Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR108W (TRS85)8.255ON69869836940.0
Smik_4.3548.255ON69869832910.0
Skud_4.3698.255ON69869732650.0
Suva_2.2688.255ON69569732470.0
NCAS0B038808.255ON70670423640.0
NDAI0J014108.255ON71669623020.0
ZYRO0C01826g8.255ON69969522780.0
CAGL0B01705g8.255ON67267322490.0
TDEL0F038208.255ON68768522230.0
Kpol_392.118.255ON67567721690.0
KAFR0B055708.255ON66968620940.0
TPHA0B032608.255ON71471520020.0
KLTH0G13860g8.255ON70873318720.0
Kwal_56.235838.255ON70072318600.0
SAKL0H17226g8.255ON71974418250.0
KNAG0H032708.255ON64871116660.0
TBLA0E043808.255ON88963715350.0
Ecym_43168.255ON62367212791e-168
AGR096C8.255ON62368812581e-165
KLLA0F18953g8.255ON64767911781e-152
KAFR0A063804.173ON187761762.0
NDAI0E010108.709ON57353707.5
TBLA0A088704.173ON186761717.8
NDAI0D03540na 1ON110729707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR108W
         (698 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...  1427   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...  1272   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...  1262   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...  1255   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   915   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   891   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   882   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   870   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   860   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   840   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   811   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   775   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   725   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   721   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   707   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   646   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   595   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   497   e-168
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   489   e-165
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   458   e-152
KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa]...    34   2.0  
NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {O...    32   7.5  
TBLA0A08870 Chr1 complement(2174037..2179640) [5604 bp, 1867 aa]...    32   7.8  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    32   7.9  

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score = 1427 bits (3694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/698 (98%), Positives = 687/698 (98%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKC           FVESILLALWKDSFIY
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
           DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600
           AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600

Query: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660
           YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH
Sbjct: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG 698
           GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG
Sbjct: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG 698

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1272 bits (3291), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 616/698 (88%), Positives = 647/698 (92%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNLLFHLDNSKETVPPEIAKRI+SNAIAPVITVTSTPLFDKHIQE YKVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVGQ EH+V D + S +S  K+KNLEVPNL KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQRDSTQSQYIRFTRPL DLIETRD NDMLFNYHSLEVFLDNYLKLVA NTDEMVPH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           NTENFP+FMNTNEMLPVFLLCYND+SQEEFEKC           FVES+LL+LWKDSFI 
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
             NS IQLHQPVMSSLEEILFFLQAPTQT+LSL LINSIYDMLDYLVYDLMIPFMKRKVS
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP NGNH HNSLT D+QGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           PLIE+ALATYENCS+IQR K ++S+S +  EPVRSYETRCMILASELFLSLS+ WTSTPY
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600
           AIQYLETILDECKLGPC QIM+WERLSDCY+LRVDPRIKHRVGAMKK  +DTEDLRG   
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600

Query: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660
            STDHFTD+DILSEGLTR+RKAAFFRLIAA+KWAEQKQWRQVSWCLKDIES YS+IKFL+
Sbjct: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660

Query: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG 698
           G+GLILSKL NQLNLKD++SAP P+EKN T TSVSFIG
Sbjct: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG 698

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1262 bits (3265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/697 (87%), Positives = 642/697 (92%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNLLFHLDNS+E VPPEIAKRI+SNAIAPVITVTSTPLFDKHIQETY VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVG +EHEV D S S +S+ KN+NL VPN  KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQRDSTQSQYIRFTRPLGDLIETRD NDMLFNYHSLEV+LDNYLKLV  NT+E  PH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           NTENFPIFMNTNEMLPVFL+CYND+SQEEFEKC           FVESI L LWK+SFI 
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
           DENS I+LHQPVMSSLEEILFFLQAPTQTTLSL LINSIYD+LDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP NG+HQHNSLTRD QGNEYF+SSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           PLIERALATYE CS+IQR KGKE +S  VTEPVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600
           AIQYLETILDECKLGPCSQIM+WERLSDCYNLRVDPRIKHRVG MKK  K+TEDLR   +
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600

Query: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660
           + TDHF +EDILSEGLTRRRKAAFFRLIAAKKWAEQK WRQVSWCLKDIESTYSEIKFLH
Sbjct: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFI 697
            N  ILSKLK+QLNLKD+DSAP P+EKN T TS++FI
Sbjct: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFI 697

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 606/697 (86%), Positives = 639/697 (91%), Gaps = 3/697 (0%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNLLFHLD+S+ETVPPEIAKRI+SNAIAPVITVTSTPLFDKHIQE Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE K  Q E    +AS S +S  KN+NL VP+  K+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQ---NASPSIESSSKNQNLGVPSALKRGSRSRSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQRDSTQSQY+RFTRPLGDLIETRD NDMLFNYHSLEVFLDNYLKLVA NTDE VPH+
Sbjct: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           NTE+FPIFMNTNEMLPVFLLCYND+SQEEFEKC           FVESILL LWKDSF+ 
Sbjct: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVD 297

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
            ENS IQLHQPVMSSLEEILFFL+APTQT LSL LINSIYDMLDYLVYDLMIPFMKRK+S
Sbjct: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNK PVNGNHQHNSLT+D+QGNEYFASSSSEFLMRKL
Sbjct: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN
Sbjct: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           PLIERALATYENCSR+QR   KE  S  V EPVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600
           AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPR+KH+VG MKK  K+TEDLR + +
Sbjct: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597

Query: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660
           Y TDHFT+EDILSEGLTRRRKAAFFRL+AAKKWAEQKQWRQVSWCLKDIE+TYS+I FLH
Sbjct: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657

Query: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFI 697
           GNGLILS LKNQLN KDVDSAP P+EKN T+TS+++I
Sbjct: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYI 694

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/704 (64%), Positives = 544/704 (77%), Gaps = 26/704 (3%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M FSYEHYMNLLFHLD  KETVP EIAKRI+SNAI+PVI VTST   D HI ETY +DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFF GCVSDRDQANE +  Q +     +S++T ++P    L  P +  +G RSRSN
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKI---SSNNTLTLPTTSPL--PKVRTRG-RSRSN 114

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQRDSTQSQYIRFT+PLGD+I T++ANDMLF+YHSLE++L NYL L+  NTD+  P+ 
Sbjct: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           +T NFPIFMNTN+MLPV LLCY+D   E+FE C           FVE I L LWKDS+  
Sbjct: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPS 294

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
           D    + LHQPVMSSLEE+++FL  P + TL   LI SIY++LD LVY+LMIPFMKRK++
Sbjct: 295 DPQ--VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FW+ETILQPRKSLF+GAKF KKFM K  +   HQ N LT+D+QGNEYF S+SSEFLMRKL
Sbjct: 353 FWDETILQPRKSLFHGAKFLKKFMTKTALT--HQENLLTKDAQGNEYFTSASSEFLMRKL 410

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ+IVTVKM+KNDIN
Sbjct: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           PLIE+AL+TYENC+ +     K +    +  PVRSYETRCMILASELFLSLS+TWTSTPY
Sbjct: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDA----KDTE-DL 595
           AI YLETIL ECKLG CSQIM+WERLSDCY LRVDPRIKH+      +     K +E D+
Sbjct: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590

Query: 596 RG---------EHKYSTD--HFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSW 644
           +G         +   S D  + TD+DI+S+G TR+RKAAFFRL+AAKKWAEQK+WRQVSW
Sbjct: 591 QGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650

Query: 645 CLKDIESTYSEIKFLHGNGLILSKLKNQLNLKDVDSAPRPSEKN 688
           CL+ I+ TYS+I     + LIL K++N+L   + ++    +EKN
Sbjct: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/696 (64%), Positives = 537/696 (77%), Gaps = 28/696 (4%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNLLFHLD++KE+VPPEIAKRI+SNAIAPVITVTSTP  D HIQETY +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVC---DASDSTDSIPKNKNLEVPNLSKKGSRS 117
           YMLLR+FGGCVSDRDQANE  VG+ E +V    + S+   S+      + P L  +  RS
Sbjct: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119

Query: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMV 177
           RSNSLFQRDSTQSQYIRFT+P+ D++  + +NDMLF+YHSLE++L+ YL+L+A NT+   
Sbjct: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179

Query: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           P+ LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239

Query: 238 LNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDS 297
           LN  T NFPIFMNTN+MLP+FLLCY+ + QE+FE C           FVES++L LW + 
Sbjct: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299

Query: 298 FIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKR 357
             Y+ +  + LHQP+MSSLEE+++FLQ P    LS++LINSIY++LD L+YDLM+PFMKR
Sbjct: 300 --YEIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKR 357

Query: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLM 417
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N   Q N LT+DS+GNEYFA SS+E LM
Sbjct: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415

Query: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQSIVTVKMIKN
Sbjct: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475

Query: 478 DINPLIERALATYENC--SRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTW 535
           DINPLIERAL TYENC  + IQ    K      V EP+RSYETRCMIL SELFLSLS+TW
Sbjct: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSV-EPLRSYETRCMILLSELFLSLSDTW 534

Query: 536 TSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAM---------- 585
           TSTPYAI YLETIL ECKLGPCSQI +WERLSDCY LR+DPRI++++             
Sbjct: 535 TSTPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTT 594

Query: 586 ---KKDAKDTED----LRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQ 638
              K  A  + D    ++ E    +   + ++ILS+G TRRRK+AFFRLIAAKKWAEQKQ
Sbjct: 595 TADKVVATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQ 654

Query: 639 WRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674
           WRQV+WCLKD+ES Y        + LI++KL+N L+
Sbjct: 655 WRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/695 (62%), Positives = 533/695 (76%), Gaps = 36/695 (5%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M  SYE+YMNLLFHLD+ +ETVPP+IA+RI+SNA++PVITV+STP  D+HI++TY +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHE---VCDASDSTDSIPKNK---NLEVPNLSKKG 114
           YM LRFFG CVSDRDQANE +  + + E   V +     D++ +N    +L+VP+ S   
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 115 S-------------RSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVF 161
                         R RSNSLFQRD TQSQY+RFTRP+ DLIE+ D+NDMLF+YHSLEVF
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 162 LDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221
           L+N L+LV   TD+  P  LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 222 GEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXX 281
           G+ YE+ARDLL+ FKNLNH  ENFPIFM+T ++LPVFLLCYND+S++E   C        
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 282 XXXFVESILLALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYD 341
              FVES+LL LWK S  Y ++  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 301 KQLFVESLLLPLWKRS--YSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358

Query: 342 MLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNG--NHQHNSLT 399
           +L+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN  NG  NHQ  SL 
Sbjct: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNS-NGSNNHQPISLG 417

Query: 400 RDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459
           +D  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477

Query: 460 VSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETR 519
           VS+LMGAQ+IVTVKMIKNDI+PLI+RAL TYENC+  +   G+E     +  PVRSYETR
Sbjct: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEE-----LYVPVRSYETR 532

Query: 520 CMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIK 579
           CM LASELFLSLS+TWTSTPYA+  LETIL EC+LGPCS+IM+WERLSDCY  R+DPRI+
Sbjct: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592

Query: 580 HRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQW 639
           H+  A    A   E        + D  ++E+I++ GLTR+RKAAFFRLIAA KW EQKQW
Sbjct: 593 HKTSAQGAKAMTDE-------LAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645

Query: 640 RQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674
           +Q  WCLK+IE  Y+ + F++   LIL++LK Q+N
Sbjct: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  870 bits (2249), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/673 (62%), Positives = 522/673 (77%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           MVFSYEHYMNL++HLD++ ETVP +IAKR++SNA+APVITVTST L D+HI+ETY +DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE K+G    +V +     +    N  L VP  ++   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTN-GLTVPRQTR--VRSNSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SL+QRD+TQSQY+RFT+PL DLI T+DANDMLF+YHSLEV+L  YL +V       +PH+
Sbjct: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
           N  +FP F+NTN++LPVFLLCYN D++ EFE+C           FVESI+L LW   F  
Sbjct: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFT- 296

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
            +N V+ LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 297 -DNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEETIL PRKSLF+GAKFFKKFMNK+      Q NSL +++ G+ Y +S+S EFLMRKL
Sbjct: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ+IVT KM+KN+IN
Sbjct: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474

Query: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540
           P IERAL  YE C+       K  +S D++ PVRSYETRCM LASELFLSLS+TWTSTP+
Sbjct: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534

Query: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600
           AI YLETIL+ECKLGP S+IM+WERLSDCY +R+DPRIKHR+G ++   K  E++  +  
Sbjct: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592

Query: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660
            + D FT EDILS+GLTR RKAA F+LIAA+KW EQKQWR++SWCL D+ESTYS++K  +
Sbjct: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652

Query: 661 GNGLILSKLKNQL 673
              L+ ++L+N+L
Sbjct: 653 KENLLYTRLRNEL 665

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/685 (61%), Positives = 521/685 (76%), Gaps = 27/685 (3%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62
            SYE+YMNLL HLD+  + VP +IAKRI+SNAI+PVI VTSTP  D+HIQET+ +DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122
           LLRFFG CV DRDQA+E             S S D   +  +     ++   SR RSNSL
Sbjct: 64  LLRFFGDCVGDRDQAHECTSA--------GSPSGDDRAEKSSSSTLAVASGPSRKRSNSL 115

Query: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLL 182
           FQRD+TQSQYIRFTRPL DL+E+ D NDMLF+YH+LE FL+N L L+  +T++  PH LL
Sbjct: 116 FQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLL 175

Query: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242
           KKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T
Sbjct: 176 KKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTT 235

Query: 243 ENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYDE 302
           +NFP+F+NTN++LPVFLLCYN DS+E++E C           FVE ILL LWKD+  Y  
Sbjct: 236 KNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDN--YKT 293

Query: 303 NSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFW 362
            + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+SFW
Sbjct: 294 ATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353

Query: 363 EETILQPRKSLFNGAKFFKKFMNKNPVNGN-HQHNSLTRDSQGNEYFASSSSEFLMRKLA 421
           EETILQPR+SLF+G+KF K+FM+K     N HQ  S+ +D+ G EYF SSS+EFLMRKLA
Sbjct: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481
           DWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ+IVT KM+K DI+P
Sbjct: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473

Query: 482 LIERALATYENCS--RIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTP 539
           LI+RA+ TYENC+    Q    K+SNS+    PVRSYETRCM LASELFLSLS+TWTSTP
Sbjct: 474 LIQRAVETYENCALYDTQLSGSKKSNSM---APVRSYETRCMFLASELFLSLSDTWTSTP 530

Query: 540 YAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRV--GAMKKDAK--DTEDL 595
           YA++ LETIL EC+LGPCSQIM+WERLS+CY  R+D RI+H+V  GAM  + K  + +D 
Sbjct: 531 YALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDS 590

Query: 596 RGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSE 655
             EH       T  DI++ GLTR RKAAFF+LIAA KWAEQKQWRQ SWCLKD E  Y+ 
Sbjct: 591 EKEH-------THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAG 643

Query: 656 IKFLHGNGLILSKLKNQLNLKDVDS 680
           I+F++   L L+KLK  L   ++DS
Sbjct: 644 IEFVNRKDLALAKLKETLKNVEIDS 668

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  840 bits (2169), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/677 (61%), Positives = 521/677 (76%), Gaps = 21/677 (3%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62
           FSYE+YMNL++HLD   E VP +I+KRI+SNAIAPVITV ST   D+H+Q++Y +DSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRFFGGCVSDRDQANE----AKVGQHEHEVCDASDSTDSIPKNKN-LEVPNLSKKGSRS 117
           L+R+FGGC+SDRDQANE    A V     E    +D      +N N LE+P  S++ SRS
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQE--GVNDQIIEEQRNSNTLELPK-SERYSRS 122

Query: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMV 177
           RSNSLFQRDSTQS YIRFT+P+ DLI +RD++DMLF+YHSLEV+L+  L L+  NT++  
Sbjct: 123 RSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDET 182

Query: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
            H  LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN
Sbjct: 183 DHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKN 242

Query: 238 LNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDS 297
            N+  E FP FM+TN++L VFLLCY+ DS+E+ E C           F ES++L LW  S
Sbjct: 243 QNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKS 302

Query: 298 FIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKR 357
             + E+  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+R
Sbjct: 303 --HSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQR 360

Query: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLM 417
           K+SFWEETILQPRKSLF+G K F+KFMN++     +Q+N++ +DS+GNEYF SSS EFL+
Sbjct: 361 KISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420

Query: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477
           RKLADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKN
Sbjct: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480

Query: 478 DINPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTS 537
           D+NPLIER+L TYE CS I      E++ L ++EPVRSYETRCM+L SELFLSL++TWTS
Sbjct: 481 DVNPLIERSLDTYEQCS-ILAQNSLENDEL-LSEPVRSYETRCMLLTSELFLSLNDTWTS 538

Query: 538 TPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRG 597
           TPYA+  LETIL ECKLG CSQIM+WERLSDCYN+R DPRI+HRV  + K     E+  G
Sbjct: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEG 594

Query: 598 EHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIK 657
             +  TD     DI+S+GL R+RKAAFFRL+AAKKWAEQKQWRQVSWCL+D+E  Y ++ 
Sbjct: 595 GQQLQTD-----DIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLS 649

Query: 658 FLHGNGLILSKLKNQLN 674
           F     LI  KLK++LN
Sbjct: 650 FSKRPELIYQKLKDELN 666

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  811 bits (2094), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/686 (60%), Positives = 514/686 (74%), Gaps = 29/686 (4%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62
           FSYEHYMNLLFHL+ S E +P EIA+RI+S+AIAPVITVTSTP  DKHIQ+TY +DSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122
           LLRFFGGCVSDRDQA+E+K                  P + +      + +  RSRSNSL
Sbjct: 64  LLRFFGGCVSDRDQASESKANA---------------PHSSSSLTTTKTTRA-RSRSNSL 107

Query: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLL 182
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LL
Sbjct: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167

Query: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227

Query: 243 ENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYDE 302
           + FPI++NT +MLPVFLLCYN DS EE ++C           FVESI L LWK+S  Y  
Sbjct: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNS--YQT 285

Query: 303 NSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFW 362
              I+LHQPVMSSL+E+++FLQ+  Q TL + L N+ YDML+ LVY L+IPFM+RK++FW
Sbjct: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345

Query: 363 EETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLAD 422
           EET+LQP+KS+F+G+KF KK M++   + + Q N LT+D  GNEYFASSS E L+RKLAD
Sbjct: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405

Query: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 482
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ+IVTVKM+KNDI+PL
Sbjct: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465

Query: 483 IERALATYENC------SRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWT 536
           I+RAL  Y+ C      S  + G   ES SL   EPV SYETRC+IL+SELFLSLS+TWT
Sbjct: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSL---EPVLSYETRCLILSSELFLSLSDTWT 522

Query: 537 STPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLR 596
           STPYAI YLE+IL+E +LGPCS+IM+WERLSDCY+LRVDPRIK +V  ++K     E   
Sbjct: 523 STPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPAD 582

Query: 597 GEHKY--STDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYS 654
            EH+   S D     +I+S+GLTR+RKAAFFRL+AAK WAEQ QW+QV WCL +I   YS
Sbjct: 583 NEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYS 642

Query: 655 EIKFLHGNGLILSKLKNQLNLKDVDS 680
            +  ++ + LIL++L+ + N+   DS
Sbjct: 643 RVGLVNRDDLILTRLREEYNIAVSDS 668

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 396/715 (55%), Positives = 488/715 (68%), Gaps = 49/715 (6%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M F+YE+YMNL+FHLD   E VP +I+KRI+SNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFGGCVSDRDQANE------------------------AKVGQHEHEVCD---AS 93
           Y LLR+FGGC+SDRDQ+NE                         KV  +E E  +    S
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 94  D------STDSIPKNKNLEVP----NLSKKGS-----RSRSNSLFQRDSTQSQYIRFTRP 138
           D      + D    N  L+V     NL  K S     RSRSNSLFQRDSTQSQ+IRFTRP
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 139 LGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISST 198
           + DL+ +    DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 199 NNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVF 258
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFPIFM+TN++LPVF
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 259 LLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYDENSVIQLHQPVMSSLEE 318
           +LCYN  S EE EK            F E I + LW     Y ++  ++LHQP MSSL+E
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKR--YSDDITVKLHQPAMSSLDE 358

Query: 319 ILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK 378
           +L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G K
Sbjct: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418

Query: 379 FFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 438
            F+KFM +  +    Q N   +D+QGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478

Query: 439 SLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQR 498
           SL++D++ +PKYLASC+EWCAV +LMGAQ+IVT KMIKND+NPLIER+L  Y NC+ +  
Sbjct: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLN 538

Query: 499 GKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCS 558
              +   S D TEPVRSYETRCM++ SELFLSLS+TWTSTPYA+  LETIL ECKLG CS
Sbjct: 539 SIAESEESPD-TEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597

Query: 559 QIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTR 618
           QIM+WERLSDCYNLR DPR+KH++    +    T  +    +          I+ +GLTR
Sbjct: 598 QIMIWERLSDCYNLRTDPRVKHKL----RSNISTSSVSEVSEEEIKKQDVSSIVLKGLTR 653

Query: 619 RRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQL 673
           +RKA+FFRL+AAKKWAEQ QWRQVSWCL DI   Y +  F     LI  KLK  L
Sbjct: 654 QRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/733 (51%), Positives = 486/733 (66%), Gaps = 76/733 (10%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++I+S+A++PV+TVTST   D+HIQE+Y VDSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLR+FG CVSDRDQA          E+   S       KN+N           R+RSN
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGP------ELGTESG------KNRN-----------RARSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV ANT    PH 
Sbjct: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
            T +FP F+N N++LPVFLLCY +DS+E+FE C           FVES+LL  W  +   
Sbjct: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
             +    LHQP+MSSLEE ++ +   +  TL L+LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FW+E+ILQPRKS+F  +KFF+K ++K P       +S T   QG  YFA++S+EF++RKL
Sbjct: 336 FWDESILQPRKSIFPNSKFFRKLISKTPAPPP-ASDSATHSQQGVAYFAATSNEFILRKL 394

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQSIVTVKMIKNDI+
Sbjct: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 481 PLIERALATYENCSRIQR-----------GKGKESNSLDVTEP----------------- 512
           PLI RAL +YE  +R  +            K  E +S   T P                 
Sbjct: 455 PLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVS 514

Query: 513 ------VRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERL 566
                  +SYETRCM+LA+ELFLSLS+TWT+TPYAI+YLETILDEC LG  S+I++WERL
Sbjct: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574

Query: 567 SDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHKYSTDHFTDED-----------ILSEG 615
           + CY LRVDPR+K ++ ++   +   E  RGE    +D   DE            + S G
Sbjct: 575 AYCYALRVDPRVKGKLPSLDGQSGQNEK-RGEESEGSDESDDETQKYDHKISQNCMASLG 633

Query: 616 LTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLNL 675
           L RRRK+  FRLIA KKW E KQWRQ  W LKDIE  YSE+ F + + LIL KL+ +++ 
Sbjct: 634 LARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH- 692

Query: 676 KDVDSAPRPSEKN 688
              +  P P + N
Sbjct: 693 ---EHEPLPQKLN 702

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  721 bits (1860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/723 (51%), Positives = 474/723 (65%), Gaps = 80/723 (11%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M  SYE YMNL+ HLD++ E VP EI+++I+SNA++PV+TVTS+   DKHIQE+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           YMLLR+FG C+SDRDQA+  +    E                     PN S+  +RSRS 
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVE---------------------PNKSR--ARSRSG 97

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180
           SLFQR +  SQ++RFTRPL D+I TR+  D+LF+YHSLEVFL  YL+LV   T    PH 
Sbjct: 98  SLFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHT 155

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LL+ SIYH FF+ AISST +LSPYE FNHP+ SL+ALDIS  E YEDARDLLV FKN+++
Sbjct: 156 LLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHN 215

Query: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIY 300
            T +FP F+N N++LPVFLLCY + S+E+FE C           FVES+LL  W  +F  
Sbjct: 216 KTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTA 275

Query: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360
            +     LHQP+MSSLEE +F +   +   L L  I  IYD L  LV +LMIPFMKRK+S
Sbjct: 276 KDTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKIS 335

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420
           FWEE+ILQPR+S+F  +KFF+K ++K P    + ++S T   QG  YFA++S+E L+RKL
Sbjct: 336 FWEESILQPRRSIFPNSKFFRKLISKAPTPSTN-NDSATHSEQGLAYFAATSNELLLRKL 394

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480
           ADWS MLSDFKTAYSTYE L  D +  P+YLA C+EWCA+S+LMGAQSIVTVKMIKNDI+
Sbjct: 395 ADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 481 PLIERALATYENCSRIQRGKGKESNSL--------------------------------- 507
           PLI RAL +YE C+     K KE N L                                 
Sbjct: 455 PLITRALKSYELCA----SKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTD 510

Query: 508 -----DVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMV 562
                  ++  +SYETRCM+LA+ELFLSLS+TWT+TPYAI+YLETILD+C +G  S+I++
Sbjct: 511 FEISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVI 570

Query: 563 WERLSDCYNLRVDPRIKHRVGAMKKDAKD-TEDLRGEHKYSTDHFTDED----------- 610
           WERL+ CY LRVDPR+K R+ A +  + D  E L  E + S +   DE            
Sbjct: 571 WERLAYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSC 630

Query: 611 ILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLK 670
           I S GLTR+RKA  FRLIA KKW E KQWRQ  W  +D+E  YS + F +   LIL KL+
Sbjct: 631 IASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLE 690

Query: 671 NQL 673
            ++
Sbjct: 691 KRI 693

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/744 (50%), Positives = 489/744 (65%), Gaps = 102/744 (13%)

Query: 1   MVFSYEHYMNLLFHLDNSKE--TVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVD 58
           M  SYE+YMNLL+H+D+S E  TV  E+AK+I+SNA++PV+ VTST L D H+QE Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSR 118
           S+YMLLRFFG CV+DRDQ NE +                               KG R R
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETN----------------------------FKG-RPR 91

Query: 119 SNSLFQRDSTQSQYIRFTRPLGDLIETRDAN-DMLFNYHSLEVFLDNYLKLVAANTDEMV 177
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        
Sbjct: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149

Query: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209

Query: 238 LNHNTEN---FPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALW 294
           +N  T++   FP F+N N++LPVFLLCYND S E+FE C           FVESILL LW
Sbjct: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269

Query: 295 KDSFIYD-ENSVIQLHQPVMSSLEEILFFL--QAPTQTTLS--------------LALIN 337
           +DS  YD E     LH P+MSSLEE+L+FL  +AP +  +S              LAL+ 
Sbjct: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329

Query: 338 SIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PVNGNHQHN 396
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ P       N
Sbjct: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389

Query: 397 SLTRDS-QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCI 455
           S +  + Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C+
Sbjct: 390 SKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCL 449

Query: 456 EWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENC-SRIQRGKGKESNSLDVTEPVR 514
           EWCAVS+LMGAQSIVTVKMIKNDI+PLI ++L  YE C S++      E++S   ++P +
Sbjct: 450 EWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQ 509

Query: 515 SYETRCMILASELFLSLSNTWTSTPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRV 574
           SYETRCM+L++ELFLSLS+TWT+TPYAI+YLETIL  C LGP SQ+++WE+L+ CY LRV
Sbjct: 510 SYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRV 569

Query: 575 DPRIKHRVGAMKKDAKDTEDL------RGEHKYSTDHFTDE------------------- 609
           DPR+ H     +    + E++      R    +S  HF+ E                   
Sbjct: 570 DPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEA 629

Query: 610 --------------------DILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDI 649
                               DI   GLTRRRKAAFFRLIAA KW EQKQW+Q SW L+D+
Sbjct: 630 LSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDV 689

Query: 650 ESTYSEIKFLHGNGLILSKLKNQL 673
           ++ YS + F +  GLIL +L  ++
Sbjct: 690 DTVYSGLVFSYRKGLILERLVGEI 713

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/711 (47%), Positives = 450/711 (63%), Gaps = 104/711 (14%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RI+S+A+APVITVTS+   D HI E+YKV S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120
           Y+L R FGGC+SDRDQ         EH   D S +                   +R RSN
Sbjct: 61  YLLFRLFGGCISDRDQL-------MEHYTLDDSSTGGR----------------TRKRSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYL----KLVAANTDEM 176
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE +L +YL    KL A + +++
Sbjct: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157

Query: 177 ------------------VPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218
                             +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217

Query: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXX 278
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ +LCY+   + +   C     
Sbjct: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277

Query: 279 XXXXXXFVESILLALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQ-------------A 325
                 FV+SI LALW +     E+ ++ LH+P+MSSL+EI+ F                
Sbjct: 278 KIKKCLFVDSIPLALWDED---PESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334

Query: 326 PTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK-FFKKFM 384
            ++  L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394

Query: 385 NKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444
            K          +  RD    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 395 GKT---------TTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445

Query: 445 DAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQRGKGKES 504
              P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY      Q+G+    
Sbjct: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYR-----QQGRS--- 497

Query: 505 NSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDEC-KLGPCSQIMVW 563
                     SYETRCMIL++ELFL+L +TWTSTPYAI+YLETIL +C +LG CSQ+M+W
Sbjct: 498 ----------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547

Query: 564 ERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAA 623
           ERLSDCY  R DPR+     A+  +        G            +IL++G TR+RKAA
Sbjct: 548 ERLSDCYQSRTDPRV---ASALSTNTSPGSAQPG-----------NEILAQGFTRKRKAA 593

Query: 624 FFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674
           FFRLIAAKKWAEQ QWRQV WCL DI+  Y+        GL++ +L  ++ 
Sbjct: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/637 (49%), Positives = 422/637 (66%), Gaps = 76/637 (11%)

Query: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAA 171
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 172 NTDEMVPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231
           NT   +PHN LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 232 LVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILL 291
           L+ FKN++  T NFP+++N N++LPVFLLCY+  S E+ +             F ESILL
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 292 ALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQ-------APTQTTLSLALINSIYDMLD 344
            LW D  IY+ +  ++LH+P+MSS++E L+FLQ         T   L L+L+  IY+M+ 
Sbjct: 361 PLWNDK-IYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419

Query: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN---------------PV 389
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+N                 
Sbjct: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNS 478

Query: 390 NGNHQHNSLTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449
              H H+ LT+DS G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 479 ISKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538

Query: 450 YLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENC------SRI------- 496
           Y+ASC+EW AVS+LMGAQ+IVT KM+KND++PLIE AL +YE        SR+       
Sbjct: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINS 598

Query: 497 -------QRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETIL 549
                        E + ++    +RSYE RCM+L SELFLSLS+TWTSTPYA++YLETIL
Sbjct: 599 LNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETIL 658

Query: 550 DECKLGPCSQIMVWERLSDCYNLRVDPRIKHR--VGAMKKDAKDT-------------ED 594
            + KLGPCSQ ++WERLS CY+LRVDPRIK +  +  + K  K T             E 
Sbjct: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718

Query: 595 LRG---EHKYSTD--------------HFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQK 637
            R    + KYS D              +    DILS+G TR+RKAAFF+LIAAKKW+EQK
Sbjct: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQK 778

Query: 638 QWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674
           QWRQ+ WCLKDIE+ Y E+ F     LIL KLK+QLN
Sbjct: 779 QWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLN 815

 Score =  128 bits (322), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 56/89 (62%), Positives = 74/89 (83%), Gaps = 1/89 (1%)

Query: 1  MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRI+ N+IAP+I+VT+TP  DKH+Q++Y +DSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRFFGGCVSDRDQANEAKVGQHEHEV 89
          YMLLR+FGGC+SDRDQ +E    QH +E+
Sbjct: 61 YMLLRYFGGCISDRDQYHEPH-HQHPNEL 88

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  497 bits (1279), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 288/672 (42%), Positives = 407/672 (60%), Gaps = 63/672 (9%)

Query: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLY 61
           + SYE YMNLL + D   + VP EI++++I NA++P I+V ST   ++H++E +K+ SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNS 121
            LLR+FG  + DRDQ ++    + +             P N+            R R NS
Sbjct: 61  KLLRYFGDYIQDRDQLDDKISAKLQ-------------PNNR------------RQRQNS 95

Query: 122 LFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNL 181
           LFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK +  +T    P  L
Sbjct: 96  LFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCEL 151

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL + 
Sbjct: 152 LKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNT 209

Query: 242 TENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYD 301
              FP F+NTN++LPVF+LC++  S +++E             FVES+ L ++ +   + 
Sbjct: 210 LSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTN---FR 266

Query: 302 ENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSF 361
           + S++ LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK+SF
Sbjct: 267 DRSIV-LHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLA 421
           W+ETILQPRKS+F+  K  K+F++K+  +G+    + +  +  + +F +SS+EFL+RKLA
Sbjct: 326 WDETILQPRKSIFHSNKLLKRFISKS--SGS---PTASMPTSPDGHFLASSNEFLLRKLA 380

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481
           DW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA SIVT KMIKNDI+P
Sbjct: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440

Query: 482 LIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYA 541
           LI + L    N             SLD        + RCMI  +ELFLSLS+TWTS P+A
Sbjct: 441 LIMKYLDYAVN----------NIISLD--------QIRCMIYMTELFLSLSDTWTSAPFA 482

Query: 542 IQYLETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEH 599
           I+YLE IL  +  KLGP  + ++WER+S  Y LR+DPRI H       D     DL  E 
Sbjct: 483 IKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRI-HADDDSTSDCD--HDLEEEL 539

Query: 600 KYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFL 659
             +        I ++G TR RK A F+L+AAKKW +  Q RQ +W LK     Y ++ F 
Sbjct: 540 YLNPHKLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFA 599

Query: 660 HGNGLILSKLKN 671
           +  G +LS+L +
Sbjct: 600 NAEGTLLSRLAD 611

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  489 bits (1258), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 287/688 (41%), Positives = 407/688 (59%), Gaps = 104/688 (15%)

Query: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLY 61
           + SYE YMNL+ + ++  + VP EI++R+I NA++P ++V ST   + H+ E +   SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNS 121
           MLLR+F   V +R +    +VG                           S  G R R  S
Sbjct: 61  MLLRYFADYVRERGE----EVG---------------------------SVSGQR-RPGS 88

Query: 122 LFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHNL 181
           ++QR +  S+Y+RF RPL ++IET +   +  ++  LE  L  +L+ + A T    P  L
Sbjct: 89  VYQRQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSEL 144

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SI+H F ++   S+  LSPY T NHPI++L+ALD++ GE Y  AR+LLV FKNL   
Sbjct: 145 LKHSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSK 202

Query: 242 TENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYD 301
           +  FP ++NTN++LPVF+LC+++ S E++E             FVES+ L ++ +   Y+
Sbjct: 203 SSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTN---YE 259

Query: 302 ENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSF 361
            + V+ LH P+ +SL+E ++    P    L   L++ IY+ ++ +V DLMIPFM RK+SF
Sbjct: 260 SDPVV-LHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISF 318

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLA 421
           W+ETILQPRKS+F+G KF K+FMNK     +    +L+  S G  YF +SS+EFL+RKLA
Sbjct: 319 WDETILQPRKSIFHGNKFLKRFMNKT---NSSAAGTLSTSSDG--YFLASSNEFLLRKLA 373

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINP 481
           DWS MLSD+KTAYS Y  L+ D + +P+YL+SC E+ A+SLLMGA SIVT KMIKNDI+P
Sbjct: 374 DWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDP 433

Query: 482 LIERALATYENCSRIQRGKGKESNSLDVTEPVRSY--ETRCMILASELFLSLSNTWTSTP 539
           LI +                     +D T    +Y  + RC++  +ELFLSLS+TWTS P
Sbjct: 434 LIMKY--------------------MDSTVASLNYLGKFRCLVYMAELFLSLSDTWTSAP 473

Query: 540 YAIQYLETIL--DECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRG 597
           +AI+YLE IL  ++ KLGP S+ M+WER+S  Y LR+DPRI             T+D   
Sbjct: 474 FAIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIH------------TDD--- 518

Query: 598 EHKYSTDHF---TDED-------------ILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQ 641
             +Y +D+F   T ED             I S GLTR RK A FRL+AAKKW E    RQ
Sbjct: 519 --EYLSDNFMELTTEDDFCMNPNKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQ 576

Query: 642 VSWCLKDIESTYSEIKFLHGNGLILSKL 669
            +W LK     Y  + F + +G +LS+L
Sbjct: 577 GAWSLKGCNKVYRNLGFANADGTLLSRL 604

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  458 bits (1178), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 258/679 (37%), Positives = 390/679 (57%), Gaps = 79/679 (11%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62
           FSYE YMNL+ + ++    +P EI+K++I N ++P I V S    D H+++ Y +DS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122
           L R+FG  + DRDQ                      IP   +L+ P     G R RS+SL
Sbjct: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101

Query: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLK-LVAANTDEMVPHNL 181
           FQR +  S+ +RFTR L DLI   D+ D +     ++ FL  YL+ L     +   P  L
Sbjct: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216

Query: 242 TENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCXXXXXXXXXXXFVESILLALWKDSFIYD 301
            ENFP F+N N++LPVF+LCY+++S+E++E             FVES+ ++L+     +D
Sbjct: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP---HD 273

Query: 302 ENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSF 361
                 LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333

Query: 362 WEETILQPRKSLFNGAKFFKKFMN---KNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMR 418
           W+ET+LQPRKS+F   KFF++F++    +P+   H+ N     ++G+  F +SS EFL+R
Sbjct: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPIA--HKVNDPQDPAEGDIMFPASSPEFLLR 391

Query: 419 KLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKND 478
           KLADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +
Sbjct: 392 KLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTE 451

Query: 479 INPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTST 538
           ++PL+ RA+  Y+        K  E +SL V          C++  S+L LSLS+TW S+
Sbjct: 452 VDPLMTRAIEQYK--------KQDEKHSLRV--------IHCILTFSDLLLSLSDTWVSS 495

Query: 539 PYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRI-------------------- 578
           P A+ YL  I     LGP + +++ ER++  Y + +D R+                    
Sbjct: 496 PLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAA 555

Query: 579 -KHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQK 637
              + G    +  D  + R E+K         ++ SEGLTR RK + ++L+AAKKW E  
Sbjct: 556 ENSKKGENGLEVDDMHEWRNENK-----LIQNNLRSEGLTRFRKYSLYQLVAAKKWVELH 610

Query: 638 QWRQVSWCLKDIESTYSEI 656
           +  Q  WC+      Y ++
Sbjct: 611 KRNQAKWCIYHAAPAYEKL 629

>KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1877

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 156  HSLEVFLDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISSTNNLSP---YE--TFNHP 210
            H+L  +   YL+L+ AN D  +   L  +SI   F  L +  TN  +P   YE  T NHP
Sbjct: 1089 HALIFYRGEYLQLIDANQDNYLEECLKIRSILAEFEELNVEQTNPYAPELKYEEQTANHP 1148

Query: 211  I 211
            +
Sbjct: 1149 V 1149

>NDAI0E01010 Chr5 complement(203904..205625) [1722 bp, 573 aa] {ON}
           Anc_8.709 YOR260W
          Length = 573

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 546 ETILDECKLGPCSQIMVWERLSDCY---NLRVDPRIKHRVGAMKKDAKDTEDL 595
           + IL+ C +GP  +I    +LS+CY   N  V+P+   +   + K A + ED+
Sbjct: 469 DVILENCIIGPNVKIGKKAKLSNCYVEGNYIVEPKGNFKGETLSKVALEEEDI 521

>TBLA0A08870 Chr1 complement(2174037..2179640) [5604 bp, 1867 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1867

 Score = 32.0 bits (71), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 31/61 (50%), Gaps = 5/61 (8%)

Query: 156  HSLEVFLDNYLKLVAANTDEMVPHNLLKKSIYHSFFSLAISSTNNLSP---YE--TFNHP 210
            H+L  +   Y++L+ AN D  +   L  +S+   F  L + + N  SP   YE  T NHP
Sbjct: 1080 HALIFYRGEYIQLIDANQDNYLEECLKIRSVLAEFEELNVENVNPYSPSLTYEEQTTNHP 1139

Query: 211  I 211
            +
Sbjct: 1140 V 1140

>NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {ON}
           
          Length = 1107

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 18/29 (62%), Gaps = 5/29 (17%)

Query: 42  TSTPLFDKHIQETYKVDSLYMLLRFFGGC 70
           TS PL  KHI+ T     LY+LLRFF  C
Sbjct: 341 TSNPLISKHIKAT-----LYILLRFFDMC 364

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,562,176
Number of extensions: 3470990
Number of successful extensions: 11950
Number of sequences better than 10.0: 54
Number of HSP's gapped: 12276
Number of HSP's successfully gapped: 60
Length of query: 698
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 581
Effective length of database: 40,065,477
Effective search space: 23278042137
Effective search space used: 23278042137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)