Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR110W (FOB1)8.262ON56656627710.0
Smik_4.3568.262ON57657724030.0
Skud_4.3718.262ON58058023610.0
Suva_2.2708.262ON63258323230.0
TDEL0F038908.262ON4763988271e-104
KAFR0B055408.262ON5193648191e-102
NCAS0B038508.262ON5885217749e-95
SAKL0H17028g8.262ON5504917692e-94
NDAI0J013808.262ON6243657291e-87
ZYRO0C01650g8.262ON5863727252e-87
KLTH0G13684g8.262ON5083476912e-83
Ecym_43088.262ON5293466853e-82
Kwal_56.237998.262ON4883356796e-82
Kpol_392.68.262ON4573376715e-81
AGR086C8.262ON5343486443e-76
Kpol_543.388.262ON4423636261e-74
KLLA0F19140g8.262ON5273546312e-74
KNAG0H032408.262ON5193926083e-71
CAGL0B01771g8.262ON5364126078e-71
TBLA0E044308.262ON4813384902e-54
TPHA0J007408.262ON4083334335e-47
TPHA0A018108.262ON4573374111e-43
TBLA0F030708.262ON4453814075e-43
NDAI0B06160singletonON1403121940.009
NDAI0G00600singletonON48892890.030
NDAI0G00550singletonON41256870.060
NDAI0D03010na 1ON778155830.18
Kpol_1035.3singletonON1130136830.23
Kwal_36.16338singletonON60499790.51
Kwal_27.11219singletonON74499780.74
Kwal_39.16409singletonON73499780.78
KAFR0B06620singletonON1185107780.89
Kwal_33.15089singletonON47899761.2
Kpol_2000.35singletonON704144761.4
Kwal_54.19470singletonON54299751.7
Kwal_27.12438singletonON64199751.8
Kwal_13.691singletonON86599752.0
NDAI0D004107.483ON320103732.2
Kwal_60.24910singletonON52499723.3
Kpol_1037.34singletonON1295105733.3
Suva_9.2392.651ON97144723.8
Kwal_26.7891singletonON31099714.2
SAKL0F15840g7.528ON28856704.7
YIR023W (DAL81)2.651ON97044715.3
Kwal_55.19799singletonON35499696.6
Kwal_47.17665singletonON62566707.2
Kwal_50.19418singletonON34866697.3
Kwal_14.764singletonON35899697.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR110W
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...  1071   0.0  
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   930   0.0  
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   914   0.0  
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   899   0.0  
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   323   e-104
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   320   e-102
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   302   9e-95
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   300   2e-94
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   285   1e-87
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   283   2e-87
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   270   2e-83
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   268   3e-82
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   266   6e-82
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   263   5e-81
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   252   3e-76
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   245   1e-74
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   247   2e-74
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   238   3e-71
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   238   8e-71
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   193   2e-54
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   171   5e-47
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   162   1e-43
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   161   5e-43
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            41   0.009
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    39   0.030
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    38   0.060
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    37   0.18 
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    37   0.23 
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    35   0.51 
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    35   0.74 
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    35   0.78 
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    35   0.89 
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    34   1.2  
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    34   1.4  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    33   1.7  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    33   1.8  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    33   2.0  
NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON}                  33   2.2  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    32   3.3  
Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON} (80237...    33   3.3  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   3.8  
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    32   4.2  
SAKL0F15840g Chr6 (1283745..1284611) [867 bp, 288 aa] {ON} simil...    32   4.7  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    32   5.3  
Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {...    31   6.6  
Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {...    32   7.2  
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...    31   7.3  
Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A ...    31   7.5  

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/566 (92%), Positives = 523/566 (92%)

Query: 1   MTKPRYNDVLFDDDDSVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTEYVD 60
           MTKPRYNDVLFDDDDSVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTEYVD
Sbjct: 1   MTKPRYNDVLFDDDDSVPSESVTRKSQRRKATSPGESRESSKDRLLILPSMGESYTEYVD 60

Query: 61  SYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKL 120
           SY            TPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKL
Sbjct: 61  SYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKL 120

Query: 121 LFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFAN 180
           LFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFAN
Sbjct: 121 LFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFAN 180

Query: 181 ISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY 240
           ISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY
Sbjct: 181 ISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY 240

Query: 241 SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE 300
           SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE
Sbjct: 241 SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE 300

Query: 301 EIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXX 360
           EIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPY        
Sbjct: 301 EIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNK 360

Query: 361 XXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE 420
                PVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE
Sbjct: 361 RTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE 420

Query: 421 ADXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLTPE 480
           AD                  FEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLTPE
Sbjct: 421 ADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLTPE 480

Query: 481 EKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLES 540
           EKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLES
Sbjct: 481 EKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLES 540

Query: 541 PSTKRQKLDQQGNGDQTRDFGTSMEL 566
           PSTKRQKLDQQGNGDQTRDFGTSMEL
Sbjct: 541 PSTKRQKLDQQGNGDQTRDFGTSMEL 566

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  930 bits (2403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/577 (80%), Positives = 491/577 (85%), Gaps = 12/577 (2%)

Query: 1   MTKPRYNDVLFDDDDSVPSESVTRK--SQRRKATSPGESRESSKDRLLILPSMGESYTEY 58
           MTKPRYN VLFDDDDS+PSES TRK  SQ RKATS  ESR+SSKDRLLILPSMGESYTEY
Sbjct: 1   MTKPRYNGVLFDDDDSLPSESATRKAPSQGRKATSSRESRDSSKDRLLILPSMGESYTEY 60

Query: 59  VDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 118
           VDSY            TPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN
Sbjct: 61  VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 120

Query: 119 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHF 178
           KLLFLQRQYYVDDEGNVRDGRNNDKIYCEP H+YDMVMATHL+NKHLRGKTLHSFLFS+F
Sbjct: 121 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF 180

Query: 179 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEG 238
           ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF+GE IEG
Sbjct: 181 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEG 240

Query: 239 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDI 298
           KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFL+FARVPIFVTSSTLDKDDLYDI
Sbjct: 241 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDI 300

Query: 299 CEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXX 358
           CEEIASKYGLRIGLGLKSSARFHTGGILCI YALNSYK+ECLADWGKCLRYGPY      
Sbjct: 301 CEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRR 360

Query: 359 XXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALA 418
                  P QVLLSE+PGHNAKFETKRERVIENTYSRNMFK AGGKGLIYLEDVNTFALA
Sbjct: 361 NKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALA 420

Query: 419 NEADXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLT 478
           N+AD                  FEEEVQKQFDLTE+NYIDEYDDLAH+SSEGEF P+TLT
Sbjct: 421 NKAD-NSYNNGSSHNNDVDNDNFEEEVQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLT 479

Query: 479 PEEKPPHNVDEDRIES-TGVAAPMQGTE----EPEKGDQKESDGASQ----VDQSVEITR 529
           PEEK     +E+RI S +GVA   + T     E EK  QK++D   Q    VDQS+EI +
Sbjct: 480 PEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAK 539

Query: 530 PETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566
           PETSY+QT+ESPSTKRQKLDQQ +GD TRDFG SMEL
Sbjct: 540 PETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/580 (80%), Positives = 484/580 (83%), Gaps = 14/580 (2%)

Query: 1   MTKPRYNDVLFDD-DDSVPSESVTRKS--QRRKATSPGESRESSKDRLLILPSMGESYTE 57
           MT  RYN  LFDD DDS+PS SVTRKS  Q RK TSP ESRE  KDRLLILPSMGESYT 
Sbjct: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60

Query: 58  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 117
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTADTLQQISDKYDGVVAE
Sbjct: 61  YVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120

Query: 118 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSH 177
           NKLLFLQRQYYVD+EGNVRDGRNNDKIYCEPKH+YDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180

Query: 178 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE 237
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF G AIE
Sbjct: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240

Query: 238 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYD 297
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFL+FARVPIFVTSSTLDKDDLYD
Sbjct: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300

Query: 298 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXX 357
           ICEEIASKYGL IGLGLKSSARFHTGGILCIQYALNSYK+ECLADWGKCLRYGPY     
Sbjct: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 360

Query: 358 XXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 417
                   P QVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL
Sbjct: 361 RNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420

Query: 418 ANEADXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTL 477
           ANEA+                  FEEEVQKQFDLTE+NYIDEYDDLAHDSSEGEFEPNTL
Sbjct: 421 ANEAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480

Query: 478 TPEEKPPHNVDEDRIESTGVAAPMQG-----TEEPEKGDQ--KESDGAS----QVDQSVE 526
           TPEEK  H V+E RI ST     + G      +EPE+ +   +E+DG      QVDQSVE
Sbjct: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540

Query: 527 ITRPETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566
           ITRP+TSYYQT  SPS KRQKL+QQ +GD TRDFG SMEL
Sbjct: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/583 (77%), Positives = 477/583 (81%), Gaps = 18/583 (3%)

Query: 1   MTKPRYNDVLFDDD-DSVPSESVTRKS--QRRKATSPGESRESSKDRLLILPSMGESYTE 57
           M K RY   LFDD+ DS+PSES   KS  QRRK TSP ESRES KDRLLILP MGESYTE
Sbjct: 51  MAKLRYKGTLFDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPLMGESYTE 110

Query: 58  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 117
           YVDSY            TPIFLESLTRQLTQKIYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 111 YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170

Query: 118 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSH 177
           NKLLFL+RQYYVD+EGNVRD RNNDKIYCEPKH+YDMVMATHLMNKHLRGKTLHSFLFSH
Sbjct: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230

Query: 178 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE 237
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G+AIE
Sbjct: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290

Query: 238 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYD 297
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFL+FAR+PIFVTSSTLDKDDLYD
Sbjct: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350

Query: 298 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXX 357
           ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYK+ECLADWGKCLRYGPY     
Sbjct: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 410

Query: 358 XXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 417
                   P QVLLSEVPGHNAKFETKRERVIENTY+RNMF MAGGKGLIYLEDVNTFAL
Sbjct: 411 RNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470

Query: 418 ANEADXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTL 477
            NE +                  FEEEVQKQFDLTE+NYIDEYDDLAHDSSEGE+EP+TL
Sbjct: 471 VNEGE-SSNNNENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTL 529

Query: 478 TPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGAS--------------QVDQ 523
           TPEE   HNV+E+RIEST     + G  + E+ + +E +  S                D+
Sbjct: 530 TPEENTSHNVEEERIESTSETTDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDR 589

Query: 524 SVEITRPETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566
           SVEIT PETSYYQT E PSTKRQK+ +QG+GD TRDFG SMEL
Sbjct: 590 SVEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 161/398 (40%), Positives = 239/398 (60%), Gaps = 13/398 (3%)

Query: 27  QRRKATSPGESRESSKDRLL----------ILPSMGESYTEYVDSYXXXXXXXXXXXXTP 76
           QRR         ++ +D++L          + PSMGESY EY +SY              
Sbjct: 10  QRRNVLFDEAHSDTQEDKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLL 69

Query: 77  IFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVR 136
            + ES+  Q+   IYELI+T SLT +TL   SDK+D   AE+K +FL R+YY ++ G VR
Sbjct: 70  KYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAESKYMFLMRRYYAEN-GIVR 128

Query: 137 DGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC 196
           D R  DKI CEP  ++D++M  HLMN H+  + +++ L   ++NI+   +    ++CS C
Sbjct: 129 DRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSC 188

Query: 197 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWL 256
           N  G  +PL++Y+  +++  LLP+ER+HIE+FE F+ E+I  K++ VL CRDY + F+WL
Sbjct: 189 NPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWL 248

Query: 257 LPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 316
            PLK+TKFKHL+  V +L L    VPIF+ SSTLDK DL+DICE++  KY +++GLG  S
Sbjct: 249 APLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANS 308

Query: 317 SARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPG 376
           S++FH  GI  ++  LN+ K +C++DW  CLRYGPY             P  +L      
Sbjct: 309 SSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHT 368

Query: 377 HNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 414
           +   F  K+E +I+   ++N+  +   KGL+YLED N+
Sbjct: 369 NRKHFRPKQEMIIDELPAQNVVHV--NKGLLYLEDENS 404

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 7/48 (14%)

Query: 503 GTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLESPSTKRQKLDQ 550
            T+ PE+           +  S EI+ P TS+YQ L SPS KR +L Q
Sbjct: 436 ATQTPERS-------VEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 231/364 (63%), Gaps = 2/364 (0%)

Query: 47  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106
           I+P MGESYT Y DS+               F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107

Query: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166
            + K+  + AE + LFL+R+YY D+ G + D    DKI CEP +V+DM+M  HLMN H  
Sbjct: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226
            K +H  L + ++NI+  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227

Query: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286
           +FEPF  E IE KYS++L CRDY S ++W+LPLK+TKFKHL+P ++SLFL+F R PIF+ 
Sbjct: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287

Query: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  ++  L ++++ECL  W  C
Sbjct: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347

Query: 347 LRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406
           L+YG Y             P  +L S++   + KF+ K  +++EN  S ++ ++    GL
Sbjct: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405

Query: 407 IYLE 410
           I+LE
Sbjct: 406 IFLE 409

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  302 bits (774), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 175/521 (33%), Positives = 273/521 (52%), Gaps = 16/521 (3%)

Query: 47  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106
           ++P++GE Y +YVD                 F +++  QL +  YELIKT SLT +TL  
Sbjct: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142

Query: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166
            + K D   A ++L+FL R+Y +D++GNVRD    +++ CEP  +YDM+M  HL+N H R
Sbjct: 143 TALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGR 202

Query: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226
            +  H  L   ++NI+   ++ + QFCS CN   +  P K+YK  + +  LLP+ER+ +E
Sbjct: 203 PRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVE 262

Query: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286
           VFEPF GE + GKY  +L  RDYRS F+W++PL+++KF HL+ ++S +  +  R+PIF  
Sbjct: 263 VFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFE 322

Query: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346
           ++T++  D +DI E+I  KY + IGLG K   +  T G+  I+  L  +K+ECLADW  C
Sbjct: 323 TTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMC 382

Query: 347 LRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406
           L+YGP+             P  +L  ++P    K   K E+++++  + N+ K+  G+G 
Sbjct: 383 LKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGC 440

Query: 407 IYLEDVNTFALANEADXXXXXXXXXXXXXXXXXXFEEEVQKQFDLTEKNYIDEYDDLAHD 466
           IYLED N      E +                   EE++                 + + 
Sbjct: 441 IYLEDRNPEDPEAEYEANTDDESDTEDNVEHRQEDEEDIGAMMSPM----------IDNT 490

Query: 467 SSEGEFEPNTLTPEEKPPHNVDEDRIESTGVAAPMQGTEEPEKGDQKESDGASQVDQSVE 526
            +E E E    + E+    N +E+ +  T V   +  T +  K + K     +Q  +S E
Sbjct: 491 RTEDELENGEKSHEDDNHSNDNEEGV--TKVEGSVPTTPKRRKLNNKNVTN-TQETESPE 547

Query: 527 ITRPETSYYQTL-ESPSTKRQKLDQQGNGDQTRDFGTSMEL 566
           IT P TSYYQT  E+ S    K D  G+  +    G S E+
Sbjct: 548 ITEPSTSYYQTYQETTSQPTMKHDDSGDDVEWNKLGYSREI 588

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  300 bits (769), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 169/491 (34%), Positives = 266/491 (54%), Gaps = 30/491 (6%)

Query: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 137
           +LES+  QLTQ  YELIKT +LT +TL  ++D      AE K LFL+R+YYVD +  VRD
Sbjct: 57  YLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRD 116

Query: 138 GRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCN 197
            + +D I CEP+ +Y+++++ HL+N HL  + LH FL S ++NI+   +    ++CS+CN
Sbjct: 117 HKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECN 176

Query: 198 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNG-EAIEGKYSYVLLCRDYRSSFMWL 256
            + ++KP  ++K  + Y  LLP+ERIH+E+F+PF   E IE KYS+VL CRDY S F+WL
Sbjct: 177 PQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWL 236

Query: 257 LPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 316
            PL    F+ L+P ++   L+  R+PIF+ ++TLD+ D++D+CE IA KY L IGLGL +
Sbjct: 237 SPLTGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNN 296

Query: 317 SARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPG 376
           S+ F+  GI  ++Y L + KK+C  DWG CL+YG Y                +L +EV  
Sbjct: 297 SSHFYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSS 356

Query: 377 HNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANEADXXXXXXXXXXXXXX 436
              KF+ KRE++I   ++ N+  +    G++Y+E+ N+  +  + D              
Sbjct: 357 CGKKFKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTP 416

Query: 437 XXXXFEEEVQKQFDLTEKNYI----DEYDDLAHDSSEGEFEPNTLTPEEKPPHNVDEDRI 492
                 + V+++ D      +        D+ H +++        TP+ K   ++     
Sbjct: 417 MATSGGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADS-------TPKVKRTSSLSRASS 469

Query: 493 ESTGVAAPMQGTEEPEKGDQKESDGASQV------------------DQSVEITRPETSY 534
           + TG  A +  T  P K  +K  +  S++                  D S EI  P TS+
Sbjct: 470 KRTGERASLSDTITPTKKVKKVGENRSRLSGSESVEQGNSEANRDEYDLSEEIPGPSTSF 529

Query: 535 YQTLESPSTKR 545
           + T+    T R
Sbjct: 530 FATVNHSRTAR 540

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  285 bits (729), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 143/365 (39%), Positives = 213/365 (58%), Gaps = 5/365 (1%)

Query: 47  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 106
           ++P++GESY +YVD                 F  S+  QL + +YELI+TKSLT +TL  
Sbjct: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149

Query: 107 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLR 166
            +  +    A  +    +R+Y  D+EG VRD    ++I C+P  +Y+M+M  HLMN H +
Sbjct: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208

Query: 167 GKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 226
            +  H  L S +ANI+   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268

Query: 227 VFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286
           +FEPFNG+ IEGKYS+V+ CRDYRS ++ L PLK+TKFK+L+  ++ L     R+PIF+ 
Sbjct: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328

Query: 287 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKC 346
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  ++  L  ++KECL DW  C
Sbjct: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388

Query: 347 LRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 406
           L+YGP+             PV +L   V     K   K E++I      N+ ++  G G 
Sbjct: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446

Query: 407 IYLED 411
           IYLE+
Sbjct: 447 IYLEE 451

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 140/372 (37%), Positives = 227/372 (61%), Gaps = 4/372 (1%)

Query: 41  SKDRLLILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLT 100
           S++   I+P M + +   +               +  F  ++  QLTQ+IYELI++ +L+
Sbjct: 33  SRNGEFIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLS 92

Query: 101 ADTLQQISDKYDGVVAENKLLFLQRQYYVDDE-GNVRDGRNNDKIYCEPKHVYDMVMATH 159
              L++   K+ G  +E +  +L+ +Y+V +E G V D + +D+I CEP  ++ +VM +H
Sbjct: 93  IANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSH 151

Query: 160 LMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLP 219
           L N H+    +H  L   +ANI+   I     +CSKCN   K KP ++ +  ++Y +LLP
Sbjct: 152 LQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLP 211

Query: 220 MERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFA 279
           +ER+HIEVFEPF+GE I+G++S++L  RDY S ++W+LPL++ K KH+I  +SS  L   
Sbjct: 212 LERVHIEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLP 271

Query: 280 RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKEC 339
           R+PIF+ S+T+D++ L+D+C +IA  Y L++GLG+K+S RFH  GI  ++  L S+K+EC
Sbjct: 272 RIPIFLESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEEC 331

Query: 340 LADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFK 399
           L DW  CL+YGP+             P  +L + VP  N KF  KR  VI +T S+ +  
Sbjct: 332 LQDWNLCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVH 391

Query: 400 MAGGKGLIYLED 411
           +  G+G+++LE+
Sbjct: 392 L--GEGVLFLEN 401

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  270 bits (691), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 134/347 (38%), Positives = 214/347 (61%), Gaps = 5/347 (1%)

Query: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 137
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109

Query: 138 GRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCN 197
            + +D + CEP+ ++D++M  HL N HL  + LHS+L  ++AN + A      ++CS+CN
Sbjct: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169

Query: 198 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLL 257
            + +++P K+++  ++Y  LLP+ER+H+E+  PF+ EAIEG YS+VL  RDY S F+W+ 
Sbjct: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228

Query: 258 PLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 317
           PLK    + +   + +  L   R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 229 PLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288

Query: 318 ARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGH 377
           + F   G+  ++Y L   +++CL  W  CL+YG               P  +L S V  +
Sbjct: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348

Query: 378 NAKFETKRERVIENTYSRNM--FKMAG-GKGLIYLED-VNTFALANE 420
             +FE KRE +IE  ++RN+   K++G  +G+IYLED  + F + +E
Sbjct: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETSAFKMPDE 395

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  268 bits (685), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 128/346 (36%), Positives = 203/346 (58%), Gaps = 4/346 (1%)

Query: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 137
            + ++  QLTQ IYELI + +L+  TL +  DK      ENK + L+R+Y +  +GNV D
Sbjct: 66  LINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSIL-QGNVVD 124

Query: 138 GRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCN 197
            +  D    EP  V+D++MA HL+N HL  + +H  L + +AN++    + V  +CS CN
Sbjct: 125 HKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCN 184

Query: 198 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFN---GEAIEGKYSYVLLCRDYRSSFM 254
               +K    YK  ++YDK++P+ER H+E+F PF+    E IE KYS+VL CRDY S F+
Sbjct: 185 TDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFV 244

Query: 255 WLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 314
           W+LPL+   F+ L+P ++ L  +  R+PIF+ ++TLD+ D++D+CE IA KY L+IGLGL
Sbjct: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304

Query: 315 KSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEV 374
            S   F   G+  I+     +K++C+ +W  CLR                 P  +L +E+
Sbjct: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364

Query: 375 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANE 420
                KF+ K+ ++I+  Y+ ++ +     G+IYLED N+  + +E
Sbjct: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDE 410

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  266 bits (679), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 126/335 (37%), Positives = 201/335 (60%), Gaps = 4/335 (1%)

Query: 80  ESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGR 139
           ES+  QLTQ+ ++L+++ +LTA+ L   SDK      E K L L+R++YVD +G VRD +
Sbjct: 52  ESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFK 111

Query: 140 NNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKK 199
            +D + CEP+ ++D++M  HL N H+  + LH +L   +AN + A      ++CS+CN +
Sbjct: 112 CDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPE 171

Query: 200 GKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPL 259
             ++P ++++  ++Y  LLP+ER+H+E+  PF  + IEG YS+VL  RDY S F+W+ PL
Sbjct: 172 EVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPL 230

Query: 260 KSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR 319
            S +   +     +  L+  RVPIFV +STL + DL+++CE IAS+YGL IGLG+  S  
Sbjct: 231 ASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTT 290

Query: 320 FHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNA 379
           F   G+  ++Y L   ++ CL  W  CL++G               P  +L S V  +  
Sbjct: 291 FQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGR 350

Query: 380 KFETKRERVIENTYSRNMFKM---AGGKGLIYLED 411
           +FE KRE +IE  ++ N+ ++      +G+IYLED
Sbjct: 351 QFELKREELIEKLFASNVVELRNEGRRRGMIYLED 385

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  263 bits (671), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 138/337 (40%), Positives = 204/337 (60%), Gaps = 4/337 (1%)

Query: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGN-VR 136
           F  ++   L+Q+IY+LI T  LT   + +   K+     E K  FL+ +YYV D+G  VR
Sbjct: 92  FQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVR 150

Query: 137 DGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC 196
           D RN+DKI C P  V ++V+ THL+N+H   K++H  L   +ANIS  I      +CS C
Sbjct: 151 DRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFC 210

Query: 197 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEA-IEGKYSYVLLCRDYRSSFMW 255
           N    +KPLK+ K+ ++Y+ LLP ERIHIE+F+PF  E  IEG YS++L  RDY S ++W
Sbjct: 211 NPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVW 270

Query: 256 LLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 315
           L PLK T FK L   + + F T  + PI++ SST++++DL  + ++IA KY LRIG+G+ 
Sbjct: 271 LYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIG 330

Query: 316 SSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLL-SEV 374
           +S+ FH  G+  ++  L  ++ ECL DWG CL+YG               P+ +LL S +
Sbjct: 331 NSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGI 390

Query: 375 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 411
              + K+++K+  VI+ T+  NM  +  GK  IYLED
Sbjct: 391 SECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  252 bits (644), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 205/348 (58%), Gaps = 4/348 (1%)

Query: 78  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 137
            ++++  QLTQ+IY+LI + +L+   L +  DK      ENK + L+R+Y V   G V D
Sbjct: 60  IMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY-VAKGGIVID 118

Query: 138 GRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCN 197
            +  D    EP  ++DM+M+ HL+N H+  + ++  +   +AN++  + + V  +CS CN
Sbjct: 119 RKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCN 178

Query: 198 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIE---GKYSYVLLCRDYRSSFM 254
               ++    YK  ++++KL+P+ER H+EVF PF+ E +E   GKYS+ L CRDY S F+
Sbjct: 179 MDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFI 238

Query: 255 WLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 314
           WLLPL+   F++L+P ++ L  T  RVPIF+ ++TLD+ D++DICE IA +Y  +IGLGL
Sbjct: 239 WLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGL 298

Query: 315 KSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEV 374
            S   F   GI  ++  L+ YK+EC  DW  CLR                 P  +L +E+
Sbjct: 299 NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEI 358

Query: 375 PGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANEAD 422
           P  + KF+ K++++I+  Y+ ++       G+IYLED  +  + ++ D
Sbjct: 359 PNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEESAFVMDDPD 406

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  245 bits (626), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 123/363 (33%), Positives = 205/363 (56%), Gaps = 1/363 (0%)

Query: 49  PSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 108
           P +G +  EY+DS                +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104

Query: 109 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGK 168
            ++  + A  K L+L+R+Y +  +G V D    +KI  EP   YD +++TH++N+HL  +
Sbjct: 105 TRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 169 TLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 228
            +H  L + ++N+S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 229 EPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSS 288
           EPF  E I+ +YS+++  RDYRS F+W+ PLK+TKFK L   +  L L   R+PI++ ++
Sbjct: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284

Query: 289 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLR 348
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  ++  LN  K +CL DW  CL+
Sbjct: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344

Query: 349 YGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIY 408
            G Y             P ++ L E+      FE+KR  +I +   +N +K +  KGL+Y
Sbjct: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404

Query: 409 LED 411
            +D
Sbjct: 405 AQD 407

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  247 bits (631), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 195/354 (55%), Gaps = 11/354 (3%)

Query: 79  LESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDG 138
           + ++  QLTQ IY+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D 
Sbjct: 89  INTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQ-ENLLHDV 147

Query: 139 RNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNK 198
           +  D +  EP  ++D++M+ H++N H+  K +++ L + +AN++ +    V  FCSKCN+
Sbjct: 148 KRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNE 207

Query: 199 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGE----------AIEGKYSYVLLCRD 248
            G     K++K  +++  L+P+ R H+E+F PF+             IEGKY +VL CRD
Sbjct: 208 SGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRD 267

Query: 249 YRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGL 308
           Y S ++WL PLKS     L+PV++ L  +  R+PIF+ + TLD+ D++D+CE IA  Y +
Sbjct: 268 YYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKI 327

Query: 309 RIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQ 368
           +IGLG+ SS  F   GI  ++     +K+ECL DW  CL+                 P  
Sbjct: 328 KIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSD 387

Query: 369 VLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALANEAD 422
           +L S     + KF T +  VI      ++ +     G+IYLED N+  L    D
Sbjct: 388 LLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLSGD 441

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  238 bits (608), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 134/392 (34%), Positives = 214/392 (54%), Gaps = 11/392 (2%)

Query: 36  ESRESSKDRLLILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIK 95
           ES  S++    ++P +G+ ++ Y D                 +  +   +++Q++Y L K
Sbjct: 24  ESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFK 83

Query: 96  TKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMV 155
              +T + + ++           K++++ R+YY D  G +RD   N++I  +P H +D++
Sbjct: 84  NDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDII 143

Query: 156 MATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYD 215
           M+ HLMNKHL  + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++
Sbjct: 144 MSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFE 202

Query: 216 KLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLF 275
           K LP+ERI IE+ EPF  E +EGKYS +++ +D+   F WL PLK+TKFK+++PVV+ + 
Sbjct: 203 KALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMI 262

Query: 276 LTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL--KSSARFHTGGILCIQYALN 333
           L+F RVPI+V S+TLD  DL+DI E I +KYG++IGLG   +SSA   T     I   LN
Sbjct: 263 LSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATAR---INRDLN 319

Query: 334 SYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTY 393
            +  ECL D+  CL+YGP              P  ++        AKF  KR  +++++ 
Sbjct: 320 DHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSP 379

Query: 394 SRNMFKMAGGKGLIYLEDVNTF---ALANEAD 422
           S  +  M  G G +YLE  N     A A+ AD
Sbjct: 380 SSCV--MNRGMGTLYLESPNGIQEDAAASSAD 409

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  238 bits (607), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 218/412 (52%), Gaps = 21/412 (5%)

Query: 24  RKSQRRKA-TSPGESRESSKDRLLILPSMGESYTEYV---DSYXXXXXXXXXXXXTPIFL 79
           R ++RR A TS   S E       ++P++ E+Y +Y+   DS                F 
Sbjct: 37  RATKRRPAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFA 96

Query: 80  ESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGR 139
           E L  +LTQ+ Y L+   +LT +T+ +  + +    AE K   L +++Y D EGN+RD +
Sbjct: 97  EGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAK 156

Query: 140 NNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKK 199
            ++ I  EP  ++++++  HL N HL+   L   L   +AN +   +     +C++CN  
Sbjct: 157 VDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPD 216

Query: 200 GKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGE--------------AIEGKYSYVLL 245
             IKP+++ +  ++ ++LLP+ER+HIEVF PF  E               IEGKYS+V  
Sbjct: 217 RYIKPIEKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFY 276

Query: 246 CRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLT-FARVPIFVTSSTLDKDDLYDICEEIAS 304
           CRD+R+ ++W  PLK+ KFK L+  +++ F+T     PIFV SST+D+DDL +I E +AS
Sbjct: 277 CRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLAS 336

Query: 305 KYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXX 364
           KYGL++GLG  +  +FH  GI   +  L+  K EC  DW  CL+ G Y            
Sbjct: 337 KYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGK 396

Query: 365 XPVQVLLSEVPGHNAK-FETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTF 415
               +L +E+ G   +    K+ + IE ++S N+       G I++E V  +
Sbjct: 397 AS-NILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIEHVQDY 447

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  193 bits (490), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 183/338 (54%), Gaps = 14/338 (4%)

Query: 86  LTQKIYELIKTKSLTADTLQQISDKY-DGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKI 144
           LTQ+  +++ T +L+ + + +   K  +   A  K  F  R+YY++++ N+ D R   +I
Sbjct: 73  LTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRI 132

Query: 145 YCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKC--NKKGKI 202
            CEPK++YD+V+A HL  K      +   L   F+N+    ID+  ++CSKC  ++   +
Sbjct: 133 ICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHM 190

Query: 203 KPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWL 256
           K   +   +K  R ++ D+ L PMERIHIE+F PF+   IE KY  +L  RDY + ++W 
Sbjct: 191 KLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWT 250

Query: 257 LPLKSTKFKHLIPVVSSLFLTFA-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 315
             LK  K KH+  +++  FL+ A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG  
Sbjct: 251 FTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTN 310

Query: 316 SSA-RFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVL-LSE 373
           +    FH  GI   +  +N  K +CL  W   L +G               P+ ++  + 
Sbjct: 311 NKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNN 370

Query: 374 VPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLED 411
           +     KF  +R R+I+ T + N  K+     +I++ED
Sbjct: 371 LAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  171 bits (433), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 166/333 (49%), Gaps = 10/333 (3%)

Query: 86  LTQKIYELIKTKSLTADTLQQI-------SDKYDGVVAENKLLFLQRQYYVDDEGNVRDG 138
           LTQK+Y LI+ K+   +T ++        S KY G  A  K + ++ +Y +++ G + D 
Sbjct: 62  LTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDK 120

Query: 139 RNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNK 198
           RN+ K+   P  +YD++M  H +N HL    +H  L   ++NIS A++    Q CS CN 
Sbjct: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180

Query: 199 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF-NGEAIEGKYSYVLLCRDYRSSFMWLL 257
           K   K + EY R    DK    E+IH+E+F+PF + +    K+S+V+  RDY + ++WL 
Sbjct: 181 KSTYKHI-EYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLY 239

Query: 258 PLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 317
           PL+    K L   +++  L   R+PI++ S TLD+ +L  I + I+    L +G+G    
Sbjct: 240 PLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKL 299

Query: 318 ARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGH 377
             F   GI  ++      ++ C  +W K +                  P+ ++  E    
Sbjct: 300 DEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD 359

Query: 378 NAKFETKRERVIENTYSRNMFKMAGGKGLIYLE 410
           N  ++ KR+R I  T S+N   +  GK  +Y E
Sbjct: 360 NKTYKKKRQRTILLTLSKNTILLKNGKSALYKE 392

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  162 bits (411), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 169/337 (50%), Gaps = 6/337 (1%)

Query: 81  SLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRN 140
           S T  L++++Y+L+K   LT   +  ++   D   A  +L+ L+ +YY D +  V D   
Sbjct: 63  SKTNYLSKELYDLVKNDDLTRKNVA-VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSK 121

Query: 141 NDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKG 200
            +KI  +P H + MVM THL+N HL    ++  L   FAN+S   I    ++CS CN   
Sbjct: 122 QNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK 181

Query: 201 KIKPLKEYKRPDMYDK--LLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLP 258
             K ++  K P + +   +L  ER+ ++V  PF  + I+ +Y+++L   D+ + FMW  P
Sbjct: 182 --KNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFP 239

Query: 259 LKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSA 318
           LK+ K + +I  V+   +     P+F++S TL  +D++++C  +A +Y + IGLG ++  
Sbjct: 240 LKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQ 299

Query: 319 RFHTGGILCIQYALNSYKKECLADWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHN 378
           + ++     +   LNS+K ECL  W  CL++                    L S +    
Sbjct: 300 KAYSKNPY-VTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFL 358

Query: 379 AKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTF 415
            K+E + + +I    S N   +  G   IY ED  +F
Sbjct: 359 KKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSF 395

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  161 bits (407), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 107/381 (28%), Positives = 188/381 (49%), Gaps = 11/381 (2%)

Query: 49  PSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 108
           P +G+    Y DSY            T  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 31  PPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90

Query: 109 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGK 168
                 +  +K ++LQ +Y  + +G++ + + N K+ CEPK++Y + M  H MN H+R  
Sbjct: 91  SL---KIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146

Query: 169 TLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 227
            L+  L   + NI + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206

Query: 228 FEPFNGEAIE--GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFV 285
            +PFN   I+   KYS++LL RDY S + W+ PLKS   K++   +    +T  R PIF+
Sbjct: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266

Query: 286 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR--FHTGGILCIQYALN--SYKKECLA 341
            S  + +  L  I  +I  +Y ++I +G+       F   GI  + Y LN    K++C +
Sbjct: 267 HSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKS 326

Query: 342 DWGKCLRYGPYXXXXXXXXXXXXXPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMA 401
           DW +C+R   +                ++  +    N  FE KR+ ++ +    N+ K+ 
Sbjct: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 402 GGKGLIYLEDVNTFALANEAD 422
               +IY ++ N+    +E D
Sbjct: 387 ECGSIIYFDNNNSGKELDEKD 407

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 159 HLMNKHLRGKTLHSFLFSHFANISHAIIDW--VQQF-CSKCNKKGKIKPLKEY--KRPDM 213
           H+  K +R K++ S L +   NI    +DW  + +F C  C   GKI   K     R   
Sbjct: 315 HINVKDIR-KSIESKLIT---NIRINDVDWSGIDKFQCKDC-LAGKITKHKHIVGSRLKY 369

Query: 214 YDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSS 273
                P E IH ++F P +G  I     Y +   D  + F W+ PLK     H++P+   
Sbjct: 370 QKSYEPFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQ 428

Query: 274 L 274
           L
Sbjct: 429 L 429

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 186 IDW--VQQF-CSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSY 242
           +DW  + +F C  C   GK+   K      +  K  PM  IH ++F P +G  I     Y
Sbjct: 151 VDWSGIDKFQCKDC-LTGKLTKHKHIVGSRLNIKS-PMSYIHTDLFGPVSGVDITSP-KY 207

Query: 243 VLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 274
            +   D  + F W+ PLK     H++P+   L
Sbjct: 208 FISFTDENTRFRWVFPLKKKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 219 PMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 274
           P E IH ++F P +G  I     Y +   D  + F W+ PLK     H++P+   L
Sbjct: 290 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 344

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 60/155 (38%), Gaps = 23/155 (14%)

Query: 144 IYCEPKHVYDMVMATH--------LMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSK 195
           I+C P  ++ ++   H         + KH     + S L + + NIS  +I  V   C  
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 196 CNKKGKIKPLKEYKRPDMYDKLLPM-----ERIHIEVFEPFNGEAIEGK----YSYVLLC 246
           C      KPL   K       +LP+     +R+ +++    +   +  K     + +L  
Sbjct: 214 C------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYI 267

Query: 247 RDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARV 281
            DY S  +WL  L   +    I +V  +FL    +
Sbjct: 268 GDYHSGAVWLFALDGEEDATDILLVLEMFLNVVLI 302

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 30/136 (22%), Positives = 53/136 (38%), Gaps = 11/136 (8%)

Query: 189 VQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRD 248
           V + CS+C    K   L   + P+++   +   R H++   P         Y Y LL  D
Sbjct: 797 VVRLCSRCETYEKFSDL-PIELPEIHRTPV-FSRWHLDFAGPLPAH---NGYKYFLLAAD 851

Query: 249 YRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGL 308
           Y S+ + + PL    F  +  ++  ++ TF R  + VT      D+       I      
Sbjct: 852 YTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVT------DNGSPFANNIVPTIAA 905

Query: 309 RIGLGLKSSARFHTGG 324
            + +    S+ +H  G
Sbjct: 906 HLKIKYYQSSAYHPRG 921

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 186 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW++     C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 143

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 34.7 bits (78), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 186 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW++     C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 140 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 198

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 199 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 237

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 186 IDWVQQF---CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW++     C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 246 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 304

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 51/107 (47%), Gaps = 8/107 (7%)

Query: 180 NISHAIIDW--VQQF-CSKCNKKGKIKPLKEYKRPDM-YDKLL-PMERIHIEVFEPFNGE 234
           NI+   IDW  + +F C +C   GK++  K      + Y +   P + IH ++F P + +
Sbjct: 623 NITADKIDWRGIDKFQCKEC-LAGKMRRHKHTVGSRLKYQQFFEPFQYIHTDLFGPMS-D 680

Query: 235 AIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARV 281
                 +Y +   D  + F W+ PL+S   +H++ V   L + F R 
Sbjct: 681 VSATTPTYFISFVDENTRFRWVYPLRSKSAEHILLVFRKL-VNFIRT 726

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 85  VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 143

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 20/144 (13%)

Query: 185 IIDWVQQFCSKCNKKGKIK----PLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKY 240
           ++D V+Q C +C    K +     L E +R  ++       R H++   P   +     Y
Sbjct: 347 LLDVVKQ-CPRCETYQKFRDIPIELPEIRRIPVF------SRWHLDFAGPLKDK---DGY 396

Query: 241 SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICE 300
            Y LL  DY S+ + + PL+   F  +  ++ +++  F    + +T      D+      
Sbjct: 397 KYFLLAADYTSNLILVKPLREQTFHSVYEIMRAIYAIFGSPHMLIT------DNGRQFAN 450

Query: 301 EIASKYGLRIGLGLKSSARFHTGG 324
            I  +    + L    S+ +H  G
Sbjct: 451 AIIPQVARSLKLKYYQSSAYHPRG 474

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKC-NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 239

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 246 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 304

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 305 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 343

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 239

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON} 
          Length = 320

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 143 KIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKI 202
           KI C   H Y ++  T   N   + K ++SF ++        ++  V+Q  SKC K+G+ 
Sbjct: 2   KILCWFLHSYSIITQT---NNQAKNKEMNSFTYTSIQK-QKRLLTLVEQKLSKCAKQGET 57

Query: 203 K--PLKEY-KRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYSY 242
           K   L+E     ++ D+LL     +I+ FE F     +  Y Y
Sbjct: 58  KGYNLREMVGHANLLDQLLD----NIQNFENFENHQRQHSYYY 96

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW++   F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 381 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 439

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 440 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 478

>Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON}
           (80237..84124) [3888 nt, 1296 aa]
          Length = 1295

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 43/105 (40%), Gaps = 7/105 (6%)

Query: 180 NISHAIIDW--VQQF-CSKCNKKGKIKPLKEY--KRPDMYDKLLPMERIHIEVFEPFNGE 234
           NIS+  IDW     F C  C  KGK    K Y   R     +    E +H ++F P    
Sbjct: 182 NISYDNIDWSGFDTFQCPDC-LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM 240

Query: 235 AIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFA 279
                 +Y +   D +S F W+ PL+S     +  V  ++  TF 
Sbjct: 241 PTSSP-TYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFG 284

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 247 RDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTL 290
           RDY  +++W+L + S  F  L   ++++ L FA++P  +T   L
Sbjct: 707 RDYLRNYIWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLTDEPL 750

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW++   F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 143

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>SAKL0F15840g Chr6 (1283745..1284611) [867 bp, 288 aa] {ON} similar
           to uniprot|Q06188 Saccharomyces cerevisiae YLR455W
           Hypothetical ORF
          Length = 288

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 6/56 (10%)

Query: 500 PMQGTEEPEKGDQKESDGASQVDQSVEITRPETSYYQTLE------SPSTKRQKLD 549
           P QG ++ EKG       +++V     ITRP+    +  E      SP  K+QKLD
Sbjct: 127 PFQGRDKEEKGKSSRKGSSTRVATPTPITRPKKERPENEERIDVSTSPPKKKQKLD 182

>YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Positive
           regulator of genes in multiple nitrogen degradation
           pathways; contains DNA binding domain but does not
           appear to bind the dodecanucleotide sequence present in
           the promoter region of many genes involved in allantoin
           catabolism
          Length = 970

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 243 VLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVT 286
            ++ RDY  ++ W+L + S  F  L   ++++ L FA++P  +T
Sbjct: 704 AMIFRDYVRNYTWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLT 747

>Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 159] FULL
          Length = 354

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 170 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 228

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 229 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 267

>Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 206] FULL
          Length = 625

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 215 DKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 274
           +K   +E +H ++F P +     G   Y +   D R+ + W+ PL     + ++ V   L
Sbjct: 20  EKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 275 FLTFAR 280
               AR
Sbjct: 79  IAHIAR 84

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 29/66 (43%), Gaps = 1/66 (1%)

Query: 215 DKLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSL 274
           +K   +E +H ++F P +     G   Y +   D R+ + W+ PL     + ++ V   L
Sbjct: 20  EKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 275 FLTFAR 280
               AR
Sbjct: 79  IAHIAR 84

>Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A -
           Ty ORF [contig 245] FULL
          Length = 358

 Score = 31.2 bits (69), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 41/99 (41%), Gaps = 5/99 (5%)

Query: 186 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEGKYS 241
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P +     G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 239

Query: 242 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFAR 280
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,880,683
Number of extensions: 2544523
Number of successful extensions: 10480
Number of sequences better than 10.0: 122
Number of HSP's gapped: 10642
Number of HSP's successfully gapped: 143
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)