Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR109C8.257ON71571538630.0
Smik_4.3558.257ON70470629560.0
Skud_4.3708.257ON71471528560.0
Suva_2.2698.257ON72569827280.0
SAKL0H17160g8.257ON73973322790.0
KLTH0G13794g8.257ON72570122350.0
Kwal_56.236078.257ON72570522240.0
TDEL0F038408.257ON72669521890.0
ZYRO0C01782g8.257ON73069821550.0
KLLA0F19041g8.257ON76351720820.0
NCAS0B038708.257ON59652318030.0
Kpol_392.98.257ON59451917760.0
NDAI0J014008.257ON58851717610.0
KAFR0B055608.257ON60551617570.0
KNAG0H032608.257ON58052017380.0
TBLA0E044008.257ON58952317080.0
Ecym_43138.257ON59751817050.0
CAGL0B01727g8.257ON57751416410.0
AGR092W8.257ON59651815780.0
TPHA0B032408.257ON58551415760.0
Suva_14.931.111ON5435505143e-56
Skud_14.891.111ON5695635041e-54
Smik_14.861.111ON5435434837e-52
TDEL0C059001.111ON5435674626e-49
YNL249C (MPA43)1.111ON5425264555e-48
ZYRO0F16016g1.111ON5425314502e-47
Kwal_33.135301.111ON5345334484e-47
KLTH0F03080g1.111ON5335254291e-44
SAKL0C03432g1.111ON5475304194e-43
KNAG0F006601.111ON5355674104e-42
KLLA0C02937g1.111ON5164993166e-30
NCAS0A007801.111ON5495342135e-17
NDAI0H002204.9ON810451910.026
NCAS0C059004.9ON703130890.054
TBLA0C027801.289ON22066760.95
Kpol_1016.241.289ON21166751.1
TPHA0K022804.9ON667199761.6
TPHA0E030005.215ON933135742.9
YHL032C (GUT1)4.9ON709149709.7
Skud_2.2978.590ON693129709.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR109C
         (715 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...  1492   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...  1143   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...  1104   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...  1055   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   882   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   865   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   861   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   847   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   834   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   806   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    699   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   688   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   682   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   681   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   674   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   662   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   661   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   636   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   612   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   611   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   202   3e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   198   1e-54
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   190   7e-52
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   182   6e-49
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   179   5e-48
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   177   2e-47
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   177   4e-47
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   169   1e-44
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   166   4e-43
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   162   4e-42
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   126   6e-30
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    87   5e-17
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    40   0.026
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    39   0.054
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...    34   0.95 
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....    33   1.1  
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    34   1.6  
TPHA0E03000 Chr5 complement(629588..632389) [2802 bp, 933 aa] {O...    33   2.9  
YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}  GU...    32   9.7  
Skud_2.297 Chr2 complement(541317..543398) [2082 bp, 693 aa] {ON...    32   9.8  

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score = 1492 bits (3863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 715/715 (100%), Positives = 715/715 (100%)

Query: 1   MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN 60
           MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN
Sbjct: 1   MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN 60

Query: 61  MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV 120
           MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV
Sbjct: 61  MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV 120

Query: 121 VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP 180
           VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP
Sbjct: 121 VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP 180

Query: 181 KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS 240
           KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS
Sbjct: 181 KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS 240

Query: 241 KEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGI 300
           KEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGI
Sbjct: 241 KEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGI 300

Query: 301 IDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVH 360
           IDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVH
Sbjct: 301 IDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVH 360

Query: 361 GVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL 420
           GVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL
Sbjct: 361 GVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL 420

Query: 421 ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA 480
           ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA
Sbjct: 421 ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA 480

Query: 481 CEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV 540
           CEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV
Sbjct: 481 CEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV 540

Query: 541 FGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSP 600
           FGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSP
Sbjct: 541 FGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSP 600

Query: 601 HNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWK 660
           HNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWK
Sbjct: 601 HNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWK 660

Query: 661 VMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715
           VMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR
Sbjct: 661 VMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score = 1143 bits (2956), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/706 (77%), Positives = 610/706 (86%), Gaps = 2/706 (0%)

Query: 10  MQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPI 69
           MQ++  +     SQ TS SRIS  + E KFYVGVDVGTGS RAC+ID+SGN+LSLAEKPI
Sbjct: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60

Query: 70  KREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEE 129
           KRE+L+SNFITQSSREIWNAVCYCVR V++E+GVDP R+ GIGFDATCSLVVVSAT+F+E
Sbjct: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120

Query: 130 IAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNL 189
           IAVGPDFTNNDQNIILWMDHRAMKETEEIN SG+ CLKYVGGQMSVEMEIPKIKWLKNNL
Sbjct: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180

Query: 190 EAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGL 249
           E+GIFQDCKFFDLPDYLTF+ATGKENRSF S VCKQGFLP GVEGS++GWSK+FL+SIGL
Sbjct: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240

Query: 250 SELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVG 309
           SELT NDFE+LGGSLR +KNFL+AGECI PLD KAA QLGLTE+CVVSSGIIDAYAGWVG
Sbjct: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300

Query: 310 TVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDV 369
           TVAAKPES +KGL E E+YK DFNGAIGRLAAVAGTSTCHILLSK+ IFVHG+WGPYRDV
Sbjct: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360

Query: 370 LARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKV 429
           LARGFWAAEGGQSCTGVLLDH+ITTHPAF++LS +A+ A VSKFEYLN +LE LVEKRK 
Sbjct: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420

Query: 430 RSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTR 489
           RSVI LAKHLFFYGDY GNRSPIADPNMRACIIGQSMDNSI+DLAV+YL ACEFISQQTR
Sbjct: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480

Query: 490 QIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAA 549
           QIIEVMLKSGH INA+FMSGGQCRN LLMRLLADCTGLPIVIPRY+D AVVFGSALLGAA
Sbjct: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540

Query: 550 ASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPS 609
           AS+ FD  + +R +K +KSS  +TE     Y SIQ L +E  N +   V+ + L  S  +
Sbjct: 541 ASKVFDLNKRRRVIKSKKSSLVQTEFLEGLYPSIQNLPLE--NHSTNVVASYKLACSNLN 598

Query: 610 APAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWKVMQELTGNA 669
           APA+ ++   PI  +QP D  S++SSK  SL  G+E+L E R    + LWKVMQELTGNA
Sbjct: 599 APARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNA 658

Query: 670 RIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715
           +++ PN KTHPDRILLDTKYQIFLDM+ETQR YRRMVDKVE +FSR
Sbjct: 659 KVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score = 1104 bits (2856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/715 (74%), Positives = 604/715 (84%), Gaps = 1/715 (0%)

Query: 1   MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN 60
           M  +K +  MQ +T    V  S++ S+S I  +DPE KFYVGVDVGTGSARAC+IDQSGN
Sbjct: 1   MYVKKLRRRMQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGN 60

Query: 61  MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV 120
           MLSLAEKPIKRE+L  NFITQSSREIW+AVC+CV+ V++ES VDP+RV G+GFDATCSLV
Sbjct: 61  MLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLV 120

Query: 121 VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP 180
           VVSAT+ + +AVGPDFT NDQNIILWMDHRAMKETEEINSS DKCLKYVGGQMSVEMEIP
Sbjct: 121 VVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIP 180

Query: 181 KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS 240
           KIKWLKNNL + +FQDCKFFDLPDYLTFKATGKENRSF SAVCKQGFLP GVEGS++GWS
Sbjct: 181 KIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWS 240

Query: 241 KEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGI 300
           +EFLN+IGLSEL ++DFE+LGGSLR KKNFL+AGECI  LD KAA +LGLTE+CVVSSG+
Sbjct: 241 EEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGL 300

Query: 301 IDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVH 360
           IDAYAGWVGTVAAKPES ++GLAE E+   ++NGAIGRLAAVAGTSTCHILLSK+PIFVH
Sbjct: 301 IDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVH 360

Query: 361 GVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL 420
           G+WGPYRDVLARGFWAAEGGQSCTGVLLDH+I  HPA+TELS + N AGVSKFEYLN +L
Sbjct: 361 GIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSML 420

Query: 421 ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA 480
           ET+V+KR  RSVISLA+HLFFYGDYHGNRSPIAD NMRACIIGQSMDNS+EDLA+ YLSA
Sbjct: 421 ETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSA 480

Query: 481 CEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV 540
           CEFISQQTRQI+EVMLKSGH+I+AIFMSGGQCRN LL RLLADC+GLPIVIPRY+D AVV
Sbjct: 481 CEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVV 540

Query: 541 FGSALLGAAASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSP 600
           FGSALLGAAASE FD  + +RTL  +KSS  + E F +SY S Q  +M  +N  +     
Sbjct: 541 FGSALLGAAASEAFDLAKGRRTLTTKKSSSAQ-EFFINSYPSPQNSAMRHQNLASDVTCS 599

Query: 601 HNLQLSTPSAPAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWK 660
           +NL  S  SAP  +N +S  I  Q   D +SEESSK    TV   SL E RY GT  LWK
Sbjct: 600 YNLPNSISSAPDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWK 659

Query: 661 VMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715
           VMQELTG+A+ VNPN+ THPDRILLDTKYQIFLDM ETQ++YR MVD +E SFS+
Sbjct: 660 VMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score = 1055 bits (2728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/698 (73%), Positives = 579/698 (82%), Gaps = 11/698 (1%)

Query: 20  LSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFI 79
           L SQ   + + S QD + KF+VGVDVGTGS RAC+IDQ G +LSLAEKPIKRE++ SNFI
Sbjct: 24  LPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFI 83

Query: 80  TQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNN 139
           TQSS+EIW+AVC+CV+ V++ES VDP++V GIGFDATCSLVVVSAT+ + IAVGPDF+NN
Sbjct: 84  TQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNN 143

Query: 140 DQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKF 199
           DQNIILWMDHRAMKETEEINS+GDKCLKYVGGQMSVEM+IPKIKWLKNNLEA IF+DCKF
Sbjct: 144 DQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKF 203

Query: 200 FDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFER 259
           F+LPDYLTFKATGKENRSF SAVCKQGFLP GVE S +GWS+EFLNSIGLSELT NDFER
Sbjct: 204 FNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFER 263

Query: 260 LGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAV 319
           LGGSLR+KKNFL+AGEC+  LD  +AC+LGLT+HC+V SGIIDAYAGWVGTVAAKP SA+
Sbjct: 264 LGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAI 323

Query: 320 KGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEG 379
            GL+E E+ K D N AIGRLAAVAGTSTCHILLSK+PIFVHGVWGPYRDVLAR FW AEG
Sbjct: 324 PGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEG 383

Query: 380 GQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHL 439
           GQSCTG LL H+I THPAFTELS +A+ A +S FEYLN +LETLV+KR  RSV+SLAKH 
Sbjct: 384 GQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHF 443

Query: 440 FFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSG 499
           FFYGDYHGNRSPIADPNMRACIIGQSMDNS+EDLAV YL ACEFISQQTRQIIE ML++G
Sbjct: 444 FFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENG 503

Query: 500 HEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTRE 559
           H I+AIFMSGGQCRN LLMRLLADCTGLPI+IPRY+DAAVVFGSALLGAAASE  D   E
Sbjct: 504 HRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDLANE 563

Query: 560 KRTLKGQKSSQTKTER-FNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPS----APAKI 614
           K   + ++SS ++ E+  ND Y  IQ LS ED+N     VSP N   STPS     PA +
Sbjct: 564 KTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFD-VSPPN---STPSYIKNIPATL 619

Query: 615 NNYSLPICTQQ--PLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWKVMQELTGNARIV 672
           N++  PI  +Q   +      + KD S +     L + R N    LWKVMQELTG A++V
Sbjct: 620 NSHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQELTGEAKVV 679

Query: 673 NPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710
           NPN+KTHPDRILLDTKYQIFLDM E QRKYR MVD+VE
Sbjct: 680 NPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  882 bits (2279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/733 (59%), Positives = 538/733 (73%), Gaps = 28/733 (3%)

Query: 1   MKSRKRQNNMQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN 60
           M SRK ++++    +    L SQ  S+S +S +  +  +YVGVDVGTGSARAC+ID  GN
Sbjct: 1   MHSRKSRSSLSISQQR---LLSQ--SMSALSMEQNKMTYYVGVDVGTGSARACIIDNMGN 55

Query: 61  MLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLV 120
           +LSLAE+PI+R++L  ++ITQSS+EIW A+CYCV++VV++SGV PE++ GIGFDATCSLV
Sbjct: 56  ILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLV 115

Query: 121 VVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIP 180
           VV   + +E+AVGPDF N +QNIILWMDHRA+ ET+EIN++ DKCLKYVGGQMSVEMEIP
Sbjct: 116 VVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIP 175

Query: 181 KIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWS 240
           KIKWLKNNL    F+ CKFFDL DYLTFKATG E RS+CS VCKQG LPVGVE S  GWS
Sbjct: 176 KIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWS 235

Query: 241 KEFLNSIGLSELTKNDFERLGGSLREK----KNFLTAGECISPLDKKAACQLGLTEHCVV 296
           KEFL +IGL +L ++DF +LGGS++        FL+AGECI  LD  AA +LGL  HCVV
Sbjct: 236 KEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVV 295

Query: 297 SSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNP 356
            SG+IDAYAGWVGTVAA+ +  +  L E +N K   + A GRLAAVAGTSTCHI +SK+P
Sbjct: 296 GSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDP 355

Query: 357 IFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYL 416
           IFV GVWGPYRDV+A GFW AEGGQSCTG LL H++T HPA+TELSH+++ A VSKF+YL
Sbjct: 356 IFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYL 415

Query: 417 NKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVM 476
           N  LE L ++R  RSV++LAKHLFFYGDYHGNRSPIADP+MRA +IGQSMDNSI+DLA+M
Sbjct: 416 NSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIM 475

Query: 477 YLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVD 536
           YL ACEFI+QQTRQI+E M  SGH I AIFMSGGQCRN LLMRLLADCTGLPIVIPRY+D
Sbjct: 476 YLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYID 535

Query: 537 AAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQT--KTERFNDSYSSIQK--LSMEDRN 592
           AAVVFGSALLGA ASE F+   +  +L  ++ S    K E F DS    +K  LS     
Sbjct: 536 AAVVFGSALLGAVASESFNLNHKSGSLSRRRKSSLSGKYEEFKDSMEIPKKNFLSKLGGT 595

Query: 593 STNGFVSPHNLQLSTPSA---PAKINNYSLPICTQQPLDKTSEESSKD--ASLTVG---- 643
           ++    SP+    +T S     + +  +  P+ +   +    E+  ++  A+L+ G    
Sbjct: 596 ASGDLPSPYTAPSATASTSQIASTVGGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKA 655

Query: 644 --QESLGEGRYNGTS----FLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIE 697
             QE L   +    S     LW VM  +TG  ++V P+   HPDR+LLD KY+IFLDM E
Sbjct: 656 TAQEQLALEKEKSASGKGDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAE 715

Query: 698 TQRKYRRMVDKVE 710
           TQR+YR  VDKVE
Sbjct: 716 TQRRYREAVDKVE 728

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  865 bits (2235), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/701 (60%), Positives = 517/701 (73%), Gaps = 20/701 (2%)

Query: 26  SISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSRE 85
           S+  +S +  +  +YVGVDVGTGSARAC+ID  GN+LSLAE+PI+REQL +NFITQSS+E
Sbjct: 21  SMVGLSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQE 80

Query: 86  IWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIIL 145
           IW AVC+CV++VV +SGV  E++ GIGFDATCSLVVV     +E+AVGPDF+N DQNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIIL 140

Query: 146 WMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDY 205
           WMDHRA++ET+ IN++GDKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DY
Sbjct: 141 WMDHRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADY 200

Query: 206 LTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLR 265
           LTFKA+GKE RSFCS VCKQG LPVGVEGS  GWS+EFL  IGL EL ++DF R+GGS++
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK 260

Query: 266 ---EKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGL 322
              + KNFL+AGE I  +D   A +LGL+ HCVV SG+IDAYAGWVGTVAA+ + ++  L
Sbjct: 261 NSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 323 AETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQS 382
            +T+  K   + A GRLAAVAGTSTCHI +S++PIFV GVWGPYRD LA  FW AEGGQS
Sbjct: 321 VKTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 383 CTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFY 442
           CTG LL H++TTHPA+TELS +A+ A VSKF+YLN  LETL +++K RSV+ LAKHLFFY
Sbjct: 381 CTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFY 440

Query: 443 GDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEI 502
           GDYHGNRSPIADP+MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI++ M  SGH++
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDL 500

Query: 503 NAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRT 562
           +AIFMSGGQCRN LLMRLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE FD +     
Sbjct: 501 SAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSA 560

Query: 563 LKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPIC 622
           L   + S    E  N        +S   +   +   SP+    +T S     +    P  
Sbjct: 561 LSVSRKSSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFP 620

Query: 623 TQQ---PLDKTSEESSKDASLT-----------VGQESLGEGRY--NGTSFLWKVMQELT 666
           T +    +D+  E+   +   T              E   +GR   NG + +W VM  +T
Sbjct: 621 TPEDAYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDA-MWNVMYNMT 679

Query: 667 GNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707
           G  ++V P  + + DR+LL+ KY+IFLDM ETQRKYR +VD
Sbjct: 680 GGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  861 bits (2224), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/705 (59%), Positives = 515/705 (73%), Gaps = 18/705 (2%)

Query: 26  SISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSRE 85
           S++ +S +  +  +Y+GVDVGTGSARAC+ID  GN+LSLAE+PI+REQL  NFITQSS+E
Sbjct: 21  SMTGLSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQE 80

Query: 86  IWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIIL 145
           IW AVC+CV++VV +SGV  E++ GIGFDATCSLVVV   + +E+AVGPDF N +QNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIIL 140

Query: 146 WMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDY 205
           WMDHRA++ETE+IN++GDKCLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DY
Sbjct: 141 WMDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADY 200

Query: 206 LTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLR 265
           LTFKA+GKE RSFCS VCKQG LPVGVEGS  GWS+EFL  IGL +  ++DF ++GGS++
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK 260

Query: 266 ---EKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGL 322
              + KNFL+AGE +  +D   A +LGL+ HCVV SG+IDAYAGWVGTVAA+ + ++  L
Sbjct: 261 NSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 323 AETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQS 382
            + +  K   + A GRLAAVAGTSTCHI +S++PIFV GVWGPYRD LA  FW AEGGQS
Sbjct: 321 VKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 383 CTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFY 442
           CTG LL H++TTHPA+TELS +A+ A VSKF+YLN  LETL +++K RSV+ LA+HLFFY
Sbjct: 381 CTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFY 440

Query: 443 GDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEI 502
           GDYHGNRSPIADP+MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI+E M  SGH++
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDM 500

Query: 503 NAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRT 562
            AIFMSGGQCRN LLMRLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE FD +     
Sbjct: 501 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSE 560

Query: 563 LKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPIC 622
           L   + S       + S      +S   +  ++   SP+    +T S     +    P  
Sbjct: 561 LSVSRKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFP 620

Query: 623 TQQPLDKTSEESSKDASLTVGQE----------SLGEGRYNGTS-----FLWKVMQELTG 667
           T        E++  DA      E             E R  G S      +W VM  +TG
Sbjct: 621 TPDDPYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTG 680

Query: 668 NARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGS 712
             ++V P  + +PDR LLD KY+IFLDM ETQRKYR +V++VE S
Sbjct: 681 GGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/695 (59%), Positives = 517/695 (74%), Gaps = 20/695 (2%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +YVGVDVGTGSARAC+ID +GN+LSLAEKPI+RE+L  N+ITQSS+EIW ++C+CV++VV
Sbjct: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93

Query: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158
            +SGV  ER+ GIGFDATCSLVVV   + +E+ VGP F NNDQNI+LWMDHRA+ ET EI
Sbjct: 94  RDSGVPVERIHGIGFDATCSLVVVDDED-KEVGVGPVFANNDQNIVLWMDHRAIAETNEI 152

Query: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218
           N++ DKCLKYVGGQMSVEMEIPKIKWLKNNL    F  CKFFDL DYLTFKAT K+ RSF
Sbjct: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212

Query: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDF------ERLGGSLREKKNFLT 272
           CS VCKQG +P+GVEGS  GWSK+FLN+I L EL +N F           +     +FL+
Sbjct: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272

Query: 273 AGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDF 332
           AGE +  LD++AA +LGL  HCVV SG+IDAYAGWVGTVAA+ +  +  LAE +  KK  
Sbjct: 273 AGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332

Query: 333 NGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLI 392
           + A GRLAAVAGTSTCHI LS++P+FV+GVWGPYRDV+A GFWAAEGGQSCTG LL H++
Sbjct: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392

Query: 393 TTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPI 452
           +THPAFTELSH+++ A +SKF+YLN  LETLV++R  RSV++LAKHL+FYGDYHGNRSPI
Sbjct: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452

Query: 453 ADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQC 512
           ADP+MRA IIGQSMDNSI+DLA+MYL ACEFI+QQTRQI+E M  +GH+I+ IFMSGGQC
Sbjct: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512

Query: 513 RNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTL-KGQKSSQT 571
           RN LLMRLLADCTGLPI+IPRY+DAAVVFGSALLGA ASE F+    K  + + +KSS T
Sbjct: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRRKSSLT 572

Query: 572 KTERFNDSYSS----IQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQPL 627
             +  +   +S    + +L     +  + + +PH    ST    A   ++  P+  +   
Sbjct: 573 NLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHATS-STSQIAATSGSFPFPVVGESSE 631

Query: 628 DKTSEESSKDASLT------VGQESLG-EGRYNGTSFLWKVMQELTGNARIVNPNEKTHP 680
             T E +  +  ++        QE L      N    LW VM ++TG  ++V P+ +  P
Sbjct: 632 AITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQMTGGGKVVRPSPEDDP 691

Query: 681 DRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715
           DR+LL+ KY+IFLDM ++QR+YR  +DKVE + ++
Sbjct: 692 DRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  834 bits (2155), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/698 (58%), Positives = 513/698 (73%), Gaps = 29/698 (4%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +Y+GVDVGTGSARAC+ID  GN++SLAEKPI+RE+L   +ITQSS+EIW+A+CYCV+TVV
Sbjct: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92

Query: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158
            +SGVD ER+ GIGFDATCSLV V++ +  ++ VGPDF N DQNIILWMDHRA++ET EI
Sbjct: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152

Query: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218
           NS+    LKYVGGQMS+EMEIPKIKWLKN++    F D  FFDL D+LT+KATG   RSF
Sbjct: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212

Query: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREK-----KNFLTA 273
            S+VCKQG LP+GVEGS+ GWS EFLN I L EL  NDF +LGGS++ K      NFL+A
Sbjct: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272

Query: 274 GECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFN 333
           G+ +  L  +AA  LGL +HCVV SG+IDAYAGWVGTVAA+ +  +  LA+ E  K   +
Sbjct: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332

Query: 334 GAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLIT 393
            A GRLAAVAGTSTCH+ LS++PIFV GVWGPYRDV+A GFW AEGGQSCTG LL H+++
Sbjct: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392

Query: 394 THPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIA 453
           THPA+T+L H++  AG+SKF+YLN  LE LV  RK RSV++LAKHLFFYGDYHGNRSPIA
Sbjct: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452

Query: 454 DPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCR 513
           D  MRA IIGQSMDNS++DLA+ YL ACEFI+QQTRQI+E+M KSGH I++IFMSGGQCR
Sbjct: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512

Query: 514 NSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFDYTREKRTLKGQKSSQ--T 571
           N LLMRLLADCTGLPI+IPRY+DAAVVFGSALLGA ASE ++    K  L+ +++S   +
Sbjct: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRASSLGS 572

Query: 572 KTERFND-SYSSIQKLSMEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQ----- 625
           K +         + KLS    +  + + +PH    +T S+     +Y  PI         
Sbjct: 573 KDQAIAGLGKGGLSKLSELQTDQPSPYTAPH----ATSSSHMGGGSY-FPIVGSDAAANL 627

Query: 626 -PLDKTSEESSKDASLT------VGQESLGE---GRYNGTSFLWKVMQELTGNARIVNPN 675
            P +  +E   ++  +T        QE+L E      NG   LWKVM ++TG  ++V PN
Sbjct: 628 SPGEAIAETEDEEEPVTFKSVKSTTQENLAEKTDTNSNGEE-LWKVMYDMTGGGKVVRPN 686

Query: 676 EKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSF 713
             T+PDR+LL+ KY+IFLDM  TQR+YR  +D+VE + 
Sbjct: 687 PDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVEANL 724

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  806 bits (2082), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/517 (72%), Positives = 434/517 (83%), Gaps = 2/517 (0%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +YVGVDVGTGSARACVID  GN+LSLAE+PI+R +L  N+ITQSS+EIWNA+CYCV+ VV
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158
            +SGVDP  + GIGFDATCSLVVV   N E++ VGPDFT+N QNIILWMDHRA++ETEEI
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218
           N++GDKCLKYVGGQMSVEMEIPKIKWLKNN+    F  CKFFDL DYLTFKATG E RS+
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECIS 278
           CS VCKQG LP+GVEGS  GWSKEFL  IGL EL  +DF +LGGS+ E   FL+AGECI 
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-TFLSAGECIG 273

Query: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGR 338
            L +++A +LGL+ HCVV SG+IDAYAGWVGTVAA+ +  +  L +++  K   + A GR
Sbjct: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333

Query: 339 LAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAF 398
           LAAVAGTSTCHI +SK+PIFV GVWGPYRDV+A GFW AEGGQSCTG LL H++TTHPA+
Sbjct: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393

Query: 399 TELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMR 458
            ELS +++ A VSKF+YLN  LE L ++RK  SV++LAKHLFFYGDYHGNRSPIADP+MR
Sbjct: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453

Query: 459 ACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLM 518
           A IIGQSMDNSI+DL++MYL ACEFI+QQTRQI+E M  SGHE+ AIFMSGGQCRN LLM
Sbjct: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513

Query: 519 RLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555
           RLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE F+
Sbjct: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 42/53 (79%)

Query: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710
           LW+VM  +TG  ++V P E+  PDR+LL+ KY+IFLDM  TQ+KYR++VD+V+
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 408/523 (78%), Gaps = 13/523 (2%)

Query: 34  DPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYC 93
           D +  +YVG+DVGTGS RACV+D  GNMLSL EK I RE+L  NFITQS+REIW A C+C
Sbjct: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70

Query: 94  VRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMK 153
           V+T +E+  VD   V GIGFDATCSLV +     +++ VGP+F N D N+ILWMDHRA+K
Sbjct: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130

Query: 154 ETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGK 213
           E  EIN++ DKCLKYVGG MSVEM+IPKIKWLKNN++  +F+ C+FF+L DYLTFKATGK
Sbjct: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190

Query: 214 ENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE--KKNFL 271
             RSFCS VCKQGFLP GVEGS  GWSKEFL+SIGL +L  N ++ LGG+L+   + NF 
Sbjct: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250

Query: 272 TAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKD 331
           ++G+C+ PL  +A  +LGL+E+CVV +GIIDAYAG +GT+AA  E        +   K D
Sbjct: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEG-------SHQIKND 303

Query: 332 ----FNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVL 387
                  AIGRLA+VAGTSTCH+LLSK+P+FV GVWGPYRDV+A G+W AEGGQ+CTG L
Sbjct: 304 SSIGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGEL 363

Query: 388 LDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHG 447
           L ++++ HPAF EL + + +A + KF+YLN +L+ L  K KV S + LAKH+FFYGDY G
Sbjct: 364 LSYVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRG 423

Query: 448 NRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFM 507
           NRSP ADP M A IIGQSM++++E+LAV YL+ACEFI+QQTRQI+E + K+G  ++ I+M
Sbjct: 424 NRSPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYM 483

Query: 508 SGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAA 550
           SGGQCRN LLM+LL+DCTGLPI++P+YVDAAVVFG+A+LGA A
Sbjct: 484 SGGQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%)

Query: 657 FLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710
            LW+ M  +T +  ++ PN+  HPDR LLD KYQIFLDM ETQRKYR+MVD ++
Sbjct: 542 MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/519 (61%), Positives = 398/519 (76%), Gaps = 4/519 (0%)

Query: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99
           Y+GVDVGTGS RACVI+  G +LSL  K I +E+L  N+ITQSSREIW  +C CV  V++
Sbjct: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63

Query: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159
           ES + P  V GIGFDATCSLVV+     +E+ VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123

Query: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219
           ++GDKCLKYVGG+MSVEME+PKIKWLKNNL  G+F +CKFFDL DYLT+KAT K+ RSF 
Sbjct: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183

Query: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKK---NFLTAGEC 276
           S VCKQG LP+GVEGSDIGWSKEF   I L EL+ ++F  +GGS+  ++   N  + GE 
Sbjct: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243

Query: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336
           +  L + +A +LGL   C+V SGIIDAYAGWVGTVAAK E  +  +   ++     + +I
Sbjct: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302

Query: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396
           G LA +AGTSTCHI LS  PIFV+G+WGPYRDVL+  FW AEGGQSCTG LL+H++TTHP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456
           A+ EL        V  FE+LN  L  L ++   RS+ISL KH F YGDYHGNRSPI+D +
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516
           MRA IIGQSMD SI+ LA+MYLSACEFISQQ+RQII  ++K+GH I  I+MSGGQ RN L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555
           LMRLLADCTGLP+VIPRY+DA+V+FGSA+LGA A + ++
Sbjct: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYN 521

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%)

Query: 648 GEGRYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707
           G   ++    LW  M +LT    ++NPN   HPDR+LL+ KY+IFLDM ETQRKYRR +D
Sbjct: 527 GNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586

Query: 708 KVEGSFSR 715
           ++E SF+ 
Sbjct: 587 EIEASFNE 594

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/517 (60%), Positives = 408/517 (78%), Gaps = 10/517 (1%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +Y+GVDVGTGS RAC+ID  G + S AE  I R++L ++ ITQSS+EIW AVC+CV+ VV
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158
            E G   ++V+GIGFDATCSLVVV       +AVGPDF +++Q+IILWMDHRA+KET+EI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218
           NS+ D+CLKYVGGQMS+EME+PKIKWLK ++   +F  C+F+DL DYLTFKATG++ RSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSL--REKKNFLTAGEC 276
           CS VCKQG +P+GVEGS +GWSK+FL +I L ELT ND+ +LGGS+     +NFLTAGE 
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETEN-YKKDFNGA 335
           I+PL+ +A  +L L++ C+V SGIIDAYAGW+GTV +       G  + E  ++     A
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-------GTVDLEQLFRVGMANA 299

Query: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395
           IGRLAAVAGTSTCHI+LSK+PIFV GVWGPY+D + +G+W  EGGQSCTG LL H++ TH
Sbjct: 300 IGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTH 359

Query: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455
           P++ EL  ++   G++KF+YLN  L  + ++   RSV+ LAKH+FFYGD HGNRSP+ADP
Sbjct: 360 PSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADP 419

Query: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515
           +M+  I+G SMD S+++LA  YL+ACEFI+QQ RQIIE M  +GHEI+AI+MSGGQCRNS
Sbjct: 420 SMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNS 479

Query: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552
           LLM+LLADC+GL ++IP Y+D+AVVFG+A+LGA+AS+
Sbjct: 480 LLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASK 516

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (65%)

Query: 653 NGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710
           N  + LW  M ++T     + P  K HPDRILLD KY+IFLDM + Q++YR +VD VE
Sbjct: 530 NTENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 401/516 (77%), Gaps = 2/516 (0%)

Query: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99
           ++GVDVGTGS RACVID+ G++L+L +KPI RE+L   FITQSS EIW+++C+CVR V+ 
Sbjct: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80

Query: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159
           ++ +   +V GIGFDATCSL VV     E +AVGP F+ NDQNII+WMDHRA +ET+EIN
Sbjct: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140

Query: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219
           S  D  LKYVGG+MS+EME+PKIKWLKN++    F+   FFDLPDYLTFKATG +NRS C
Sbjct: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200

Query: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECISP 279
           SAVCKQG LP+GVEGS  GWS+ FL++ GL EL +N+FER+GG     +NFL+AGE +S 
Sbjct: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260

Query: 280 LDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRL 339
           L K +  QLGLTE CVV SG+IDAYAG +GT+AA+ + + +   + +   +D   AIGRL
Sbjct: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318

Query: 340 AAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFT 399
           AAVAGTSTCHI LS  PIFV+GVWGPY+D+LA+ +W AEGGQSCTG LL H+ITTHPA+ 
Sbjct: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378

Query: 400 ELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRA 459
           EL   A  + +  FE LN+I+  L E++   +++ L K LF YGDYHGNRSPIADP MRA
Sbjct: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438

Query: 460 CIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMR 519
            IIGQSMD ++E LA++YL+ACEFI+ QTR II  M ++GH I +I+MSGGQCRN++LM 
Sbjct: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498

Query: 520 LLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555
           LLAD TGLP+VIP+Y+DAAVVFG+AL+GA A + F+
Sbjct: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%)

Query: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707
           LW  M ++TGN   + P    H  + LL+TKY+I++DM +TQ+KYR ++D
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/520 (60%), Positives = 397/520 (76%), Gaps = 8/520 (1%)

Query: 36  EAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVR 95
           EA +Y+GVDVGTGSARA ++   G  L+L E PIKR++L  +FITQSS EIW+AVC+CVR
Sbjct: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62

Query: 96  TVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKET 155
            VV +SGV+P  V+GIGFDATCSLV V A   + + VGP+F ++ QNIILWMDHRA +ET
Sbjct: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122

Query: 156 EEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKEN 215
           + IN++GD+CLKYVGGQMSVEME+PKIKWLK ++  G F  CKFFDLPDYLTF AT K+ 
Sbjct: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182

Query: 216 RSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGE 275
           RSFCSAVCKQG LP GV+GS+  WS EFL ++GLSEL   +F +LGG+   K  FLTAG+
Sbjct: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242

Query: 276 CISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGA 335
            +  L  +A+ Q GL+  C+V+SG+IDAYAGW+G+V AK + + K            + A
Sbjct: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHK--------SSGLDVA 294

Query: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395
           I RLA +AGTSTCHI+LSK P FV GVWGPYRDVL  G+W AEGGQSCTG LL H++ TH
Sbjct: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354

Query: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455
           PA  EL  +A    VS FEYL  +L+TL+ KR+VR+V+ L++  F YGD+HGNRSP+ADP
Sbjct: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414

Query: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515
           +MRA +IGQSMD SIE LAV YL+ACEFI+ QTRQI+E M+++GH +  ++MSGGQCRNS
Sbjct: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474

Query: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709
           LW +M  +T     V PN+ +  +R  +D KY IFLDMIE Q+ YR  +D+V
Sbjct: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/523 (58%), Positives = 402/523 (76%), Gaps = 12/523 (2%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +Y+GVDVGTGSARAC+ID +G++LS+ E  I R++L   +ITQS+ +IWN +C C+R ++
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 99  EESGVD--PERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETE 156
           +ES VD    +++GIGFDATCSLVV+++   +E+AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 157 EINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENR 216
           EINS+  KCLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT+KATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 217 SFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE----KKNFLT 272
           SFCSAVCKQG LP+GVEGS  GW++EFL +IGL +L +++F +LGG +++    K +F T
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 273 AGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDF 332
           AGE I  L  K++  +G++  C VSSGIIDAYAGW+GT+AA  +  ++ L    N++ + 
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQL---NNFQDNL 299

Query: 333 NGAI---GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLD 389
           NG I   GRLA VAGTSTCHI L+  PIFV GVWGPYRDVL   FW AEGGQSCTG LL 
Sbjct: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359

Query: 390 HLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNR 449
           H++ THPA+ EL  ++    +S FE LN  +  L  +R +   + L K+LFFYGD+HGNR
Sbjct: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419

Query: 450 SPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSG 509
           SP+AD  MR  IIG SMD+S+ DL  MYL ACEFI+QQTR I+++M KSG+ +++++MSG
Sbjct: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479

Query: 510 GQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552
           GQCRN LLM+L+++C GLP+VIP+ +D AVVFGSAL+GA ASE
Sbjct: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 34/51 (66%)

Query: 657 FLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707
            LW VM ++TG   +V+P + +     LL  KYQI+LDMI TQ++YR MV+
Sbjct: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/518 (59%), Positives = 394/518 (76%), Gaps = 9/518 (1%)

Query: 38  KFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTV 97
           + Y+GVDVGT S RACV+D  G +LSLA KPI R+++  N++TQSS EIW A+C+C+R +
Sbjct: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62

Query: 98  VEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEE 157
           + +S V  + + GIGFDATCSLVV+     + +AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122

Query: 158 INSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRS 217
           INS+G +CLKYVGG+MS+EM+IPKIKWLKNNL  G F  C+F+DLPD+LT++ATG + RS
Sbjct: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182

Query: 218 FCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLRE-KKNFLTAGEC 276
           FCS VCK G LP+GV+GS  GW ++    IGL+EL + +F +LGG +     NFL+AG+ 
Sbjct: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242

Query: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336
           +  L  +AA  LGLT  C+V+SG+IDAYAGWVGT+AA       G  E+E        A 
Sbjct: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDG-QESEL-------AS 294

Query: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396
            RLA VAGTSTCHI +SK P F+ GVWGPYRD L  G+W  EGGQSCTG LL H++ +HP
Sbjct: 295 SRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354

Query: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456
           A+  L  +A   G+SKF+++N  LE L E+R  +SV +L KHLFFYGDYHGNRSPIADPN
Sbjct: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414

Query: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516
           MRA IIGQSMD S++DLA+M L ACEFI+QQTRQI+E + +SGHEI +I+MSGGQCRN +
Sbjct: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474

Query: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDF 554
           L++LLA+CT LPIV+P+Y+DAAVVFGSALLG AASE +
Sbjct: 475 LIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 63.9 bits (154), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 38/57 (66%)

Query: 656 SFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGS 712
           S LW VM  LTG  +I+ P+     +  LLD KY+IFLDMIETQ++YR +V + E S
Sbjct: 540 SILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENS 596

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/514 (58%), Positives = 378/514 (73%), Gaps = 10/514 (1%)

Query: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98
           +Y+GVDVG+GS RACV+D  G MLS+A + I +E+ +   +TQSS EIW+AVCYCV++ +
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158
             S V+   + GIGFDATCSLVV++  +FE +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218
           N SGD CLKYVGGQMSVEMEIPKIKWLKN++    F+   F DLPDYLTF A+G   RS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECIS 278
           CSAVCKQGFLP GVEGS  GWS EFL  IGL E+++++F  LGG   E  NF  AG  +S
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241

Query: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKK--DFNGAI 336
            + +       +   C+V SGIIDAYAGW+GTVA+          E  N K+  D     
Sbjct: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASS-------TIEVPNNKEVVDIEECA 294

Query: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396
           GRLAAVAGTSTCHI+LSK  IFV GVWGPYRDVL   +W AEGGQS TG LL H+++ HP
Sbjct: 295 GRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHP 354

Query: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456
           +  ELS++     V KF +LN  +  L  K  + + + L K  F YGDYHGNRSPIADPN
Sbjct: 355 SANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPN 414

Query: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516
           MRA IIGQSMD S++DLA  YL+ACEFI+ QT+ II+ ++ +GH I AI+MSGGQCRN++
Sbjct: 415 MRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNI 474

Query: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAA 550
           LM+L+A+CTGLP++IP+Y+D+AVVFGSA+LGA A
Sbjct: 475 LMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMA 508

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 42/80 (52%), Gaps = 9/80 (11%)

Query: 637 DASLTVGQESLGEGRYN---------GTSFLWKVMQELTGNARIVNPNEKTHPDRILLDT 687
           D+++  G   LG   Y+         G   LW  M  +T +   V P  +   +R L++ 
Sbjct: 494 DSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFPATEDSIERKLINV 553

Query: 688 KYQIFLDMIETQRKYRRMVD 707
           K++IFLDM +TQ+ YR++V+
Sbjct: 554 KHKIFLDMAKTQQTYRQLVE 573

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/518 (57%), Positives = 371/518 (71%), Gaps = 9/518 (1%)

Query: 38  KFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTV 97
           ++YVGVDVGT  ARAC+ID+SG +L+  + PI R Q   + ITQSS EIW AVC  VR  
Sbjct: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67

Query: 98  VEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEE 157
           V ES V  + V GI FDATCSLVV+   +  E+AVGPDF++N QN+ILWMDHRA+ E  E
Sbjct: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127

Query: 158 INSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRS 217
           INS+G   L+YVGG+MSVEM++PKIKWL+ ++  G F  CKF+DLPD+LT++ATG E+RS
Sbjct: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187

Query: 218 FCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREK-KNFLTAGEC 276
           FCS VCK G +P GV+ S  GWS+EFL  IGL EL ++ F RLGG+L E    F +AGE 
Sbjct: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247

Query: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336
           +  L + AA  LGLT  CVV SG+IDAYAGWVGTV A P+ A +     E          
Sbjct: 248 VGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE--------LA 299

Query: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396
           GRLAAVAGTSTC I+LS+ P FV GVWGPYRDVLARG+W  EGGQSCTG LL H + THP
Sbjct: 300 GRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHP 359

Query: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456
           A+TEL   A   G++ F+Y+N  L+ L  +   RS+ +LAKH F YGDYHGNRSP+ADP+
Sbjct: 360 AYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPS 419

Query: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516
           MRA ++G SMD S +DLA+  L+A EFI+ Q R I++ M  +G  ++ +++SGGQ RN L
Sbjct: 420 MRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPL 479

Query: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDF 554
           L +LLAD    P+V PR+V AAVVFGSALL AAA E++
Sbjct: 480 LTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENY 517

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%)

Query: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710
           LW++M  LT    +V+P+    PD  LL+ KY++FL+M E Q+ YR++VD VE
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/514 (56%), Positives = 379/514 (73%), Gaps = 3/514 (0%)

Query: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99
           Y+GVDVGTGSARAC+ +++G +L++  K I +++L   FITQSS EIW+A+   ++ V++
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159
            S VDP  + GI FDATCSLVV    + E IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219
           S+ DK LKYVGG+MSVE E+PKIKWLK++L    F  C F DL D+LT+KATGK   SF 
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKK-NFLTAGECIS 278
           SAVCKQG LP GVEGS +GWSKEFL  IGL EL+ N+FE+LGGS+  K+ NFL  G+ + 
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGR 338
            +DKK A    L  HCVV +G+IDAY+GWVGTVA+     V   +  E  K    G++GR
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK--IEGSLGR 301

Query: 339 LAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAF 398
           +A V+GTSTCHI+LSK P+F+ GVWGPYRDVLA   WA EGGQS TG LLD++I THPA+
Sbjct: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361

Query: 399 TELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMR 458
            EL  + +    + F YL++ LE L   RK+ SV  L K++F YGDY+GNRSP+ADP M 
Sbjct: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421

Query: 459 ACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLM 518
             IIGQ+MD+SI DLA+ YL+ACEFI+ QTR II+ ++  GH I AI+MSGG C+N LLM
Sbjct: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481

Query: 519 RLLADCTGLPIVIPRYVDAAVVFGSALLGAAASE 552
            L+++C  LP+V+ +Y+D++VVFG+A+LG+ A++
Sbjct: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 651 RYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709
            Y+    LW  M+ +T    ++ P  +    R  L  KY+++LDMI+T  KYR+ +++V
Sbjct: 525 EYSLNDVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  202 bits (514), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 161/550 (29%), Positives = 252/550 (45%), Gaps = 102/550 (18%)

Query: 41  VGVDVGTGSARACVIDQSGN-MLSLAEKPIKREQLISNFITQSSREIW------NAVCYC 93
           +G+D+G+ SAR  + D   + +L++A++P+        +   SS++ W        +   
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVP-------YYHDSSKKSWKFWQKSTEIIKA 61

Query: 94  VRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTN-------NDQNIILW 146
           ++   +E  +    VR  G  ATCSL +             D TN       N+ N+I W
Sbjct: 62  LQNCFQELKITQYNVRSCGVSATCSLAIFQK----------DLTNGNLIPYPNEDNVIFW 111

Query: 147 MDHRAMKETEEINSSGDKC----LKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDL 202
           MD  A+ E E +N   +KC    L Y+GG+   EM IPK+K+  N       +    FDL
Sbjct: 112 MDSSAVDECEWLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDL 168

Query: 203 PDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGG 262
             Y+ ++       +      ++    +G +G   GWS  F N I   +L  N       
Sbjct: 169 HQYIAYELGRLYRWNTDELSARENINGIGNDGEASGWSSSFYNDI--MKLPSN------- 219

Query: 263 SLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGL 322
                   +T G  ++ L+   +        C      ID+YA W    +   E++    
Sbjct: 220 --------VTIG--LTGLNSNNSSSTTTVCSC------IDSYASWFAVSSPNLEAS---- 259

Query: 323 AETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIF---VHGVWGPYRDVLARG--FWAA 377
                           L  +AGTSTC++  S  P+    + GVWGP+  +L     +   
Sbjct: 260 ----------------LFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVY 301

Query: 378 EGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAK 437
             GQSCTG L++HL  +HPA  ++      +G   +E L   ++  +EK+  +S+  LAK
Sbjct: 302 TAGQSCTGKLIEHLFKSHPAARKIQR----SGEDIYEVLENSIQD-IEKKNRKSIHILAK 356

Query: 438 HLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVM-- 495
           H+FFYGDY GNR+P AD  MR   IG+S D SI +L   Y+S  EF+S QT+ II+    
Sbjct: 357 HMFFYGDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQG 416

Query: 496 LKSGHEINAIFMSGGQCRNSLLMRLLADCT-GLPIVIP-RYVDAAVVFGSALLGAAASED 553
             SG  I  + +SG Q +N  L+ L++    G+ I  P   +D   V G+ +LG +A+E 
Sbjct: 417 QNSGARIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEK 476

Query: 554 ---FDYTREK 560
               D  RE+
Sbjct: 477 KQIIDIIRER 486

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 19/25 (76%)

Query: 684 LLDTKYQIFLDMIETQRKYRRMVDK 708
           LL  KY+I LDM + Q++Y R+VD+
Sbjct: 513 LLSVKYRIHLDMAKQQQQYHRLVDE 537

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  198 bits (504), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 163/563 (28%), Positives = 256/563 (45%), Gaps = 76/563 (13%)

Query: 17  PAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGN-MLSLAEKPIKREQLI 75
           P   +  ETS+  I      A+  +G+DVG+ SAR  + +   + +L +A++P+   Q  
Sbjct: 10  PRKRTHNETSMLEIKMTKDSARIGIGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDS 69

Query: 76  SNF---ITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAV 132
           S       Q S EI  A+  C++ +     +    V+  G  ATCSL +     FE+   
Sbjct: 70  SRTSWKFWQRSTEIIKALQKCLQKL----KITEYNVKSCGVSATCSLAI-----FEKDKR 120

Query: 133 GPDFTN--NDQNIILWMDHRAMKETEEINSS-GDKCLKYVGGQMSVEMEIPKIKWLKNNL 189
                   N+ N+I WMD  A+ E +++N+    + L ++GG    EM IPK+K+  N  
Sbjct: 121 NGSLIPYPNEDNVIFWMDSSAIDECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEY 180

Query: 190 EAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGL 249
                +    FDL  Y+ ++ +     +    + ++    VGV+G   GWS  F  +I  
Sbjct: 181 SHNQDKQFHIFDLHQYIAYELSHLYQWNNEVLLKRENNKMVGVDGEASGWSPSFYENI-- 238

Query: 250 SELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVG 309
                         +    N +            A C+  +    +V S  ID+YA W  
Sbjct: 239 --------------MHLPSNVIIGS-------NGATCK-KIASSAIVRS-CIDSYASWFA 275

Query: 310 TVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSK-NPIFVHGVWGPYRD 368
             +   E++                    L  +AGTSTC++  +    I + GVWGP+  
Sbjct: 276 VSSPHLETS--------------------LFMIAGTSTCYMYGTPITDIKIPGVWGPFDS 315

Query: 369 VLARG--FWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEK 426
           +L     F     GQSCTG L++HL  THP   E+       G   ++ L + +   +EK
Sbjct: 316 ILDSNSHFSVYAAGQSCTGKLIEHLFVTHPCAKEILK----RGADIYQVLERTIHD-IEK 370

Query: 427 RKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQ 486
           +  +SV    K +FFYGDY GNR+P ADP M+   IG++ D SI +L   Y+   EF+S 
Sbjct: 371 QNGQSVHVFTKDIFFYGDYEGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSF 430

Query: 487 QTRQIIEVMLKS--GHEINAIFMSGGQCRNSLLMRLLADC-TGLPIVIPR-YVDAAVVFG 542
           QTR II+   +   G  I  + +SG Q +N  L+ L++    G+ I  P+  VD   V G
Sbjct: 431 QTRLIIDTFKRQNIGMCIQELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRG 490

Query: 543 SALLGAAASED---FDYTREKRT 562
           + LL  +A+E     D  RE+ T
Sbjct: 491 AYLLAKSANEGKQIIDVIRERDT 513

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  190 bits (483), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 161/543 (29%), Positives = 252/543 (46%), Gaps = 88/543 (16%)

Query: 41  VGVDVGTGSARACVIDQSGN-MLSLAEKPIKREQLISNF---ITQSSREIWNAVCYCVRT 96
           +G+D+G+ SAR  +     + +L +A++P+   Q  +       Q S EI  A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 97  VVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETE 156
           +     +    V+  G  ATCSL +    +  E A+ P    N+ N+I WMD  A  E E
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSE-ALIP--YPNENNVIFWMDSSATDECE 121

Query: 157 EINSSGDK-CLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKF--FDLPDYLTFKATGK 213
            +N+   K  L Y+GG+   EM IPK+K+  N  E    QD +F  FDL  Y+ ++    
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLN--EYSHRQDKRFHIFDLHQYIAYELGRL 179

Query: 214 ENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTA 273
              +    +  +    +G +G   GWS  F  +I                +    N +  
Sbjct: 180 YQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI----------------MNIPSNVI-- 221

Query: 274 GECISPLDKKAACQLGLTEHCVVSSGI----IDAYAGWVGTVAAKPESAVKGLAETENYK 329
              I P+        GL    V+S+ +    ID+YA W        E +           
Sbjct: 222 ---IGPV--------GLVSKKVISTTVVRSCIDSYASWFAVSPPFLERS----------- 259

Query: 330 KDFNGAIGRLAAVAGTSTCHILLSKNPIF---VHGVWGPYRDVL--ARGFWAAEGGQSCT 384
                    L  +AGTS+C+  +   P+    + GVWGP+ ++L     F     GQSCT
Sbjct: 260 ---------LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCT 308

Query: 385 GVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGD 444
           G L++HL  +HP   ++      +G   ++ L + +   +EK+K  S+  LAK +FFYGD
Sbjct: 309 GKLIEHLFESHPCARKILK----SGADIYQVLEQTIHG-IEKKKGLSIHILAKDMFFYGD 363

Query: 445 YHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVM--LKSGHEI 502
           Y GNR+P ADP M+   IG++ D SI +L   Y+S  EF+S QT+ II+     K+   I
Sbjct: 364 YEGNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRI 423

Query: 503 NAIFMSGGQCRNSLLMRLLADC-TGLPIVIPR-YVDAAVVFGSALLGAAASED---FDYT 557
             + +SG Q RN  L+ L++    G+ I  PR  VD   + G+ +L  +A+E     D  
Sbjct: 424 QELRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVI 483

Query: 558 REK 560
           RE+
Sbjct: 484 RER 486

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 684 LLDTKYQIFLDMIETQRKYRRMVDKVEGSFS 714
           LL  KY+I LDM + Q+ Y ++VD+V   FS
Sbjct: 513 LLCVKYRIHLDMAKQQKYYYKLVDEVISPFS 543

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  182 bits (462), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 155/567 (27%), Positives = 257/567 (45%), Gaps = 80/567 (14%)

Query: 41  VGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFI---------TQSSREIWNAVC 91
           +G+D+G+ S R  +     +++    K     Q IS +          TQS+ EI   + 
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVK-----QKISYYYHGDSALWEYTQSTDEIMKVIE 60

Query: 92  YCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRA 151
            C+  +     +D   ++  G  ATCS+ +    +           ++ QN+I WMD+ +
Sbjct: 61  RCLHDL----KIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSS 116

Query: 152 MKETEEINSSGDKCLK-YVGGQMSVEMEIPKIKWLKNNLEAGI-FQDCKF--FDLPDYLT 207
             E + +N+  +K L+ ++GG+   EM IPKI  L N L++    Q+      DL  YL 
Sbjct: 117 KTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLA 176

Query: 208 FKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREK 267
           ++   +   +F   +    F  +G +G   GWS +F                   +L+  
Sbjct: 177 YEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYID----------------TLKIP 220

Query: 268 KNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETEN 327
            N     E   PL+       G+   C      ID Y+ W+   +  PE +         
Sbjct: 221 SNITIGPE--PPLEDDFEYCKGIVASC------IDCYSSWLSLCSPTPEES--------- 263

Query: 328 YKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVL--ARGFWAAEGGQSCTG 385
                      L  V GTSTC++  +     + GVWGP+ D+L  +  +   EGGQSCTG
Sbjct: 264 -----------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTG 312

Query: 386 VLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDY 445
            L++HL+ THPA + ++       + K E   +I  + +E++  RS+    KH+FFYGD+
Sbjct: 313 KLIEHLLQTHPASSSIAKDDWPLLLEKIE--QEI--SAIEEQTGRSIHFKTKHMFFYGDF 368

Query: 446 HGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKS--GHEIN 503
            GNR+P ADP M    IG++ D S  +L + Y+   EF++ Q + +I +  K+    +I 
Sbjct: 369 QGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKIT 428

Query: 504 AIFMSGGQCRNSLLMRLLADC-TGLPIVIPRY-VDAAVVFGSALLGAAASEDFDYTREKR 561
            I + G Q +N  L+ L++    G  I +P+  V+ + V G+ LLG +A       +   
Sbjct: 429 EIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSAL----LNKSPL 484

Query: 562 TLKGQKSSQTKTERFNDSYSSIQKLSM 588
            L  +K  Q + + F    S  Q LSM
Sbjct: 485 DLIQEKDDQKQVDIFETPSSINQPLSM 511

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%)

Query: 674 PNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709
           P+    P  +LL+ KY+I LDM + Q  YR M++K+
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  179 bits (455), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 147/526 (27%), Positives = 241/526 (45%), Gaps = 73/526 (13%)

Query: 41  VGVDVGTGSARACVIDQSGN-MLSLAEKPIKREQLISNF---ITQSSREIWNAVCYCVRT 96
           +G+DVG+ SAR  V +   + +L +A++P+   Q  S       Q S EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 97  VVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETE 156
           +     +    V+  G  ATCSL +        + +      N+ N+I WMD  A+ E +
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVNECQ 121

Query: 157 EIN-SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKF--FDLPDYLTFKATGK 213
            +N     + L Y+GG+   EM +PK+K+  +  E    +D  F  FDL  Y+ ++ +  
Sbjct: 122 WLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLD--EYSHLRDKHFHIFDLHQYIAYELSRL 179

Query: 214 ENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTA 273
              +    + ++    +G +G   GWS  F  +I            L  ++      L A
Sbjct: 180 YEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------INLPSNVSIGTTSLVA 229

Query: 274 GECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFN 333
            + IS                 V    ID+YA W    +   E++               
Sbjct: 230 NKHIS---------------TTVVRSCIDSYASWFAVASPHLETS--------------- 259

Query: 334 GAIGRLAAVAGTSTCHIL-LSKNPIFVHGVWGPYRDVL-ARG-FWAAEGGQSCTGVLLDH 390
                L  +AGTS+C++   + +   + GVWGP+  +L  RG F     GQSCTG L++H
Sbjct: 260 -----LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEH 314

Query: 391 LITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRS 450
           L  +HP   ++       G   ++ L + +   +EK    S+  L K +FFYGDY GNR+
Sbjct: 315 LFESHPCARKILK----DGADIYQVLEQTIRD-IEKNNGLSIHILTKDMFFYGDYEGNRT 369

Query: 451 PIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVML--KSGHEINAIFMS 508
           P ADP ++   IG+S D S+ +L   Y+   EF+S QT+ II+      S   I  + +S
Sbjct: 370 PFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRIS 429

Query: 509 GGQCRNSLLMRLLADC-TGLPIVIPR-YVDAAVVFGSALLGAAASE 552
           G Q +N  L+ L++    G+ I+ P+  VD   + G+ +L  +A E
Sbjct: 430 GSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKE 475

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 20/28 (71%)

Query: 682 RILLDTKYQIFLDMIETQRKYRRMVDKV 709
           R LL  KY I LDM + Q++Y ++VD+V
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  177 bits (450), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 148/531 (27%), Positives = 237/531 (44%), Gaps = 78/531 (14%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEK--PIKREQLISNF-ITQSSREIWNAVCYCVRT 96
           +G+D+G+ S R  + + Q+  +++   K  P       +N+  TQSSREI  A+  C   
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCF-- 67

Query: 97  VVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETE 156
             +E  +D   ++  G  ATCSL +    +   I    D  + D+N++ WMD  A+KET+
Sbjct: 68  --QELNIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 157 EINS-SGDKCLKYVGGQMSVEMEIPKIKW----LKNNLEAGIFQDCKFFDLPDYLTFKAT 211
           E+N  +  +   ++GG    EM +PK++     LKN      F+     DL  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 212 GKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFL 271
            +    + +         +G +G   GWS  F  ++                L+   N +
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV----------------LQLPPNIV 224

Query: 272 TAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKD 331
                 S    K   ++         S  ID Y+ W   + +  +++             
Sbjct: 225 IGPTKHSQHSSKQGLKV---------SSCIDCYSNWFALLPSNLQNS------------- 262

Query: 332 FNGAIGRLAAVAGTSTCHILLSKNPIFVH---GVWGPYRDVLARG--FWAAEGGQSCTGV 386
                  L  V GTSTC++  S    F H   GVWGP+ ++  R   F   E GQSCTG 
Sbjct: 263 -------LFIVGGTSTCYLYASSE--FSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGK 313

Query: 387 LLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYH 446
           L++HL  THPA    SH+        F  +N  +E  VE+    S+    KH+FFYGD  
Sbjct: 314 LIEHLFKTHPA---SSHIDTRDWPHLFSQINDFIEK-VEQNTQDSIHMQTKHMFFYGDLD 369

Query: 447 GNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVM--LKSGHEINA 504
           GNR+P ADP+M    IG++ D S  +L   Y+S  EFI+ Q + ++ +   L    +I+ 
Sbjct: 370 GNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISN 429

Query: 505 IFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVV--FGSALLGAAASED 553
           +   G   +N  L+ LLA       +    +D A++  +GS L+G A++ D
Sbjct: 430 LQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTSD 480

 Score = 38.5 bits (88), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 674 PNEKTHPDRI-LLDTKYQIFLDMIETQRKYRRMVDKV 709
           P EKT    + LL+ KYQI+ +M E QRKYR+ V+ V
Sbjct: 496 PPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  177 bits (448), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 153/533 (28%), Positives = 230/533 (43%), Gaps = 96/533 (18%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99
           +G+D+G+   R    + ++   +++  + +   +      TQSS EI  A+  C  ++  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 100 ESGVDPERVRGIGFDATCSLVVV---SATNFEEIAVGPDFTN-NDQNIILWMDHRAMKET 155
              +D   V+  G  ATCSL V    S    +   V  D    NDQN++ WMD  A++E 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 156 EEINSSGDKCLKYVGGQMSVEMEIPKIKWL-----KNNLEAGIFQDCKFFDLPDYLTFKA 210
             IN        Y GG    EM +PK+        KNN       D + FDL  Y+ +  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN------SDFEVFDLHTYVAYDL 177

Query: 211 TGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNF 270
             +        + +     +G +G   GW  EF             +E+   +L+   N 
Sbjct: 178 ANRYGWDASFLINRPNHNGIGHDGEIKGWKDEF-------------YEK---TLKLPPNV 221

Query: 271 LTAGECI----SPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETE 326
                CI    SP+ K A+C              ID Y+ W    ++ PE +        
Sbjct: 222 RIGPLCINRRFSPV-KVASC--------------IDCYSSWFSMFSSTPERS-------- 258

Query: 327 NYKKDFNGAIGRLAAVAGTSTCHILLSKNPI-FVHGVWGPYRDVLARG---FWAA-EGGQ 381
                       L   AGTSTC++  +  P   + G+WGP+ D+L       W+  E GQ
Sbjct: 259 ------------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQ 306

Query: 382 SCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILET---LVEKRKVRSVISLAKH 438
           S TG L++HL  +HPA        N+        L   LET   L+E++   SV    KH
Sbjct: 307 STTGKLIEHLFESHPAAKPYLEDRNV--------LFNRLETEINLIEQQSAESVHFKTKH 358

Query: 439 LFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKS 498
           +F YG+  GNR+P  DP M    IG+S D S  DL + Y++  EF++ Q R I E +   
Sbjct: 359 MFNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL--- 415

Query: 499 GHEINAIFMSGGQCRNSLLMRLLADCT-GLPIVIP-RYVDAAVVFGSALLGAA 549
           G  IN I ++G Q +N+ L+ L++    G  + IP    D   V G+ LLG A
Sbjct: 416 GAPINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKA 468

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 7/71 (9%)

Query: 643 GQESLGEGRYNGTSFLWKVMQELTGNARI------VNPNEKTHPDRILLDTKYQIFLDMI 696
           G   LG+ ++ G + +  + QE  G + +      +  NE+    R L + KY+I+L+M 
Sbjct: 461 GAYLLGKAKHLGLNVVELITQENGGESPMKDIEVRIEKNEENKL-RALFEIKYKIYLNMA 519

Query: 697 ETQRKYRRMVD 707
           +TQR+YR MV+
Sbjct: 520 QTQRQYREMVN 530

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  169 bits (429), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 141/525 (26%), Positives = 237/525 (45%), Gaps = 70/525 (13%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99
           +G+D+G+ + R  + D ++  ++ +  KP+       N +TQSS +I +A+  C++ +  
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDL-- 68

Query: 100 ESGVDPERVRGIGFDATCSLVVVSAT--NFEEIAVGPDFTNNDQNIILWMDHRAMKETEE 157
               D + V   G  ATCSL V +    + + + +         N++ WMD  A  E E 
Sbjct: 69  --NPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 158 INSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRS 217
           +N +  +  +++GG    EM IPK+  +    EA      + FDL  Y+ ++   K    
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAE-GHKLEVFDLHSYIAYELAIKYGWD 185

Query: 218 FCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECI 277
               + K     +G +G   GW   F N          D  +L  +++           I
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFYN----------DVLKLPANVK-----------I 224

Query: 278 SPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIG 337
            P+          TE  V  +  ID Y+ W    ++ P ++                   
Sbjct: 225 GPIHALN------TESPVRVASCIDCYSNWFSMCSSSPNNS------------------- 259

Query: 338 RLAAVAGTSTCHILL-SKNPIFVHGVWGPYRDVL----ARGFWAAEGGQSCTGVLLDHLI 392
            L   AGTSTC++   ++N   + GVWGP+ ++L    A+ +   E GQS TG L++HL 
Sbjct: 260 -LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLF 318

Query: 393 TTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPI 452
            THPA    S    +     F  +   +E L E+    SV   +KH+F YG+  GNR+P 
Sbjct: 319 ETHPAARAYS----MDKSKLFSAIESAIEKL-EQDFGESVHFRSKHMFTYGELQGNRTPY 373

Query: 453 ADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQC 512
            D +M    IG++ D S +DL + Y++  EF++ Q + I E       EI  I ++G Q 
Sbjct: 374 CDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKA---EIKDIRIAGSQA 430

Query: 513 RNSLLMRLLADCTG-LPIVIP-RYVDAAVVFGSALLGAAASEDFD 555
           +N+ L+ L +     + + IP +  D   V G+ LLG AA ++ +
Sbjct: 431 KNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNIN 475

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 3/43 (6%)

Query: 667 GNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709
           G  ++ N N K    + LL+ KY+I+LDM +TQ +YR MVD V
Sbjct: 494 GPMKLGNHNTKL---KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  166 bits (419), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 147/530 (27%), Positives = 240/530 (45%), Gaps = 86/530 (16%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEKPIKREQL-ISNFITQSSREIWNAVCYCVRTVV 98
           VGVD+G+ S R  +   ++ ++L + E+P++      S   TQS+ EI  A+  C+    
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECL---- 68

Query: 99  EESGVDP--ERVRGIGFDATCSLVVVSATNFEEIAVGPDFT----NNDQNIILWMDHRAM 152
           +E G+ P    +   G  ATCS+ V +    +      D +    ++D+N++ WMD  A 
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVAS 128

Query: 153 KETEEINSSGDKCLKY-VGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKAT 211
           +  + ++      +K  + G    EM +PK+  L         +  + FDL  Y+ +   
Sbjct: 129 EACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDLA 185

Query: 212 GKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFL 271
            +      +   +     +G +G   GW +EF  ++                L+     L
Sbjct: 186 RRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------------LK-----L 224

Query: 272 TAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKD 331
            A   + P       ++G+       +  ID YA W G  + +PE +             
Sbjct: 225 PATVAVGPASTFKGQRVGV-------ASCIDCYASWFGVCSTQPEQS------------- 264

Query: 332 FNGAIGRLAAVAGTSTCHILLSK-NPIFVHGVWGPYRDVL----ARGFWAA-EGGQSCTG 385
                  L  VAGTSTC++  S  +   + G+WGP+ ++L    AR  W+  E GQS TG
Sbjct: 265 -------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEAR--WSVYEAGQSTTG 315

Query: 386 VLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVIS---LAKHLFFY 442
            LL+HL  THPA  + +             L K LE  +   +  S  S   LA+H+F Y
Sbjct: 316 RLLEHLFETHPAARDYA--------GDTGRLFKDLEDRIADMEADSGCSIHHLARHMFLY 367

Query: 443 GDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIE-VMLKSGHE 501
           G+  GNR+P ADP M    +G++ D S  +LA+ Y+   EF++ QTRQI+E     +   
Sbjct: 368 GELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAA 427

Query: 502 INAIFMSGGQCRNSLLMRLLADCTG-LPIVIP-RYVDAAVVFGSALLGAA 549
           I  + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG A
Sbjct: 428 IGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKA 477

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 682 RILLDTKYQIFLDMIETQRKYRRMVDKV 709
           R LL+ KY I LDM + Q++YR  +D V
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  162 bits (410), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 159/567 (28%), Positives = 249/567 (43%), Gaps = 97/567 (17%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEKPI------KREQLISNFITQSSREIWNAVCYC 93
           +G+D+G+ S R  +      ++L +  KP+       R  L     TQ S EI  A+  C
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWE--YTQDSAEILTAIKEC 65

Query: 94  VRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMK 153
                + + +    V+  G  ATCSLV+   +  +          + +N++ WMD  A +
Sbjct: 66  F----DMADLQKYDVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKE 118

Query: 154 ETEEINSSGDK-CLKYVGGQMSVEMEIPKI-KWLKN--NLEAGIFQDCKFFDLPDYLTFK 209
           ET  +N+   +  L ++GG    EM IPK+ ++LK+  +   G  Q  + FDL  Y+ +K
Sbjct: 119 ETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQ-WEVFDLHKYVAYK 177

Query: 210 ATGKENRSFCSAVCKQGFLP----VGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLR 265
                 + +C    +    P    +G +G   GWSK F + I                +R
Sbjct: 178 LA----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----------------VR 217

Query: 266 EKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAET 325
              N +T G C   ++ +        +  V+    ID Y+ W   + +  ++        
Sbjct: 218 LPPN-VTIG-CPKTIENE--------DSLVIVDSCIDCYSSWFSPLQSLNKNT------- 260

Query: 326 ENYKKDFNGAIGRLAAVAGTSTCHIL---LSKNPIFVHGVWGPYRDVLARGFWAAEGGQS 382
                        L  VAGTSTC+I      K    V G+WGP+ D+L       E G S
Sbjct: 261 -------------LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSS 307

Query: 383 CTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFY 442
           C+G L++HL T+HP+   L +++    +SK E    I ET    +   S+   A + F Y
Sbjct: 308 CSGKLIEHLFTSHPSAISL-NLSTGQLISKLEEEINIWET----QNATSIHFEACNNFLY 362

Query: 443 GDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEI 502
           GD  GNR+P  DP MR   IG+S D S  DL V Y+   E ++ QT+ +++   K  + I
Sbjct: 363 GDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKL-NSI 421

Query: 503 NAIFMSGGQCRNSLLMRL--LADCTGLPIVIPRYVDAAVVFGSALLGAAA---------- 550
           N +F+ G Q +N+ L++L  L +   L +V     D   V G+ LLG A           
Sbjct: 422 NELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYLGTSVDLVP 481

Query: 551 -SEDFDYTREKRTLKGQKSSQTKTERF 576
            SE  +Y   K T    K  QTK  + 
Sbjct: 482 VSEPREYISVKYTNDSDKIQQTKLYKL 508

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 643 GQESLGEGRYNGTSFLWKVMQELTG--NARIVNPNEKTHPDRI--LLDTKYQIFLDMIET 698
           G   LG+  Y GTS     + E     + +  N ++K    ++  LL TKY I L+M E 
Sbjct: 463 GAYLLGKAGYLGTSVDLVPVSEPREYISVKYTNDSDKIQQTKLYKLLLTKYIIHLEMAEQ 522

Query: 699 QRKYRRMVDK 708
           Q+++R+MV K
Sbjct: 523 QQRFRKMVSK 532

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  126 bits (316), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 127/499 (25%), Positives = 211/499 (42%), Gaps = 87/499 (17%)

Query: 41  VGVDVGTGSARACVIDQSGNMLSLAEK---PIKREQLISNFITQSSREIWNAVCYCVRTV 97
           +GVD+G+   R  + D   + L    K   P  R    +  ITQ + +I  AV     T+
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHG--NGIITQCTSDILTAVEKAFNTL 63

Query: 98  VEESGVDPERVRGIGFDATCSLVVVSAT--NFEEIAVGPDFTNNDQNIILWMDHRAMKET 155
                +    +  +G  ATCS+VV      N     +  D      +II WM   A++ET
Sbjct: 64  Y----IQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 156 EEINSSGDK-CLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQD--CKFFDLPDYLTFKATG 212
           E +N+  D+  L + GG+   EM IPK+  L       +++D      DL  +L +K + 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNK-----LYKDDGLTVLDLHIWLLWKISL 174

Query: 213 KENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLT 272
           K        V +     +G +G   GWSKEF   + L+++       +G +   KKN   
Sbjct: 175 KLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIF------IGNNAVIKKNEQF 228

Query: 273 AGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDF 332
              CI                        D YA W    +                    
Sbjct: 229 GDSCI------------------------DCYASWFQCWST------------------- 245

Query: 333 NGAIGR-LAAVAGTSTCHILLSK-NPIFVHGVWGPYRDVLAR--------GFWAAEGGQS 382
              + R L  VAGTSTC +  S     F+ G+WGP++D+L           +   E G S
Sbjct: 246 -AMLNRTLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGIS 304

Query: 383 CTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFY 442
            TGVLL+ L++THPA  +       + V+  E +   ++ L+E+   +S+  + K+ FF+
Sbjct: 305 RTGVLLEKLLSTHPAVKD-------SDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFH 356

Query: 443 GDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEI 502
            DY    S     +    I+ +  + +++DLA+ Y+   E ++ Q   +I    +    I
Sbjct: 357 EDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITI 416

Query: 503 NAIFMSGGQCRNSLLMRLL 521
           + + ++G Q +NS L+++L
Sbjct: 417 SKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 86.7 bits (213), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 125/534 (23%), Positives = 212/534 (39%), Gaps = 104/534 (19%)

Query: 41  VGVDVGTGSARACVID-QSGNMLSLAEKPIKREQLISNFITQSSREIWNAV--CYCVR-- 95
           +G+DVG+ S R  + + + G  +    K I +E L  +   +   ++W+     + +R  
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEMLYKH---EPDSKLWHYTQNAFVMRDS 57

Query: 96  --TVVEESGVDPERVRGIGFDATCSLVVVS----ATNFEEIAVGPDFTNNDQNIILWMDH 149
             T +EE  V+   V+  G  ATCS+V +     A +   + +  + TNN  +II W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 150 RAMKETEEINS---------SG--DKCLKYVGGQMSV--EMEIPKIKWLKNNLEAGIFQD 196
            A  E + +N+         SG  +K L  +G +     EM IPK+  L N ++ G ++ 
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 197 ---CKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELT 253
               + +DL  Y+      K + +      K     +G++G   GW   F     +  L 
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY----VWALP 233

Query: 254 KNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAA 313
           +  F                  CI P        +   + C      ID YA W  T A 
Sbjct: 234 ETSFPI----------------CIGPSKVINETSIVRPKSC------IDCYASWFSTDAC 271

Query: 314 KPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHIL-LSKNPIFVHG--------VWG 364
             +                      L   AGTSTC +  + ++ +   G         WG
Sbjct: 272 TKDDT--------------------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWG 311

Query: 365 PYRDVLARGFWAA-EGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETL 423
           P+ +VL +   ++ E G S TG+LL+ L   H      S   ++  V      N+I   +
Sbjct: 312 PFTNVLDKDKKSSFEIGFSETGILLEKLFNKHQITASWSVAESINYVE-----NQI--AI 364

Query: 424 VEKRKVRSVISLAKHLFFYGDYHGNRSPIA--DPNMRACIIGQSMDNSIEDLAVMYLSAC 481
            E++K  S I L   ++ +  Y     P     P+         + +S   L   Y++  
Sbjct: 365 YERKKSHS-IYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAIL 423

Query: 482 EFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLMRL---LADCTGLPIVIP 532
           E+++ Q   +I    K    IN + +SG Q +N  L+ L   + D T + I++P
Sbjct: 424 EYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLILFMHDGT-IDIIVP 476

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 106/451 (23%), Positives = 183/451 (40%), Gaps = 87/451 (19%)

Query: 144 ILWMDHRAMKETEEINSSGDKCLKYVGGQ------MSVEMEIPKIKWLKNN----LEAGI 193
           ILW D R +K  + +  S    ++ +  +       S      K+KWL NN    L+A  
Sbjct: 341 ILWNDTRNLKIIKHLQESTPNVVQKMLAKKTGLPLFSTYFSSSKLKWLLNNEPLVLKAYN 400

Query: 194 FQDCKFFDLPDYLTFKATGKENRSFCSAVC---KQGFLPVGVEGSDIGWSKEFLNSIGLS 250
             D  F  L  ++ +  T   N++F + V    + GF+ +      + +  E L+  GL 
Sbjct: 401 EGDLMFGTLDTWIIYNLT--PNKTFVTDVTNASRTGFMNI----ETLQYDNELLSFWGLD 454

Query: 251 ELTKNDFERLGGSL---------REKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGII 301
               N   ++  S          R  KNF+ A +  + L    A ++ + + C     I 
Sbjct: 455 PNLIN-LPKIVSSAEYYGDFKIPRFTKNFI-APDIWNELTNFQAVKIPI-QGC-----IG 506

Query: 302 DAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHG 361
           D  A  VG +A KP SA K    T  +   +N    +L +  G  T        P +   
Sbjct: 507 DQTASLVGQMAFKPGSA-KCTYGTGCFLL-YNTGKEKLTSENGALTT-------PAY--- 554

Query: 362 VWGP-YRDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKIL 420
            W P      ++  +A EG  +  G ++  L              NL  + K E++  + 
Sbjct: 555 -WFPNLSGEDSKPHFALEGSIAVGGAVVQWL------------RDNLRLIPKSEHVGPL- 600

Query: 421 ETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSA 480
                  +VR     +  + F   ++G  +P  DP+ RA I+G S   +   +A    +A
Sbjct: 601 -----ASRVRD----SGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAA 648

Query: 481 CEFISQQTRQIIEVM----LKSGHE---INAIFMSGGQCRNSLLMRLLADCTGLPIVIPR 533
            E +  Q R I++ M    ++ G+E   +  + + GG  ++  +M++ AD  G  I + R
Sbjct: 649 IEGVCFQVRAILKAMSGDKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR 708

Query: 534 YVDAAVVFGSALLGAAASEDFDYTR-EKRTL 563
              + +V  +A LGAA + +  Y   E R L
Sbjct: 709 ---SPIVECTA-LGAAIAANMAYKNVEDRVL 735

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 38.9 bits (89), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 16/130 (12%)

Query: 439 LFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQII------ 492
           + F   ++G  +P  DP+ RA I+G S   +   +A    +A E +  Q R I+      
Sbjct: 503 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMGSD 559

Query: 493 EVMLKSGHE---INAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAA 549
           EV   S +E   +  + + GG  +++ +M++ AD  G  I + R   + +V  +A LGAA
Sbjct: 560 EVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR---SPIVECTA-LGAA 615

Query: 550 ASEDFDYTRE 559
            + +  Y +E
Sbjct: 616 IAANMAYKKE 625

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 449 RSPIADPNMRACIIGQSMDNSIEDLA---VMYLSACEFISQQTRQIIEVMLKSGHEINAI 505
           +S + D N+  C++G  +D   ED +   V+   A ++  +Q     EV  KSG  +  +
Sbjct: 103 KSKVGDENLVICLVGNKIDLCDEDESKRVVLTKDAKDYADEQNLMFYEVSAKSGENVKEV 162

Query: 506 FMSGGQ 511
           F   G+
Sbjct: 163 FQVIGE 168

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 449 RSPIADPNMRACIIGQSMDNSIED---LAVMYLSACEFISQQTRQIIEVMLKSGHEINAI 505
           ++ +AD  +  C++G  +D   ED    +V    A ++  +Q     EV  K+G ++N +
Sbjct: 104 KNKVADDKLVICLVGNKLDLCQEDSGKRSVEISDAKQYADEQGLLFFEVSAKTGEKVNDV 163

Query: 506 FMSGGQ 511
           F S G+
Sbjct: 164 FKSIGE 169

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 44/199 (22%), Positives = 79/199 (39%), Gaps = 41/199 (20%)

Query: 351 LLSKN-PIFVHGVWGPY--RDVLARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANL 407
           L+SKN  +   G W PY   +  ++  +A EG  +  G ++  L      F     +  L
Sbjct: 397 LISKNGALTTFGYWFPYLENEEHSKPHFALEGSVAVAGAVVQWLRDNLRLFPRAEDVGPL 456

Query: 408 AGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMD 467
           A                      S +  +  + F   + G  +P  DPN RA I+G S  
Sbjct: 457 A----------------------SQVKDSGGVVFVPAFSGLFAPYWDPNARASIMGMSQY 494

Query: 468 NSIEDLAVMYLSACEFISQQTRQII-----EVMLKSGH--------EINAIFMSGGQCRN 514
            +   +A    +A E +  Q R I+     +V+ +SG          ++ + + GG  R+
Sbjct: 495 TTAAHIA---RAAVEGVCFQARAILKAMSSDVLQESGDFEDTYEKSALSTLAVDGGMSRS 551

Query: 515 SLLMRLLADCTGLPIVIPR 533
             +M++ A+  G  + + R
Sbjct: 552 DEVMQIQANILGPCVKVRR 570

>TPHA0E03000 Chr5 complement(629588..632389) [2802 bp, 933 aa] {ON}
           Anc_5.215 YLL003W
          Length = 933

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 23/135 (17%)

Query: 588 MEDRNSTNGFVSPHNLQLSTPSAPAKINNYSLPICTQQPLDKTSEE-----SSKDASLTV 642
           ME+ +ST+  ++ + +Q     A   +++ S+   T   L+K  EE     S  D+ LT 
Sbjct: 1   MENEDSTDLLLNDNYIQQKVNKAEDLLSDASVRATTNSLLNKDLEELLRRVSISDSKLTQ 60

Query: 643 GQESLGEGRYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKY---QIF------- 692
            Q+       NG+  L+++ + L  N +  N N+   P   +LDT Y   Q+F       
Sbjct: 61  KQDV------NGS--LFEIHKSLDPNFKFTNENQDDRPLNSILDTIYNRIQVFLIRNKMS 112

Query: 693 LDMIETQRKYRRMVD 707
           LD ++  +KY   ++
Sbjct: 113 LDFLKIFKKYVHFIE 127

>YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}
           GUT1Glycerol kinase, converts glycerol to
           glycerol-3-phosphate; glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p; derepression of
           expression on non-fermentable carbon sources is mediated
           by Opi1p and Rsf1p
          Length = 709

 Score = 31.6 bits (70), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 31/149 (20%), Positives = 60/149 (40%), Gaps = 25/149 (16%)

Query: 429 VRSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQT 488
           + S +  +  + F   + G  +P  DP+ RA I+G S   +   +A    +A E +  Q 
Sbjct: 485 IASTVPDSGGVVFVPAFSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQA 541

Query: 489 RQIIEVMLKSGH---------------------EINAIFMSGGQCRNSLLMRLLADCTGL 527
           R I++ M                           ++ + + GG  R++ +M++ AD  G 
Sbjct: 542 RAILKAMSSDAFGEGSKDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGP 601

Query: 528 PIVIPRYVDA-AVVFGSALLGAAASEDFD 555
            + + R   A     G+A+    A +D +
Sbjct: 602 CVKVRRSPTAECTALGAAIAANMAFKDVN 630

>Skud_2.297 Chr2 complement(541317..543398) [2082 bp, 693 aa] {ON}
           YBR169C (REAL)
          Length = 693

 Score = 31.6 bits (70), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 52/129 (40%), Gaps = 15/129 (11%)

Query: 500 HEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAAS-------- 551
           ++++ + + GG  R  +L + ++D  G P+      D A+  G+A + A  S        
Sbjct: 333 NDVDFVEIVGGTTRIPVLKKSISDAFGKPLSSTLNQDEAIAKGAAFICAIHSPTLRVRPF 392

Query: 552 --EDFDYTREKRTLKGQKSSQTKTERF--NDSYSSIQKLSME---DRNSTNGFVSPHNLQ 604
             ED D      T   Q   +   E F  N SY S + +++    D      +  P  L 
Sbjct: 393 KFEDIDSYSVSYTWDKQAEDEDHLEVFPANSSYPSTKLITLHRTGDFRMEARYTDPSKLP 452

Query: 605 LSTPSAPAK 613
             TP+  AK
Sbjct: 453 RGTPATIAK 461

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,480,864
Number of extensions: 3217141
Number of successful extensions: 9493
Number of sequences better than 10.0: 48
Number of HSP's gapped: 9753
Number of HSP's successfully gapped: 76
Length of query: 715
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 598
Effective length of database: 40,065,477
Effective search space: 23959155246
Effective search space used: 23959155246
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)