKLVSQLSIGGANVSGGTPAQLNSMIVGTLLKNRLAEKILFNFIKTYKD---RAAVLYT 360

Query: 409 TFKEL--EGIECQKPQGAMYLFPRL 431
             K    EG    K  G  + + +L
Sbjct: 361 AMKLYMPEGTAFSKMNGGYFCWVKL 385

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,707,375
Number of extensions: 2334544
Number of successful extensions: 6669
Number of sequences better than 10.0: 119
Number of HSP's gapped: 6763
Number of HSP's successfully gapped: 119
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)