Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDR107C (TMN2)8.254ON67267233340.0
Smik_4.3538.254ON69067229370.0
Suva_2.2678.254ON67267229050.0
Skud_4.3688.254ON67267228660.0
NDAI0B023708.254ON72266925360.0
Suva_10.1678.254ON68468125220.0
Smik_12.1428.254ON66365925090.0
YLR083C (EMP70)8.254ON66766625090.0
NCAS0B049708.254ON66666124870.0
Skud_12.1518.254ON66466624770.0
KAFR0B026808.254ON66465724180.0
Kpol_543.358.254ON65867223270.0
KNAG0G019908.254ON66767023230.0
CAGL0B01683g8.254ON69168623070.0
ZYRO0C01848g8.254ON64766723020.0
SAKL0H17248g8.254ON66065822320.0
TBLA0E043708.254ON67666722060.0
KLLA0F18931g8.254ON66566022000.0
Kwal_56.235778.254ON68367121770.0
NCAS0B038908.254ON66366521610.0
KLTH0G13882g8.254ON68768921420.0
TBLA0H014508.254ON67366621290.0
TPHA0A018408.254ON68569221250.0
TDEL0F038108.254ON65665220180.0
NDAI0J014208.254ON61962719790.0
AGR097W8.254ON65365818970.0
Ecym_43178.254ON60566015230.0
YER113C (TMN3)7.411ON7067113606e-35
NCAS0A145207.411ON6706953462e-33
Smik_5.2587.411ON7067183454e-33
KNAG0C034307.411ON6807103445e-33
TDEL0C027107.411ON6786953402e-32
NDAI0A015107.411ON6796983322e-31
Suva_5.2347.411ON7067133285e-31
Skud_5.2667.411ON7077143197e-30
KLLA0E20835g7.411ON6766933189e-30
ZYRO0B03784g7.411ON6586863116e-29
SAKL0F12914g7.411ON7077423045e-28
CAGL0G03487g7.411ON7047323036e-28
Ecym_71437.411ON6767261959e-15
KAFR0K019507.411ON6642781886e-14
Kwal_27.107467.411ON6902921861e-13
KLTH0C06226g7.411ON6942811815e-13
TPHA0K007307.411ON7335201781e-12
TBLA0I003307.411ON7135261762e-12
Kpol_1045.287.411ON6815711395e-08
AGL295C7.411ON6571661342e-07
Suva_8.2578.614ON61894716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDR107C
         (672 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}  ...  1288   0.0  
Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON...  1135   0.0  
Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON...  1123   0.0  
Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON...  1108   0.0  
NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {O...   981   0.0  
Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {...   976   0.0  
Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {...   971   0.0  
YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON} ...   971   0.0  
NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {O...   962   0.0  
Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {...   958   0.0  
KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {O...   936   0.0  
Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}...   900   0.0  
KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {O...   899   0.0  
CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {...   893   0.0  
ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} simila...   891   0.0  
SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} simi...   864   0.0  
TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa] ...   854   0.0  
KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]...   852   0.0  
Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {...   843   0.0  
NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254    837   0.0  
KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} simi...   829   0.0  
TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {O...   824   0.0  
TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.2...   823   0.0  
TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {O...   781   0.0  
NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8....   766   0.0  
AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic ho...   735   0.0  
Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar t...   591   0.0  
YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}  ...   143   6e-35
NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa] ...   137   2e-33
Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON...   137   4e-33
KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.4...   137   5e-33
TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {O...   135   2e-32
NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.4...   132   2e-31
Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON...   130   5e-31
Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C ...   127   7e-30
KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]...   127   9e-30
ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {...   124   6e-29
SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]...   121   5e-28
CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {...   121   6e-28
Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar t...    80   9e-15
KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {...    77   6e-14
Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113...    76   1e-13
KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} simila...    74   5e-13
TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7....    73   1e-12
TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411...    72   2e-12
Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON} (64237....    58   5e-08
AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON} S...    56   2e-07
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...    32   6.9  

>YDR107C Chr4 complement(669016..671034) [2019 bp, 672 aa] {ON}
           TMN2Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn3p; member
           of the evolutionarily conserved Transmembrane Nine
           family of proteins with nine membrane-spanning segments
          Length = 672

 Score = 1288 bits (3334), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/672 (93%), Positives = 631/672 (93%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG
Sbjct: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK
Sbjct: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180
           STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD
Sbjct: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180

Query: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240
           GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN
Sbjct: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240

Query: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300
           YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY
Sbjct: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300

Query: 301 LHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLG 360
           LHIYDPQIQWF                     RALKSDLARYNELNLDNEFHEDSGWKLG
Sbjct: 301 LHIYDPQIQWFSLINFSVIVILLSSVVMHSLLRALKSDLARYNELNLDNEFHEDSGWKLG 360

Query: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420
           HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG
Sbjct: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420

Query: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480
           FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF
Sbjct: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480

Query: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540
           FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF
Sbjct: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    YYSLCLENWLWQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYYSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660
           RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF
Sbjct: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660

Query: 661 FIRKIYSAIKVE 672
           FIRKIYSAIKVE
Sbjct: 661 FIRKIYSAIKVE 672

>Smik_4.353 Chr4 complement(630320..632392) [2073 bp, 690 aa] {ON}
           YDR107C (REAL)
          Length = 690

 Score = 1135 bits (2937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/672 (80%), Positives = 580/672 (86%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           MK+ +WLL++ Y  LTK FSLPGLSPTTYH  DEIPLLVNRLTPSIYFQHQDE G D+S 
Sbjct: 19  MKQSIWLLLFFYIGLTKAFSLPGLSPTTYHKNDEIPLLVNRLTPSIYFQHQDENGKDISS 78

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           DKEH+LYSYDYYN+RFHFCRPEHVE+QPESLGS+IFGDRIYNSPFQL MLE KECVALC+
Sbjct: 79  DKEHYLYSYDYYNERFHFCRPEHVERQPESLGSIIFGDRIYNSPFQLRMLETKECVALCE 138

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180
           +TIPGKDAKFIN LIKSGFFQNWLVDGLPAARK +DSRTKTNYYGTGFELG T VK T+D
Sbjct: 139 NTIPGKDAKFINKLIKSGFFQNWLVDGLPAARKVWDSRTKTNYYGTGFELGITAVKNTID 198

Query: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240
           GK +PSTMEEL SE SN    LDAR PKN+KPNLVKTVELPYFVNHFDIEVEFHDRG+DN
Sbjct: 199 GKVIPSTMEELDSETSNTGAALDAREPKNIKPNLVKTVELPYFVNHFDIEVEFHDRGDDN 258

Query: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300
           YRVVGV VNP+SIERSSP +CS   KPLILDE+ DNE+YFTYSVKFVASDTVWATRWDKY
Sbjct: 259 YRVVGVTVNPMSIERSSPDSCSKATKPLILDEEGDNEIYFTYSVKFVASDTVWATRWDKY 318

Query: 301 LHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLG 360
           LHIYDPQIQWF                     RAL SDL+RYNELNLDNEFHEDSGWKLG
Sbjct: 319 LHIYDPQIQWFSLINFSVIIVLLSSVVMHSLLRALNSDLSRYNELNLDNEFHEDSGWKLG 378

Query: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420
           HGDVFRTP+KSMLLS+LVGSG+QLFLM++CSIF AA+GLVSPVSRGSLPTVMFV YALFG
Sbjct: 379 HGDVFRTPTKSMLLSVLVGSGVQLFLMIICSIFLAALGLVSPVSRGSLPTVMFVFYALFG 438

Query: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480
           FVGSY SMGVYKFF GPYWKAN+ILTPILLPG IF+LIV MNFFLLFAHSSGVIPA +LF
Sbjct: 439 FVGSYTSMGVYKFFHGPYWKANLILTPILLPGGIFVLIVAMNFFLLFAHSSGVIPASTLF 498

Query: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540
           FII LWF VS+PLSFAGS++AHK CNWDEHPTKTNQIARQ+PYQPWYLRT QATLIAGIF
Sbjct: 499 FIIFLWFAVSIPLSFAGSMIAHKWCNWDEHPTKTNQIARQVPYQPWYLRTIQATLIAGIF 558

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQW 600
            FGSIAVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENW WQW
Sbjct: 559 CFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLVTVLITYHSLCLENWQWQW 618

Query: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660
           RSFIIGGLGCS+Y FIHSILFTKFKLGG IT+VLY GYS IISALCCVVTGAIGFFS M 
Sbjct: 619 RSFIIGGLGCSVYMFIHSILFTKFKLGGFITIVLYFGYSFIISALCCVVTGAIGFFSCML 678

Query: 661 FIRKIYSAIKVE 672
           FIRKIYSA+K+E
Sbjct: 679 FIRKIYSAVKIE 690

>Suva_2.267 Chr2 complement(463458..465476) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1123 bits (2905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/672 (79%), Positives = 581/672 (86%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           M++G+WL ++ Y  L K FSLPG+SPTTY + DEIPLLVNRLTPSIYFQH+DE G DVS 
Sbjct: 1   MRKGIWLALFLYIALAKAFSLPGVSPTTYRANDEIPLLVNRLTPSIYFQHKDENGKDVSS 60

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           DKEHFLYSYDYYN +FHFC+PEHVEKQPESLGSVIFGDRIYNSPFQL MLE+KECVALCK
Sbjct: 61  DKEHFLYSYDYYNDKFHFCKPEHVEKQPESLGSVIFGDRIYNSPFQLKMLEDKECVALCK 120

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180
           STIPGKDAKFINTLIK+GFFQNWLVDGLPAAR  YDSRTKTNYYGTGFELGFTDVKQTV 
Sbjct: 121 STIPGKDAKFINTLIKNGFFQNWLVDGLPAARNVYDSRTKTNYYGTGFELGFTDVKQTVG 180

Query: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240
           GK +PSTMEEL SE S     LDAR PKN+KPNLV+T+EL +FVNHF+I+VE+HDRGN N
Sbjct: 181 GKTIPSTMEELDSEDSKTGATLDARDPKNIKPNLVQTIELTHFVNHFNIQVEYHDRGNGN 240

Query: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300
           YRVVGV VNP+SIERSSPGACSTTG+PL L EDKDN+VYFTYSVKF+ASDTVWATRWDKY
Sbjct: 241 YRVVGVTVNPLSIERSSPGACSTTGEPLTLVEDKDNDVYFTYSVKFIASDTVWATRWDKY 300

Query: 301 LHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLG 360
           LH+YDPQIQWF                     RA++SD ARYNELNLDNEFHED+GWKLG
Sbjct: 301 LHVYDPQIQWFSLINFSIIVILLSSVVIHSILRAVRSDFARYNELNLDNEFHEDAGWKLG 360

Query: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420
           HGDVFR P KSM+LS+LVGSG+QLFLM++CSIFFAA+GLVSP SRGSLPTVMFVLYALFG
Sbjct: 361 HGDVFRIPPKSMVLSVLVGSGIQLFLMIICSIFFAALGLVSPASRGSLPTVMFVLYALFG 420

Query: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480
           FVGSY SMGVYKFF GPYWKAN+I+TPILLPGAIFLLIV MNFFLLFAHSSGVIPAR+LF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAIFLLIVAMNFFLLFAHSSGVIPARTLF 480

Query: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540
           FII LWF VS+PLSFAGS +AHK+C WDEHPTKTNQIARQ P QPWYLRT QATLIAGIF
Sbjct: 481 FIIFLWFSVSIPLSFAGSYIAHKRCKWDEHPTKTNQIARQSPRQPWYLRTIQATLIAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENW WQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLATSLVTVFITYHSLCLENWSWQW 600

Query: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660
           RSFIIGGLGCS+Y FIH+ILFTKFKLGG +TVVLY+GYS IISALCCVVTGAIGFFSSM 
Sbjct: 601 RSFIIGGLGCSVYMFIHAILFTKFKLGGFVTVVLYVGYSFIISALCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYSAIKVE 672
           FIRKIYS IKVE
Sbjct: 661 FIRKIYSRIKVE 672

>Skud_4.368 Chr4 complement(640627..642645) [2019 bp, 672 aa] {ON}
           YDR107C (REAL)
          Length = 672

 Score = 1108 bits (2866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/672 (78%), Positives = 573/672 (85%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           MK+ +WL +  Y  + K FSLPGLSPTTYHS DEIPLLVNRLTPSIYFQHQDE GND+S 
Sbjct: 1   MKQSIWLALLSYIPVAKAFSLPGLSPTTYHSNDEIPLLVNRLTPSIYFQHQDENGNDISS 60

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           DKEHFLYSYDYYN+RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQL MLEEKECVALCK
Sbjct: 61  DKEHFLYSYDYYNERFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLRMLEEKECVALCK 120

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180
            TIPG+DA+FIN LI SGFFQNWLVDGLPAAR  YDSRTKTNYYGTGFELGFTDV QTV 
Sbjct: 121 GTIPGRDAEFINRLIISGFFQNWLVDGLPAARSVYDSRTKTNYYGTGFELGFTDVIQTVG 180

Query: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240
            + VP+TMEE   +ASN    L  R PKN++PN VKTVELPYFVNHF+I VEFH+RGND+
Sbjct: 181 DETVPNTMEEADMDASNAGATLHIRSPKNIRPNPVKTVELPYFVNHFEIVVEFHERGNDS 240

Query: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300
           YR+VGV VNPVSIERSSPG+CS T KPL L ED+DNEVYFTYSVKFVAS TVWATRWDKY
Sbjct: 241 YRIVGVTVNPVSIERSSPGSCSRTRKPLTLHEDRDNEVYFTYSVKFVASATVWATRWDKY 300

Query: 301 LHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLG 360
           LHIYDPQIQWF                     RALKSDL RYNELNL+NEFHED+GWKL 
Sbjct: 301 LHIYDPQIQWFSLIGFSVIVILLSSAVIHSLLRALKSDLTRYNELNLNNEFHEDAGWKLS 360

Query: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420
           HGDVFRTP KSMLLS+LVGSG+QLFLM++CSIFFAA GLVSP+SRGSL TVMF+LYALFG
Sbjct: 361 HGDVFRTPPKSMLLSVLVGSGIQLFLMIICSIFFAAFGLVSPISRGSLQTVMFLLYALFG 420

Query: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480
           FVGSY SMGVYKFF GPYWKAN+I+TPILLPGAI LLIV MN FLLFAHSSGVIPA+SLF
Sbjct: 421 FVGSYTSMGVYKFFHGPYWKANLIITPILLPGAILLLIVAMNIFLLFAHSSGVIPAKSLF 480

Query: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540
           FII LWF+VS+PLSF GS++AHK+C+W+EHPTKTNQIARQIP+QPWYLRT QAT++AGIF
Sbjct: 481 FIIFLWFVVSIPLSFVGSVLAHKRCSWNEHPTKTNQIARQIPHQPWYLRTTQATMVAGIF 540

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQW 600
           SFGSIAVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENWLWQW
Sbjct: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFLLFSFLLLTLTTSLITVLITYHSLCLENWLWQW 600

Query: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660
           RSFIIGGLGCSIY FIHSILFTKFKLGG ITVVLYLGYS I+S LCCVVTGAIGFFSSM 
Sbjct: 601 RSFIIGGLGCSIYMFIHSILFTKFKLGGFITVVLYLGYSFIMSVLCCVVTGAIGFFSSMI 660

Query: 661 FIRKIYSAIKVE 672
           FIRKIY A+KVE
Sbjct: 661 FIRKIYYAVKVE 672

>NDAI0B02370 Chr2 complement(593012..595180) [2169 bp, 722 aa] {ON}
           Anc_8.254
          Length = 722

 Score =  981 bits (2536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/669 (69%), Positives = 545/669 (81%), Gaps = 7/669 (1%)

Query: 5   VWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEH 64
           V L  +C  +LT+ F LPG++PTTYH  DEIPLLVN LTPS+YFQH++E+G  +  DKE 
Sbjct: 60  VLLFAFC-LSLTRAFYLPGVAPTTYHPDDEIPLLVNHLTPSMYFQHKNEDGKTMKSDKER 118

Query: 65  FLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIP 124
           FLYSYDYY  RFHFC+PEH+EKQPESLGS+IFGDRIYNSPFQ+NML++K CV+LCK+TIP
Sbjct: 119 FLYSYDYYYDRFHFCQPEHIEKQPESLGSIIFGDRIYNSPFQINMLQDKTCVSLCKTTIP 178

Query: 125 GKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQ-TVDGKA 183
           GKDAKFIN LIK+GFFQNWL+DGLPAAR+ YDSRTKT +YGTGFELGF DV Q T  G  
Sbjct: 179 GKDAKFINKLIKNGFFQNWLIDGLPAARQVYDSRTKTEFYGTGFELGFVDVVQGTTTGDN 238

Query: 184 VPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRV 243
             +  ++ T+   NE + LD R  KNV+  ++K  ELPYF NHFDI+VE+HDRG +NYRV
Sbjct: 239 ANTVAKKPTT---NEGLELDTRDAKNVQ--MLKNFELPYFANHFDIQVEYHDRGENNYRV 293

Query: 244 VGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHI 303
           VGVIVNPVSI+RS+PG C T+G PL+L ED+DN+VYFTYSVKF+ S+T+WATRWDKYLHI
Sbjct: 294 VGVIVNPVSIKRSTPGTCETSGAPLMLSEDQDNDVYFTYSVKFIPSETIWATRWDKYLHI 353

Query: 304 YDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGD 363
           YDP IQWF                     +ALKSD ARYNELNLD++F E++GWKLGHGD
Sbjct: 354 YDPAIQWFSLINFSVVVLLLSSVVIHSLLKALKSDFARYNELNLDDDFQEEAGWKLGHGD 413

Query: 364 VFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVG 423
           VFR P +S+LLS+LVGSG+QLFLM++CSIFFAA+G +SP SRGSL TVMF+LYALFGFVG
Sbjct: 414 VFRIPHRSLLLSVLVGSGVQLFLMIICSIFFAALGFLSPSSRGSLATVMFILYALFGFVG 473

Query: 424 SYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFII 483
           SY SMGVYKFF GPYWK NM+LTPIL+PG IF  IV +N FLLF HSSGVIPA +LFF+I
Sbjct: 474 SYTSMGVYKFFGGPYWKVNMLLTPILVPGLIFCGIVALNIFLLFVHSSGVIPAVTLFFMI 533

Query: 484 LLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFG 543
           LLWF+ S+PL+ AGS++AHK+CNWDEHPTKTNQIARQIP+QPWYL+T  ATLIAGIF FG
Sbjct: 534 LLWFVFSIPLALAGSLIAHKKCNWDEHPTKTNQIARQIPFQPWYLKTWPATLIAGIFPFG 593

Query: 544 SIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSF 603
           SIAVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENW+WQWR F
Sbjct: 594 SIAVELYFIYSSLWFNKIFYMFGFLLFSFFLLTLTTSLVTILITYHSLCLENWMWQWRGF 653

Query: 604 IIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIR 663
           IIGG+GC+IY FIHSILFTKFKLGG  T+VLY+GYS IIS L C+VTGAIGF SSMFFIR
Sbjct: 654 IIGGVGCAIYVFIHSILFTKFKLGGFTTIVLYVGYSTIISLLFCIVTGAIGFLSSMFFIR 713

Query: 664 KIYSAIKVE 672
           KIYS+IKVE
Sbjct: 714 KIYSSIKVE 722

>Suva_10.167 Chr10 complement(299075..301129) [2055 bp, 684 aa] {ON}
           YLR083C (REAL)
          Length = 684

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/681 (67%), Positives = 538/681 (79%), Gaps = 18/681 (2%)

Query: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66
            L+Y   +  + F LPG++PTTY   DEIPLLVN LTPS+Y+QHQDE+GN+VSGDKEHFL
Sbjct: 7   FLLYFIVSAARAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHQDEDGNNVSGDKEHFL 66

Query: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126
           YSYDYY  +FHFC+PEHVEKQPESLGS+IFGDRIYNSPF+LNML+EKECV+LCK+ IPG 
Sbjct: 67  YSYDYYYDKFHFCKPEHVEKQPESLGSIIFGDRIYNSPFELNMLQEKECVSLCKTVIPGD 126

Query: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDG----- 181
           DAKFIN LIK+GFFQNWL+DGLPAAR+ +D RTKT++YG GF LGF +V Q VD      
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVHDGRTKTDFYGAGFGLGFVEVAQVVDSETEQV 186

Query: 182 ----------KAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEV 231
                     +A     E    ++SNE + LDAR   +   N+VKT E PYF NHFDI++
Sbjct: 187 QVASGETEQTQAADGKTEPEKGKSSNEGMELDAR---DQGKNMVKTREFPYFANHFDIKI 243

Query: 232 EFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDT 291
           E+HDRG  NYRVVGVIVNP+SI+RSSPG C T G PL+LDE  DNEVYFTYSVKF  S T
Sbjct: 244 EYHDRGEGNYRVVGVIVNPLSIKRSSPGTCETNGSPLVLDEANDNEVYFTYSVKFEESPT 303

Query: 292 VWATRWDKYLHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEF 351
            WATRWDKYLH+YDP IQWF                     RALKSD ARYNELNLD++F
Sbjct: 304 SWATRWDKYLHVYDPSIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDF 363

Query: 352 HEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTV 411
            EDSGWKL HGDVFR PS+S++LSILVGSG+Q+FLMV CSIFFAA+G +SP SRGSL TV
Sbjct: 364 QEDSGWKLNHGDVFRPPSQSLMLSILVGSGVQIFLMVTCSIFFAALGFLSPSSRGSLATV 423

Query: 412 MFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSS 471
           MF+LYALFGFVGSY SMG+YKFF GPYWKAN+I+TP+L+PGAI L+I+ +NFFL+F HSS
Sbjct: 424 MFILYALFGFVGSYTSMGIYKFFDGPYWKANVIMTPLLIPGAILLVIIALNFFLMFVHSS 483

Query: 472 GVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTA 531
           GVIPA +LFF++ LWFL S+PLSFAGS+VA K+C+WDEHPTKTNQIARQIP+QPWYL+T 
Sbjct: 484 GVIPASTLFFMVFLWFLFSIPLSFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTL 543

Query: 532 QATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSL 591
            ATLIAGIF FGSIAVELYFIY+SLWFNKIFYMFGF                    Y+SL
Sbjct: 544 PATLIAGIFPFGSIAVELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTVMITYHSL 603

Query: 592 CLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTG 651
           CLENW WQWR F +GG+GC++Y FIHSILFTKFKLGG  T+VLYLGYS +IS LCC+VTG
Sbjct: 604 CLENWKWQWRGFTVGGVGCALYVFIHSILFTKFKLGGFTTIVLYLGYSSVISLLCCLVTG 663

Query: 652 AIGFFSSMFFIRKIYSAIKVE 672
           +IGF SSMFFIRKIYS+IKV+
Sbjct: 664 SIGFISSMFFIRKIYSSIKVD 684

>Smik_12.142 Chr12 complement(273932..275923) [1992 bp, 663 aa] {ON}
           YLR083C (REAL)
          Length = 663

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/659 (69%), Positives = 528/659 (80%), Gaps = 9/659 (1%)

Query: 14  TLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYN 73
           +  K F LPG++PTTY   DEIPLLVN LTPS+Y+QH+DEEGN+VSGDKE+FLYSYDYYN
Sbjct: 14  STAKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHKDEEGNNVSGDKENFLYSYDYYN 73

Query: 74  KRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINT 133
            RFHFC+PE VEKQPESLGS+IFGDRIYNSPFQL MLEEKECV+LCK TIPG DAKFIN 
Sbjct: 74  SRFHFCKPEKVEKQPESLGSIIFGDRIYNSPFQLKMLEEKECVSLCKKTIPGNDAKFINK 133

Query: 134 LIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTS 193
           LIK+GFFQNWL+DGLPAAR   D RTKT++YG GFELGF +V Q    +A P+T     +
Sbjct: 134 LIKNGFFQNWLIDGLPAARNVSDKRTKTSFYGAGFELGFVEVTQGTASEATPNT-----A 188

Query: 194 EASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI 253
           E +N+ V LD R   N    +V+T E PYF NH+DI +E+HDRG  NYRVVGVIVNPVSI
Sbjct: 189 ETTNQGVELDTRDGHN----MVQTYEHPYFTNHYDIRIEYHDRGEGNYRVVGVIVNPVSI 244

Query: 254 ERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFXX 313
           +RS P  C T G PL+LDE+ DNEVYFTYSVKFV S+T WATRWDKYLH+YDP IQWF  
Sbjct: 245 KRSDPETCETDGSPLMLDEENDNEVYFTYSVKFVESETSWATRWDKYLHVYDPSIQWFSL 304

Query: 314 XXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSML 373
                              RALKSD ARYNELNLD++F EDSGWKL HGDVFR PS+S+ 
Sbjct: 305 INFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLSHGDVFRAPSRSLT 364

Query: 374 LSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKF 433
           LSILVGSG+QLF MV CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY SMG+YKF
Sbjct: 365 LSILVGSGVQLFFMVTCSIFFAALGFLSPSSRGSLATVMFMLYALFGFVGSYTSMGIYKF 424

Query: 434 FRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPL 493
           F GPYWKAN+ILTP+L+PG I ++I+ +NFFL+F HSSGVIPA +LFF++ LWFL S+PL
Sbjct: 425 FDGPYWKANLILTPLLVPGTILIIIIALNFFLMFVHSSGVIPASTLFFMVFLWFLFSIPL 484

Query: 494 SFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIY 553
           SFAGS+VA K+C+WDEHPTKTNQIARQIP+QPWYL+T  ATLIAG+F FGSIAVELYFIY
Sbjct: 485 SFAGSLVARKKCHWDEHPTKTNQIARQIPFQPWYLKTVPATLIAGVFPFGSIAVELYFIY 544

Query: 554 SSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIY 613
           +SLWFNKIFYMFGF                    Y+SLCLENW WQWR FI+GG GC++Y
Sbjct: 545 TSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVGGAGCALY 604

Query: 614 TFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
            FIHSILFTKFKLGG  T+VLY+GYS +IS LCC+VTG+IGF SSMFFIRKIYS+IKV+
Sbjct: 605 VFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMFFIRKIYSSIKVD 663

>YLR083C Chr12 complement(294091..296094) [2004 bp, 667 aa] {ON}
           EMP70Protein with a role in cellular adhesion,
           filamentous growth, and endosome-to-vacuole sorting;
           similar to Tmn2p and Tmn3p; member of Transmembrane Nine
           family of proteins with 9 transmembrane segments
          Length = 667

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/666 (69%), Positives = 533/666 (80%), Gaps = 9/666 (1%)

Query: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66
           LL+Y + +  K F LPG++PTTY   D IPLLVN LTPS+ +QH+DE+GN+VSGDKE+FL
Sbjct: 11  LLLYFFVSTVKAFYLPGVAPTTYRENDNIPLLVNHLTPSMNYQHKDEDGNNVSGDKENFL 70

Query: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126
           YSYDYY  RFHFC+PE VEKQPESLGSVIFGDRIYNSPFQLNML+EKEC +LCK+ IPG 
Sbjct: 71  YSYDYYYNRFHFCQPEKVEKQPESLGSVIFGDRIYNSPFQLNMLQEKECESLCKTVIPGD 130

Query: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186
           DAKFIN LIK+GFFQNWL+DGLPAAR+ YD RTKT++YG GF LGF  V Q  D +A P 
Sbjct: 131 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTSFYGAGFNLGFVQVTQGTDIEATPK 190

Query: 187 TMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGV 246
                 +E +++DV L+ R  +N    +VKT ELPYF NHFDI +E+HDRG  NYRVVGV
Sbjct: 191 G-----AETTDKDVELETRNDRN----MVKTYELPYFANHFDIMIEYHDRGEGNYRVVGV 241

Query: 247 IVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDP 306
           IV PVSI+RSSPG C TTG PL+LDE  DNEVYFTYSVKF  S T WATRWDKYLH+YDP
Sbjct: 242 IVEPVSIKRSSPGTCETTGSPLMLDEGNDNEVYFTYSVKFNESATSWATRWDKYLHVYDP 301

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366
            IQWF                     RALKSD ARYNELNLD++F EDSGWKL HGDVFR
Sbjct: 302 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLDDDFQEDSGWKLNHGDVFR 361

Query: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426
           +PS+S+ LSILVGSG+QLFLMV CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY 
Sbjct: 362 SPSQSLTLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 421

Query: 427 SMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLW 486
           SMG+YKFF GPYWKAN+ILTP+L+PGAI L+I+ +NFFL+F HSSGVIPA +LFF++ LW
Sbjct: 422 SMGIYKFFNGPYWKANLILTPLLVPGAILLIIIALNFFLMFVHSSGVIPASTLFFMVFLW 481

Query: 487 FLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIA 546
           FL S+PLSFAGS++A K+C+WDEHPTKTNQIARQIP+QPWYL+T  ATLIAGIF FGSIA
Sbjct: 482 FLFSIPLSFAGSLIARKRCHWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 541

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFGF                    Y+SLCLENW WQWR FIIG
Sbjct: 542 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITYHSLCLENWKWQWRGFIIG 601

Query: 607 GLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           G GC++Y FIHSILFTKFKLGG  T+VLY+GYS +IS LCC+VTG+IGF SSM F+RKIY
Sbjct: 602 GAGCALYVFIHSILFTKFKLGGFTTIVLYVGYSSVISLLCCLVTGSIGFISSMLFVRKIY 661

Query: 667 SAIKVE 672
           S+IKV+
Sbjct: 662 SSIKVD 667

>NCAS0B04970 Chr2 complement(909770..911770) [2001 bp, 666 aa] {ON} 
          Length = 666

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/661 (68%), Positives = 534/661 (80%), Gaps = 7/661 (1%)

Query: 12  YATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDY 71
           + +LT+ F LPG++PTTYH GDEIPLLVN LTPS+YFQ  D  G   S +KEHFLYS+DY
Sbjct: 13  FLSLTRAFYLPGVAPTTYHEGDEIPLLVNHLTPSVYFQRTDANGK--SKNKEHFLYSFDY 70

Query: 72  YNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFI 131
           Y  R HFC+PEH+EKQPESLGS+IFGDRIYNSPF+L MLEEK CV+LCKSTIPGKDAKFI
Sbjct: 71  YFDRLHFCKPEHIEKQPESLGSIIFGDRIYNSPFELKMLEEKTCVSLCKSTIPGKDAKFI 130

Query: 132 NTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEEL 191
           N LIK+GFFQNWL+DGLPAA + YD +TK+ +YGTGFELGF +  Q +DG+A P+T +  
Sbjct: 131 NKLIKNGFFQNWLIDGLPAATQVYDRKTKSEFYGTGFELGFVESFQAIDGQA-PATTKP- 188

Query: 192 TSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPV 251
             + +NE + L+ R  KNV+  +VK +E+ YFVNH+DI+VE+HDRG   YRVVGVIVNPV
Sbjct: 189 -KQTTNEGLELETREAKNVQ--MVKNIEIAYFVNHYDIQVEYHDRGEGTYRVVGVIVNPV 245

Query: 252 SIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWF 311
           SI+RS+PG C TTG PL+L ED DN+VYFTYSVKFV S+TVWATRWDKYLH YDP IQWF
Sbjct: 246 SIKRSTPGTCETTGDPLVLSEDADNDVYFTYSVKFVPSETVWATRWDKYLHTYDPTIQWF 305

Query: 312 XXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKS 371
                                +ALKSD ARYNE NL+++F ED+GWKLGHGDVFR P KS
Sbjct: 306 SLVNFSIIVLLLSSVVIHSLMKALKSDFARYNEFNLEDDFQEDAGWKLGHGDVFRIPHKS 365

Query: 372 MLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVY 431
           MLLS+LVGSG+QLFLM+ CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY SM VY
Sbjct: 366 MLLSVLVGSGVQLFLMISCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYTSMAVY 425

Query: 432 KFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSV 491
           KFF+GPYWK NM+LTP ++PG IFL IV +NFFL+FAHSSGV+PA +LFF+ILLWF+ S+
Sbjct: 426 KFFKGPYWKVNMLLTPFMIPGFIFLTIVGLNFFLMFAHSSGVVPAGTLFFMILLWFIFSI 485

Query: 492 PLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYF 551
           PL+FAGS++AHK+C WDEHPTKTNQIARQIP+QPWYL+T  AT+IAGIF FGSIAVELYF
Sbjct: 486 PLAFAGSLIAHKKCTWDEHPTKTNQIARQIPFQPWYLKTWPATMIAGIFPFGSIAVELYF 545

Query: 552 IYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCS 611
           IY+SLWFNKIFYMFGF                    Y+SLCLENW WQWR FI+GG+GC+
Sbjct: 546 IYTSLWFNKIFYMFGFLLFSFLLLTLTTSLVTILITYHSLCLENWQWQWRGFIVGGVGCA 605

Query: 612 IYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKV 671
           IY F+HSILFTKFKLGG  T+VLY+GYS +IS L CVVTGAIGF SS+ F+RKIYSAIKV
Sbjct: 606 IYVFVHSILFTKFKLGGFATIVLYVGYSTMISLLFCVVTGAIGFLSSLIFVRKIYSAIKV 665

Query: 672 E 672
           +
Sbjct: 666 D 666

>Skud_12.151 Chr12 complement(277467..279461) [1995 bp, 664 aa] {ON}
           YLR083C (REAL)
          Length = 664

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/666 (68%), Positives = 529/666 (79%), Gaps = 8/666 (1%)

Query: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66
           LL+Y + + TK F LPG++PTTY   DEIPLLVN LTPS+Y+QH+DE+GN VSGDKE+FL
Sbjct: 7   LLLYFFVSATKAFYLPGVAPTTYKENDEIPLLVNHLTPSMYYQHEDEQGNSVSGDKENFL 66

Query: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126
           YSYDYY  RFHFCRP+HVEKQPESLGSVIFGDRIYNSPF+LNML+EKECV LC +TIPG 
Sbjct: 67  YSYDYYYDRFHFCRPKHVEKQPESLGSVIFGDRIYNSPFELNMLQEKECVPLCNTTIPGN 126

Query: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186
           DAKFIN LIK+GFFQNWL+DGLPAAR+ YD RTKTN+YG GFELG  +V Q    K  P 
Sbjct: 127 DAKFINKLIKNGFFQNWLIDGLPAAREVYDGRTKTNFYGAGFELGDVEVSQGTRSKTAPK 186

Query: 187 TMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGV 246
                 +E +NE + L  R       ++V+T E PYF NHFDI +E+HDRG  +YRVVGV
Sbjct: 187 Q-----AETTNEGLELGTRAEDY---SIVETFEHPYFANHFDIMIEYHDRGGGDYRVVGV 238

Query: 247 IVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDP 306
           IVNP+SI+RS  G C T   PLILDE++DNEV FTYSVKF  S T WATRWDKYLH+YDP
Sbjct: 239 IVNPLSIKRSITGTCETDASPLILDEERDNEVSFTYSVKFKESATSWATRWDKYLHVYDP 298

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366
            IQWF                     RALKSD ARYNELNL+++F EDSGWKL HGDVFR
Sbjct: 299 SIQWFSLINFSLVVVLLSSVVIHSLLRALKSDFARYNELNLEDDFQEDSGWKLNHGDVFR 358

Query: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426
            PS S+LLSILVGSG+QLFLMV CSIFFAA+G +SP SRGSL TVMF+LYALFGFVGSY 
Sbjct: 359 PPSHSLLLSILVGSGVQLFLMVTCSIFFAALGFLSPSSRGSLATVMFILYALFGFVGSYT 418

Query: 427 SMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLW 486
           SMG+YKFF GPYWKAN++LTP+L+PGAI L+IV +NFFL+  HSSGVIPAR+LFF++ LW
Sbjct: 419 SMGIYKFFNGPYWKANLLLTPLLVPGAILLIIVALNFFLMVVHSSGVIPARTLFFMVFLW 478

Query: 487 FLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIA 546
           FL S+PLSF GS++A K+C WDEHPTKTNQIARQIP+QPWYL+T  ATLIAGIF FGSIA
Sbjct: 479 FLFSIPLSFGGSLIARKKCGWDEHPTKTNQIARQIPFQPWYLKTIPATLIAGIFPFGSIA 538

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIG 606
           VELYFIY+SLWFNKIFYMFGF                    Y+SLCLENW WQWR FI+G
Sbjct: 539 VELYFIYTSLWFNKIFYMFGFLFFSFLLLTLTTSLVTILITYHSLCLENWKWQWRGFIVG 598

Query: 607 GLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           G+GC++Y FIHSILFTKFKLGG +T+VLY+GYS +IS LCC+VTG+IGF SSMFF+R+IY
Sbjct: 599 GVGCALYVFIHSILFTKFKLGGFVTIVLYVGYSYVISLLCCLVTGSIGFISSMFFLRRIY 658

Query: 667 SAIKVE 672
           S+IKV+
Sbjct: 659 SSIKVD 664

>KAFR0B02680 Chr2 complement(537048..539042) [1995 bp, 664 aa] {ON}
           Anc_8.254 YLR083C
          Length = 664

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/657 (68%), Positives = 534/657 (81%), Gaps = 7/657 (1%)

Query: 16  TKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKR 75
           T+ F LPG++PTTYH GDEIPLLVN L+PS+Y+QH+++EG DVS DK  +LYSYDYY  R
Sbjct: 15  TRAFYLPGVAPTTYHEGDEIPLLVNHLSPSMYWQHKNDEGKDVSSDKNKYLYSYDYYYDR 74

Query: 76  FHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLI 135
           FHFC+PE +EKQPESLGS++FGDRIYNSPFQLNMLEEK+C +LCKSTIPG DAKFIN LI
Sbjct: 75  FHFCQPEKIEKQPESLGSIMFGDRIYNSPFQLNMLEEKQCASLCKSTIPGNDAKFINKLI 134

Query: 136 KSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEA 195
           K+GFFQNWL+DGLPAA +A+D+RT T++YG+GFELG  DV Q VD      T       A
Sbjct: 135 KNGFFQNWLIDGLPAAHEAHDTRTGTDFYGSGFELGLVDVVQAVD-----ETEARTKVAA 189

Query: 196 SNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIER 255
           +N+   LDAR  KNVK   +K VEL YFVNH+DI +E+HDRGN +YRVVGVIVNPVSI+R
Sbjct: 190 ANQGAELDARDAKNVKT--IKNVELVYFVNHYDIRIEYHDRGNGDYRVVGVIVNPVSIQR 247

Query: 256 SSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFXXXX 315
           SSPG+C +TG+PL L ED+DN+VYFTYSV FV S+T WATRWDKYLH+YDP IQWF    
Sbjct: 248 SSPGSCESTGQPLTLQEDEDNDVYFTYSVTFVPSETSWATRWDKYLHVYDPTIQWFSLVN 307

Query: 316 XXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLS 375
                            +ALK+D ARYNE NLD+EF ED+GWKL HGDVFR P KSMLLS
Sbjct: 308 FSLIVLLLSTVVLHSLLKALKNDFARYNEFNLDDEFQEDAGWKLCHGDVFRIPHKSMLLS 367

Query: 376 ILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFR 435
           +LVGSG+QLF+M+  +IFFAA+G +SP SRG L TVMF+LYALFGFVGSY SMGVYKFFR
Sbjct: 368 VLVGSGVQLFIMISTTIFFAALGFLSPSSRGLLGTVMFMLYALFGFVGSYTSMGVYKFFR 427

Query: 436 GPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSF 495
           GPYWKANM+LTPIL+PG+IF+ I+ MNFFL++ HSSGVIPA++LFF++LLWF+ S+P +F
Sbjct: 428 GPYWKANMVLTPILVPGSIFITIIAMNFFLMYVHSSGVIPAKTLFFMVLLWFVFSIPSAF 487

Query: 496 AGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSS 555
           AGS+VA+K+CNW+EHPTKT QIARQIP+QPWYL+T  AT IAGIF FGSIAVE+YFIY+S
Sbjct: 488 AGSLVANKKCNWNEHPTKTEQIARQIPFQPWYLKTIPATFIAGIFPFGSIAVEIYFIYTS 547

Query: 556 LWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIYTF 615
           LW+NKIFYMFGF                    Y+SLCLENW WQWRSFI+GG+GC+IY F
Sbjct: 548 LWYNKIFYMFGFLFVSLLLLALTTSLVTVLITYHSLCLENWNWQWRSFIVGGVGCAIYVF 607

Query: 616 IHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           IHSILFTKFKLGG  TVVLYLGYS IIS LCC+VTG+IGF SSMFF+RKI+S+IKV+
Sbjct: 608 IHSILFTKFKLGGFTTVVLYLGYSSIISLLCCIVTGSIGFLSSMFFVRKIFSSIKVD 664

>Kpol_543.35 s543 complement(78246..80222) [1977 bp, 658 aa] {ON}
           complement(78246..80222) [1977 nt, 659 aa]
          Length = 658

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/672 (64%), Positives = 516/672 (76%), Gaps = 15/672 (2%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           M + ++ L+  Y  LT  F LPG++PTTY  GDEIPLLVN LTPS+ FQH+D++GND+ G
Sbjct: 2   MMKTIFCLLSVYLALTSAFYLPGVAPTTYGKGDEIPLLVNHLTPSLNFQHKDDQGNDIKG 61

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           +KEHFLYS+DYY  + HFC+PEHVEKQPESLGS++FGDRIYNSPF + MLE +EC +LCK
Sbjct: 62  NKEHFLYSFDYYFPKLHFCKPEHVEKQPESLGSILFGDRIYNSPFSIKMLENQECTSLCK 121

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVD 180
            TIP  DAKFIN LIK+GFFQNWL+DGLPAARK +D +TK+++YGTGF LG   V+Q V 
Sbjct: 122 VTIPADDAKFINKLIKNGFFQNWLIDGLPAARKLHDVKTKSDFYGTGFPLGNVHVRQAVG 181

Query: 181 GKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDN 240
           G A        +S+ + E+    AR  KNV  N+V  VE+P+  NH+DI VE+HDRG  N
Sbjct: 182 GLA--------SSKLNLEN---PAREAKNVN-NMVHNVEIPFLFNHYDINVEYHDRGEGN 229

Query: 241 YRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKY 300
           YRVVGV V+P S   S+   C+     LIL E +DNEV F+YSV+F+ S+TVWATRWDKY
Sbjct: 230 YRVVGVTVDPKS---STGDICTKKSGGLILLETEDNEVQFSYSVRFIPSETVWATRWDKY 286

Query: 301 LHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLG 360
           LH+YDP IQWF                     RALKSD ARY E NLD+ F +DSGWKLG
Sbjct: 287 LHVYDPTIQWFSLINFSVVVILLSMVVIHSLMRALKSDFARYEEFNLDDTFQQDSGWKLG 346

Query: 361 HGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFG 420
           HGDVFR P KSMLLSILVGSG QLFLMV  SIFFAA+G++SP SRGSLP+ MF+LYALFG
Sbjct: 347 HGDVFRIPDKSMLLSILVGSGTQLFLMVAVSIFFAAIGILSPSSRGSLPSAMFILYALFG 406

Query: 421 FVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLF 480
           F GSY SMGVYKFF GPYWKANMILTPIL+PG +F+ IV +NFFLLF+ SSG IP  +L 
Sbjct: 407 FCGSYVSMGVYKFFNGPYWKANMILTPILVPGLLFISIVGLNFFLLFSRSSGTIPPTALI 466

Query: 481 FIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIF 540
           F+I+LWF++S+PLS AGS++A+K+CNW EHPTKTN+IARQIP+QPWYL+T  ATLIAG+F
Sbjct: 467 FVIVLWFIISIPLSLAGSLIANKKCNWGEHPTKTNEIARQIPFQPWYLKTVPATLIAGLF 526

Query: 541 SFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQW 600
            FGSIAVELYFIYSSLWFNKIFYMFGF                    YYSL LENW WQW
Sbjct: 527 PFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTTLVTILITYYSLNLENWRWQW 586

Query: 601 RSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMF 660
           RSFI+GG+GC+ Y F+HSI+FTKFKLGG  T+VLY+GYSLIISALC VVTGAIGF SSM 
Sbjct: 587 RSFIVGGVGCAFYIFVHSIIFTKFKLGGFTTIVLYVGYSLIISALCAVVTGAIGFISSML 646

Query: 661 FIRKIYSAIKVE 672
           F++KIYS++KV+
Sbjct: 647 FVKKIYSSVKVD 658

>KNAG0G01990 Chr7 complement(441326..443329) [2004 bp, 667 aa] {ON}
           Anc_8.254 YLR083C
          Length = 667

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/670 (65%), Positives = 521/670 (77%), Gaps = 12/670 (1%)

Query: 4   GVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKE 63
           G+ LL  C       F LPG++PTTY + DEIPLLVN L+PS+Y+QH+ E+G ++ GDK 
Sbjct: 9   GLALLWAC--GQVNAFYLPGVAPTTYKANDEIPLLVNHLSPSMYWQHETEDGENMKGDKS 66

Query: 64  HFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTI 123
            +LYSYDYY  RFHFC+PE + K+PESLGS+IFGDRIYNSP+Q+ MLEEK CV LC + I
Sbjct: 67  RYLYSYDYYYDRFHFCQPEKIVKEPESLGSIIFGDRIYNSPYQIKMLEEKTCVPLCNTII 126

Query: 124 PGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTV-DGK 182
           PGKDA+FIN LIK+GFFQNWL+DGLPAAR  +D  T +++YG GFELG  +V Q V   K
Sbjct: 127 PGKDAEFINKLIKNGFFQNWLIDGLPAARVVHDKSTNSDFYGNGFELGSVEVVQAVAQAK 186

Query: 183 AVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYR 242
             P   +  +++ S  D        KNV+  ++K VELPYF NH DI VE+HDRG  N R
Sbjct: 187 THPKEDDSGSAKLSTRDA-------KNVQ--MLKNVELPYFANHHDITVEYHDRGEGNLR 237

Query: 243 VVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLH 302
           VVGV V+P+SI+RSSPG C T+G PL+LDE  DNEVYFTYSV+FVASDTVWATRWDKYLH
Sbjct: 238 VVGVTVDPISIKRSSPGTCQTSGDPLMLDEKNDNEVYFTYSVRFVASDTVWATRWDKYLH 297

Query: 303 IYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHG 362
            YDP IQWF                     +AL+SD ARYNELNLDNEF EDSGWKL HG
Sbjct: 298 TYDPTIQWFSLVNFSIVVVLLSSVVIHMLLKALRSDFARYNELNLDNEFQEDSGWKLTHG 357

Query: 363 DVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFV 422
           DVFR PSKSMLLSILVGSG+QLFLM+  SIFFAA+G +SP SRGSL TVMF+LYALFGFV
Sbjct: 358 DVFRIPSKSMLLSILVGSGIQLFLMISVSIFFAALGFLSPSSRGSLGTVMFMLYALFGFV 417

Query: 423 GSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFI 482
           GSY SMGVYKFFRGPYWKANMILTP+L+PG + L IV +N FLL AHSSG IPA++LFFI
Sbjct: 418 GSYTSMGVYKFFRGPYWKANMILTPLLVPGCLLLSIVGLNMFLLGAHSSGTIPAKTLFFI 477

Query: 483 ILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSF 542
           +LLWF++SVP + AGS++AHK+C+WDEHPTKTNQ+ARQ+P+QPWYL+T  AT IAGIF F
Sbjct: 478 VLLWFVISVPSALAGSLIAHKKCSWDEHPTKTNQVARQVPFQPWYLKTVAATFIAGIFPF 537

Query: 543 GSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRS 602
           GSIAVELYFIY+SLW+NKIFYMFGF                    Y+SL LENW WQWRS
Sbjct: 538 GSIAVELYFIYTSLWYNKIFYMFGFLFVSFLLLTLTTVLVTILITYHSLSLENWQWQWRS 597

Query: 603 FIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFI 662
           FI+GG+GC+IY F+HSILFTK KLGG +T+VLY+GYS +IS LCC+VTG+IGF SSMFF+
Sbjct: 598 FIVGGVGCAIYMFVHSILFTKLKLGGFVTIVLYVGYSAVISLLCCLVTGSIGFLSSMFFV 657

Query: 663 RKIYSAIKVE 672
           R+IYS+IKVE
Sbjct: 658 RRIYSSIKVE 667

>CAGL0B01683g Chr2 complement(154275..156350) [2076 bp, 691 aa] {ON}
           highly similar to uniprot|Q04562 Saccharomyces
           cerevisiae YDR107c or uniprot|P32802 Saccharomyces
           cerevisiae YLR083c EMP70
          Length = 691

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/686 (61%), Positives = 511/686 (74%), Gaps = 20/686 (2%)

Query: 7   LLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFL 66
           L++  +   T GF LPG +P TY  GD IPLLVN LTPS+ FQH D++GN++ GDK   L
Sbjct: 6   LVLSLFVASTLGFYLPGAAPRTYKQGDAIPLLVNHLTPSLNFQHVDDDGNEIKGDKARML 65

Query: 67  YSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126
           Y YDYYN++ HFC+PE +EKQPESLGSVIFG++IYNSPF + MLE+ ECV LC +TIPGK
Sbjct: 66  YPYDYYNEKLHFCQPEKIEKQPESLGSVIFGEKIYNSPFNVKMLEDNECVQLCSTTIPGK 125

Query: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186
           DAKFIN LIK+GF QNWL+DGLPAARK +DSRT T +YG GFELGF +V+Q V GK V  
Sbjct: 126 DAKFINKLIKNGFMQNWLIDGLPAARKLHDSRTNTEFYGQGFELGFVEVRQAVGGKIVSE 185

Query: 187 TMEELT-SEASNEDVI------------------LDARLPKNVKPNLVKTVELPYFVNHF 227
           + +EL  SE   +++I                  L+ R  KNV  N+V  VE+P F NHF
Sbjct: 186 SEKELQLSERDAKNIIDFTDIEIRSPKNLVDLSNLEVREAKNVVDNIVTNVEVPVFANHF 245

Query: 228 DIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGK-PLILDEDKDNEVYFTYSVKF 286
           DIEVE+HDRGN ++RVVGVIVNPVS++     +C+   +  L LDE+KDNEV FTYSVKF
Sbjct: 246 DIEVEYHDRGNGDFRVVGVIVNPVSLDNYKSRSCALANQHKLHLDENKDNEVMFTYSVKF 305

Query: 287 VASDTVWATRWDKYLHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELN 346
             SDT WATRWDKYLHIYDP+IQWF                     RALKSD++RYNE N
Sbjct: 306 TPSDTPWATRWDKYLHIYDPKIQWFSLINFSVIVLLLSSVAIHSLLRALKSDISRYNEFN 365

Query: 347 LDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRG 406
           L +EF EDSGWKL HGDVFRTP  SMLLS+LVGSG+QLFLM+  SI  +A+G++SP SRG
Sbjct: 366 LGDEFEEDSGWKLVHGDVFRTPKNSMLLSVLVGSGIQLFLMIFLSIILSALGILSPSSRG 425

Query: 407 SLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLL 466
           SLPT MF+ YA+FGFVGSY SMG+YKFF+GPYWKANMILTP+LLPG IFL ++ MN  L 
Sbjct: 426 SLPTAMFMFYAIFGFVGSYTSMGIYKFFKGPYWKANMILTPVLLPGIIFLTVIFMNVLLY 485

Query: 467 FAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPW 526
           F  SS VIP  +L F++ LW L S+PL+FAGS++++K+CNWDEHPTKTN+I RQIP+QPW
Sbjct: 486 FVGSSNVIPLATLVFMVFLWILFSIPLAFAGSLISYKKCNWDEHPTKTNEIPRQIPFQPW 545

Query: 527 YLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXX 586
           +L+T  ATLI G+ SFGSIAVELYFIYSSLWFNKIFYMFGF                   
Sbjct: 546 FLKTVPATLIGGLVSFGSIAVELYFIYSSLWFNKIFYMFGFLLFSIVLFSFTTGLINVII 605

Query: 587 XYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALC 646
            Y +LC ENW WQWRSF IGGLGCSIY FIHSILFT+FKLGG  T+VLY+GYS +IS L 
Sbjct: 606 TYRALCSENWTWQWRSFFIGGLGCSIYIFIHSILFTQFKLGGFATIVLYVGYSFLISFLT 665

Query: 647 CVVTGAIGFFSSMFFIRKIYSAIKVE 672
           C+VTGAIGF  SMFF+R+I+++IKV+
Sbjct: 666 CIVTGAIGFICSMFFVRRIFASIKVD 691

>ZYRO0C01848g Chr3 (146621..148564) [1944 bp, 647 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 647

 Score =  891 bits (2302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/667 (65%), Positives = 515/667 (77%), Gaps = 26/667 (3%)

Query: 7   LLIYCYAT-LTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHF 65
           LL  C  T L K F LPG++PTTYHS DEI LLVN LTPS+ FQH+DE+GN V GDKEH+
Sbjct: 6   LLFVCLLTSLVKAFYLPGVAPTTYHSNDEIQLLVNHLTPSMNFQHEDEDGNMVKGDKEHY 65

Query: 66  LYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPG 125
           LYSYDYY  +FHFC+PE+V +QP SLGSVIFGDRI+NSPF+LNMLEEKECV LC S IPG
Sbjct: 66  LYSYDYYYSKFHFCKPENVVRQPASLGSVIFGDRIFNSPFKLNMLEEKECVPLCSSRIPG 125

Query: 126 KDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVP 185
           +DAKF+N LIK+GF QNWL+DGLPA R+ +DSRT +N+YGTGF+LGF DV +        
Sbjct: 126 EDAKFVNKLIKNGFMQNWLIDGLPAGREIHDSRTNSNFYGTGFQLGFVDVTEGF------ 179

Query: 186 STMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVG 245
                  S++++E+              ++KT+E+PY  NH+DI +E+HDRGNDNYRVVG
Sbjct: 180 -------SDSNDEE------------KKIMKTLEVPYLANHYDINIEYHDRGNDNYRVVG 220

Query: 246 VIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYD 305
           V V+PVSI+RSS  +C      L L E ++NEV+FTYSVKF+ SDTVWATRWDKYLH+YD
Sbjct: 221 VTVDPVSIKRSSSDSCQYNSGSLTLSETEENEVHFTYSVKFIKSDTVWATRWDKYLHVYD 280

Query: 306 PQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF 365
           P IQWF                     RALK+DL+RYNE NLDNEFHEDSGWKL HGDVF
Sbjct: 281 PTIQWFSLINCSVIVVALSSVVLHMLLRALKNDLSRYNEFNLDNEFHEDSGWKLSHGDVF 340

Query: 366 RTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSY 425
           R P +S+LLSILVGSG+QLFLM+ CSI FAA+G +SP SRGSLPTVMF+LYALFGFVGSY
Sbjct: 341 RIPPRSLLLSILVGSGVQLFLMIACSIIFAALGFLSPSSRGSLPTVMFLLYALFGFVGSY 400

Query: 426 ASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILL 485
            SM +YKFF+GP WK N++LTP+L+PG IF+ I+++NFFL+F  SSG IPA +LF IILL
Sbjct: 401 TSMAIYKFFKGPLWKVNLLLTPVLVPGGIFVTIILLNFFLVFVRSSGAIPAGTLFTIILL 460

Query: 486 WFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSI 545
           WF+ S+PLSFAGS++AHK+C  D HPTKTNQIARQIP QPWYL+T   +LIAG+F F SI
Sbjct: 461 WFVFSIPLSFAGSLIAHKRCRLDNHPTKTNQIARQIPIQPWYLKTIPVSLIAGVFPFASI 520

Query: 546 AVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFII 605
           AVELYFIY+SLWFNKIFYMFGF                    Y+SLCLENW WQWRSFII
Sbjct: 521 AVELYFIYTSLWFNKIFYMFGFLLFSFLLLTFTTALVTILTTYHSLCLENWKWQWRSFII 580

Query: 606 GGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665
           GG GC+IY FIHSILFTKFKLGG  TVVLYLGYS +IS LCC+VTG+IGF SSMFFIRKI
Sbjct: 581 GGCGCAIYVFIHSILFTKFKLGGFTTVVLYLGYSGLISVLCCIVTGSIGFISSMFFIRKI 640

Query: 666 YSAIKVE 672
           YS++KV+
Sbjct: 641 YSSVKVD 647

>SAKL0H17248g Chr8 (1530599..1532581) [1983 bp, 660 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 660

 Score =  864 bits (2232), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/658 (62%), Positives = 492/658 (74%), Gaps = 9/658 (1%)

Query: 15  LTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNK 74
           +   F LPG++PTTYH GDEIPLLVN LTPS YFQH D+EG+ +SGDKE FLYSYDYY  
Sbjct: 12  IASAFYLPGVAPTTYHKGDEIPLLVNHLTPSTYFQHADQEGHTMSGDKERFLYSYDYYYD 71

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTL 134
           +FHFCRPE++ KQPESLGS+IFGDRIYNSPF+LNMLE K CV LCKS IP  DAKFIN L
Sbjct: 72  KFHFCRPENLIKQPESLGSIIFGDRIYNSPFELNMLENKTCVPLCKSEIPKDDAKFINKL 131

Query: 135 IKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSE 194
           I++GFF NWLVDGLPAAR+ +D RT + +YG GFELGF DV  T++        +  T +
Sbjct: 132 IRNGFFHNWLVDGLPAAREMHDGRTNSYFYGNGFELGFVDVVDTIE--------DPDTKK 183

Query: 195 ASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIE 254
            S  D I  A   K +K    K  EL YF+NHFDI++E+HDRG DNYRVVGV V P SI+
Sbjct: 184 VSESDYIEIADADKELKERSAKLTELSYFINHFDIKIEYHDRGEDNYRVVGVSVIPASIK 243

Query: 255 RSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFXXX 314
           R S  +C T G+PL+L ED DN V+FTYSV FV S T+WATRWDKYLH+YDPQIQWF   
Sbjct: 244 RDSSDSCDTEGEPLVLSEDADNTVHFTYSVSFVPSQTLWATRWDKYLHVYDPQIQWFSLI 303

Query: 315 XXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLL 374
                             RALK+DL+RYNELNLD+EF E++GWKL HGDVFRTP ++MLL
Sbjct: 304 SFSLIVILLSSVMVHSLFRALKNDLSRYNELNLDDEFQEETGWKLVHGDVFRTPERTMLL 363

Query: 375 SILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFF 434
           S+LVGSG QLFLM   +I FA +GL+SP SRGSL TVMF+LYALFG  GSY SM VYKFF
Sbjct: 364 SVLVGSGAQLFLMAGFTILFALLGLLSPSSRGSLTTVMFILYALFGSFGSYTSMAVYKFF 423

Query: 435 RGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLS 494
            G  WK NMILTPIL+P  IF+ ++ +N FL+F HSSG IP  ++  I++LWF+ S+PLS
Sbjct: 424 NGQNWKLNMILTPILIPSMIFISMLGLNTFLVFVHSSGAIPFGTMLAIVVLWFVFSIPLS 483

Query: 495 FAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYS 554
            AGSI++ K+  WD  PT TNQIARQIP+QPWYL+T  A+LIAG F FGSI VELYFIYS
Sbjct: 484 VAGSIISRKKSQWDR-PTNTNQIARQIPFQPWYLKTVPASLIAGTFPFGSIVVELYFIYS 542

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIYT 614
           SLWFNKIFYMFGF                    YYSLC+ENW WQWR F IGG GC+ Y 
Sbjct: 543 SLWFNKIFYMFGFLFFSFLLLTLTTTLVTVLLTYYSLCMENWKWQWRGFWIGGAGCAFYV 602

Query: 615 FIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           F+H+ILFTKFKLGG+ TVVLYLGYS++IS LCC++TGA+GF SS++F+RKIY +IKV+
Sbjct: 603 FVHAILFTKFKLGGLTTVVLYLGYSVVISGLCCLITGAVGFLSSLWFVRKIYGSIKVD 660

>TBLA0E04370 Chr5 complement(1108954..1110984) [2031 bp, 676 aa]
           {ON} Anc_8.254 YLR083C
          Length = 676

 Score =  854 bits (2206), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/667 (60%), Positives = 497/667 (74%), Gaps = 6/667 (0%)

Query: 11  CYATL--TKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYS 68
           C  TL  T GF LPG++PTTYH  D IPLLVN LTPS++F+H+D +GN++S DKE+FLYS
Sbjct: 11  CLITLSVTNGFYLPGVAPTTYHELDSIPLLVNHLTPSMFFKHKDSDGNELSSDKENFLYS 70

Query: 69  YDYYNKRFHFCRP--EHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGK 126
           YDYY  + HFC+P    ++KQPESLGS++FGDRIYNSPF+L ML ++ C  LC + IPG 
Sbjct: 71  YDYYYSKLHFCKPLDREIKKQPESLGSILFGDRIYNSPFELKMLVDENCKELCSTNIPGD 130

Query: 127 DAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPS 186
           DAKFIN LIKSGF QNWL+DGLPAAR+ YD  TK+++YG+GFELG  ++ Q VD     +
Sbjct: 131 DAKFINDLIKSGFLQNWLIDGLPAARQLYDQTTKSSFYGSGFELGSVEMIQVVDEAPSHT 190

Query: 187 TMEE-LTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVG 245
           T ++ +  +  ++++  +    K     LV +VE  YF NHFDI +E+HDRGN+ YR+VG
Sbjct: 191 TPKQPIVEDVLSQELDEEQATEKRANQMLVSSVERTYFANHFDIHIEYHDRGNNEYRIVG 250

Query: 246 VIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYD 305
           V VNP+S++R S   C T    L L E  D +V FTYSV F  SDTVWATRWDKYLHIYD
Sbjct: 251 VTVNPISMKRDS-AICDTNLGKLALSEVSDTDVIFTYSVTFEKSDTVWATRWDKYLHIYD 309

Query: 306 PQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF 365
           P IQWF                     +ALK+D  RYNE NL++ F EDSGWKL HGDVF
Sbjct: 310 PTIQWFSLINFTVIVVVLSIIVVHFLTKALKNDFVRYNEFNLNDSFDEDSGWKLAHGDVF 369

Query: 366 RTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSY 425
           R P+KSMLLSI VGSG QLF M+   +  AA+G +SP +RGSLPT+MF+LYA+FGFVGSY
Sbjct: 370 RIPTKSMLLSIFVGSGTQLFFMISSVLVLAALGFLSPSARGSLPTIMFILYAVFGFVGSY 429

Query: 426 ASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILL 485
            SMGVY+FF GPYWKANMILTP+++PG IF+ I+ MN FL+F HSS V+P  +L  ++LL
Sbjct: 430 TSMGVYRFFNGPYWKANMILTPLIVPGGIFMFIISMNLFLVFVHSSDVVPIGTLSLMVLL 489

Query: 486 WFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSI 545
           W ++S+PLSFAGS+++ K+C W +HPTKTN++ RQIP+QPWYL+T  ATLI GIF FGSI
Sbjct: 490 WIVLSLPLSFAGSLISFKRCTWYDHPTKTNEVLRQIPFQPWYLKTVPATLIGGIFPFGSI 549

Query: 546 AVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFII 605
           AVELYFIYSSLWFNKIFYMFGF                    Y+SLCLENW WQWRSFII
Sbjct: 550 AVELYFIYSSLWFNKIFYMFGFLLVSFLLLTMTTSLVTIIVTYHSLCLENWRWQWRSFII 609

Query: 606 GGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665
           GG+GCSIY FIHSILFT+FKLGG IT+VLY+GYS +I+ LC +VTGAIGF S+MFF++KI
Sbjct: 610 GGIGCSIYIFIHSILFTEFKLGGFITIVLYVGYSALIAILCAMVTGAIGFISNMFFVKKI 669

Query: 666 YSAIKVE 672
           YS+IKVE
Sbjct: 670 YSSIKVE 676

>KLLA0F18931g Chr6 complement(1734636..1736633) [1998 bp, 665 aa]
           {ON} similar to uniprot|P32802 Saccharomyces cerevisiae
           YLR083C EMP70 Protein whose 24kDa cleavage product is
           found in endosome-enriched membrane fractions predicted
           to be a transmembrane protein
          Length = 665

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/660 (59%), Positives = 500/660 (75%), Gaps = 11/660 (1%)

Query: 13  ATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYY 72
           + L + F LPG++PTTYH GD++PLLVN LTPS +++H D + +D +GDKE FLYSYDYY
Sbjct: 17  SLLVEAFYLPGVAPTTYHEGDDLPLLVNHLTPSQFYKHYDTDQHD-TGDKEGFLYSYDYY 75

Query: 73  NKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFIN 132
            K+FHFC+P  ++KQPESLGS+IFGDRIYNSPF+L +L+  EC +LCKS IPGKDAKFIN
Sbjct: 76  YKKFHFCQPAELKKQPESLGSIIFGDRIYNSPFKLQLLKNVECQSLCKSVIPGKDAKFIN 135

Query: 133 TLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELT 192
            LI +GFFQNW++DGLPAARK  D++T   +YG GFELG  DV    +    P T     
Sbjct: 136 KLILNGFFQNWIIDGLPAARKMEDTKTNKIFYGNGFELGLVDVLSDYE----PDT----- 186

Query: 193 SEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVS 252
             + ++++ L     KNV     K  E+PYFVNH+DI++E+HDRG +NYR+VGV VNP S
Sbjct: 187 -RSLHDELELQLNAKKNVLSPGDKVTEIPYFVNHYDIQIEYHDRGENNYRIVGVTVNPAS 245

Query: 253 IERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFX 312
           I+R SP +C +TGK L+L E +DNEVYFTYSVKF+ SDTVWATRWDKYLH+YDP+IQWF 
Sbjct: 246 IKRDSPDSCESTGKSLVLSETEDNEVYFTYSVKFIKSDTVWATRWDKYLHVYDPKIQWFS 305

Query: 313 XXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSM 372
                                ALK+DLARYNELNLD +F E++GWKL HGDVFR+P+K++
Sbjct: 306 LINFSTIVVLLSSVMLHSLYSALKNDLARYNELNLDTDFEEETGWKLIHGDVFRSPNKAL 365

Query: 373 LLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYK 432
           LLS+LVGSG QL LM+  +I FA +G +SP SRGSL TVMF+LYA+FG  GS+ SM  YK
Sbjct: 366 LLSVLVGSGGQLALMLTTTILFACLGFLSPSSRGSLSTVMFLLYAIFGSFGSFTSMATYK 425

Query: 433 FFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVP 492
           FF G  W+ N++LTP+L+PG+I  +++ +NFFL+F HSSG IP +++  ++LLWF++S+P
Sbjct: 426 FFNGKAWRLNLVLTPLLVPGSILTVVLGLNFFLIFVHSSGAIPFQTMLVLVLLWFVISIP 485

Query: 493 LSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFI 552
           LS  GS++A K+CNW+EHPTKTNQIARQIP+QPWYL+T    L+AGIF FGSIAVELYFI
Sbjct: 486 LSAIGSVIAWKKCNWNEHPTKTNQIARQIPFQPWYLKTIPVALLAGIFPFGSIAVELYFI 545

Query: 553 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSI 612
           YSSLWFNKI+YMFGF                    Y+SLC+ENW WQWRSF+IGG GC+ 
Sbjct: 546 YSSLWFNKIYYMFGFLFFSFILLALTTSLITVLLTYHSLCMENWKWQWRSFVIGGCGCAF 605

Query: 613 YTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           Y F HSILFTKF+LGG+ T+VLYLGYS++IS LCC+VTGAIGF SS+  +RKIYS +KV+
Sbjct: 606 YVFCHSILFTKFRLGGLTTIVLYLGYSILISGLCCLVTGAIGFLSSLILVRKIYSCVKVD 665

>Kwal_56.23577 s56 complement(605281..607332) [2052 bp, 683 aa] {ON}
           YLR083C (EMP70) - endosomal membrane protein [contig
           176] FULL
          Length = 683

 Score =  843 bits (2177), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/671 (60%), Positives = 504/671 (75%), Gaps = 12/671 (1%)

Query: 13  ATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYY 72
           A+  +GF LPG++PTTYH GD IPLLVN LTPS+YF+H D++G D +GD+E FLYSYDYY
Sbjct: 14  ASRVEGFYLPGVAPTTYHEGDSIPLLVNHLTPSMYFKHVDDDGKD-TGDRESFLYSYDYY 72

Query: 73  NKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFIN 132
             +FHFC+PE +EKQ ESLGS+IFGDRIYNSPF+L ML++KEC ALC S IP  DAKFIN
Sbjct: 73  YDKFHFCKPEKLEKQRESLGSIIFGDRIYNSPFKLEMLKDKECEALCSSKIPANDAKFIN 132

Query: 133 TLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDV---KQTVDGKAVPSTME 189
            LI +GFFQNWLVDGLPAARK  D RTK+ +Y  GFELGF DV   K  +DG+       
Sbjct: 133 KLIANGFFQNWLVDGLPAARKTTDERTKSEFYTPGFELGFIDVGGAKLRMDGQGEEDAHP 192

Query: 190 ELTSEASNEDVILD-------ARLPKNVKPN-LVKTVELPYFVNHFDIEVEFHDRGNDNY 241
           +  ++   +D  LD        +  K V P  LVK +E  YF NHF+IEV++HDRGN +Y
Sbjct: 193 KGATKPVAQDDYLDRPSKSKNEKRKKIVDPKELVKQLETAYFANHFNIEVQYHDRGNGDY 252

Query: 242 RVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYL 301
           RVVGVIVNP SI+R S  +C+ TG+ L L E+++  V+F+YSVKF  SDTVWATRWDKYL
Sbjct: 253 RVVGVIVNPQSIKRDSSNSCAATGELLKLSEEEETTVHFSYSVKFTPSDTVWATRWDKYL 312

Query: 302 HIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGH 361
           H+YDP+IQW+                     R L+ DL+RYN+LNLD++F E++GWKL H
Sbjct: 313 HVYDPKIQWYSLINFSIVVIVLSSVVIHSLYRTLRDDLSRYNQLNLDDDFQEETGWKLVH 372

Query: 362 GDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGF 421
           GDVFRTP+KS+LLS+LVGSG QLF+M  C+I FA +GL+SP SRGSL TVMF+LYALFG 
Sbjct: 373 GDVFRTPTKSLLLSVLVGSGTQLFVMAACTIAFALLGLLSPSSRGSLTTVMFILYALFGS 432

Query: 422 VGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFF 481
           +GSY SM  YKFF G YWK NMILTPIL+PG +F +++ +NFFL+   S+G IP  ++  
Sbjct: 433 LGSYTSMATYKFFGGEYWKVNMILTPILVPGLLFCVVLGLNFFLIMVESAGAIPFGTMCA 492

Query: 482 IILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFS 541
           I+LLWF+ S+PLS AGS++A K+C W+EHPTKT QI RQIP+QPWYL+TA A LIAGIF 
Sbjct: 493 IVLLWFVFSIPLSLAGSLIAKKKCRWNEHPTKTRQIPRQIPFQPWYLKTAPAALIAGIFP 552

Query: 542 FGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWR 601
           FGSIAVELYF+YSSLWFNKIFYMFGF                    YYSLCLENW WQWR
Sbjct: 553 FGSIAVELYFVYSSLWFNKIFYMFGFLFVSFLLLTLTTALVTVLLTYYSLCLENWKWQWR 612

Query: 602 SFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFF 661
            F IGG GC++Y F+H+ILFTKFKLGG +T+VLY+GYSL+IS L C++TGA+GF SS++F
Sbjct: 613 GFWIGGAGCALYVFLHAILFTKFKLGGFVTIVLYVGYSLVISLLTCLITGAVGFMSSLWF 672

Query: 662 IRKIYSAIKVE 672
           +R+IYS+IKV+
Sbjct: 673 VRRIYSSIKVD 683

>NCAS0B03890 Chr2 (693950..695941) [1992 bp, 663 aa] {ON} Anc_8.254
          Length = 663

 Score =  837 bits (2161), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/665 (56%), Positives = 497/665 (74%), Gaps = 9/665 (1%)

Query: 8   LIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLY 67
           L++C  ++ + F+LPGL P TY  GD+IPLLVN LTPS++F H++EEG D+S  K++ ++
Sbjct: 8   LLFC-LSVVEAFNLPGLGPVTYQKGDDIPLLVNHLTPSMHFHHKNEEGKDISTAKKYVVH 66

Query: 68  SYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKD 127
           SYDYY ++FHFC+P H+EK   S+GS++FGDRIYNSPFQLNMLE K CV LC+S IPGKD
Sbjct: 67  SYDYYYEKFHFCQPVHIEKAGSSIGSILFGDRIYNSPFQLNMLENKTCVPLCESIIPGKD 126

Query: 128 AKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPST 187
           A+FIN LIK+G++QNW +DGLPAAR+ YD RTK+++YG GFELG  +++QT   K +P +
Sbjct: 127 AEFINKLIKNGYYQNWFIDGLPAAREVYDKRTKSSFYGNGFELGLVEIRQTTGDKLLPDS 186

Query: 188 MEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVI 247
           + +++         L  R  KN+  NL+K VE+PYFVNHFDI +E+H+RGN NYRVVG  
Sbjct: 187 VHDISD--------LAKRDAKNLVQNLIKEVEVPYFVNHFDIVIEYHERGNGNYRVVGAT 238

Query: 248 VNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQ 307
           VNPVSI R S G C+ TGK L L+E++DN V+ TYSV FV S T W TRWDKYLH+YDP+
Sbjct: 239 VNPVSIARKSAGDCTPTGKSLTLNEEEDNNVHSTYSVTFVPSKTSWVTRWDKYLHVYDPK 298

Query: 308 IQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRT 367
           IQWF                     +ALKSD ARYN +NLD++  E+SGWKL HG VFR 
Sbjct: 299 IQWFSLINFSLIVILLSVILINSLLKALKSDFARYNNINLDDDVKEESGWKLVHGYVFRI 358

Query: 368 PSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYAS 427
           P   M+LSILVGSG QLFL+++C++F AA+ ++SP+ RG+LPT M +LY LFGF+ SY S
Sbjct: 359 PKNPMILSILVGSGFQLFLVIVCTVFLAAIDILSPIYRGALPTAMIILYILFGFISSYVS 418

Query: 428 MGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWF 487
           MGVYKFF+GPYWK NM+LTPIL+PG I +  + +N FL+F+ SS V+PA+++  +ILLWF
Sbjct: 419 MGVYKFFKGPYWKVNMLLTPILVPGLIIITFLALNLFLMFSESSSVVPAKTIMTLILLWF 478

Query: 488 LVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAV 547
            VS+PLS AGS++A K+C+WDEHPT TNQIA+ IP Q WYL+T  A+LI G+FSFGSI+V
Sbjct: 479 AVSIPLSVAGSLMAQKKCHWDEHPTVTNQIAKVIPPQKWYLKTIPASLIGGLFSFGSISV 538

Query: 548 ELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGG 607
           +LYFIY+SLWFN IFYM+GF                    Y+SLC ENW WQWR F IGG
Sbjct: 539 QLYFIYTSLWFNNIFYMYGFLLFSICLFTMTITLVTILFTYHSLCQENWKWQWRGFFIGG 598

Query: 608 LGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYS 667
           LGCSIY  +HS+ F + KLGG   ++LY+GYS +++AL  +VTG++GF SSMFFI++I+S
Sbjct: 599 LGCSIYVLLHSLFFIELKLGGFTNILLYMGYSSVVTALIFLVTGSVGFLSSMFFIKRIFS 658

Query: 668 AIKVE 672
           ++KV+
Sbjct: 659 SVKVD 663

>KLTH0G13882g Chr7 (1204180..1206243) [2064 bp, 687 aa] {ON} similar
           to uniprot|P32802 Saccharomyces cerevisiae YLR083C EMP70
           Protein whose 24kDa cleavage product is found in
           endosome-enriched membrane fractions predicted to be a
           transmembrane protein
          Length = 687

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/689 (59%), Positives = 502/689 (72%), Gaps = 19/689 (2%)

Query: 1   MKRGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSG 60
           M   + LL   +A+   GF LPG++PTTYH GD IPLLVN LTP++Y+QH DE+GND+ G
Sbjct: 1   MVSAILLLSILWASQVSGFYLPGVAPTTYHEGDAIPLLVNHLTPTMYYQHADEDGNDL-G 59

Query: 61  DKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCK 120
           DKE  LYSYDYY  +FHFCRPE +EKQ ESLGS+IFGDRIYNSPFQ+ ML+ KEC +LC 
Sbjct: 60  DKESLLYSYDYYYPKFHFCRPEKLEKQRESLGSIIFGDRIYNSPFQIEMLKNKECASLCS 119

Query: 121 STIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQT-- 178
            +IP  DAKFIN LI +GFFQNWLVDGLPAARK  D RTK+ +Y  GFELG+  +  +  
Sbjct: 120 ESIPADDAKFINKLITNGFFQNWLVDGLPAARKTTDVRTKSEFYTPGFELGYVGIGGSEL 179

Query: 179 -VDGKAVPSTMEELTSEASNEDV----ILDARLPK----------NVKPNLVKTVELPYF 223
            ++G+      ++  S  S ++V     LDA   K          N K  LVK +E PYF
Sbjct: 180 RMNGQGGSQDGDDSGSHGSTKEVSESDYLDAPPAKRSLAKRKQVSNTK-ELVKQLETPYF 238

Query: 224 VNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYS 283
            NHF+IEV++HDRGN NYRVVGVIVNP SI+R SP  C  TG+ L L E +  EV+F+YS
Sbjct: 239 ANHFEIEVQYHDRGNGNYRVVGVIVNPYSIKRESPDTCDKTGELLKLSETEATEVHFSYS 298

Query: 284 VKFVASDTVWATRWDKYLHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYN 343
           VKF  S+TVWATRWDKYLH+YDP+IQWF                       L  DL+RYN
Sbjct: 299 VKFTPSETVWATRWDKYLHVYDPKIQWFSLINFSLVVVFLSTVMIHRLYVTLTDDLSRYN 358

Query: 344 ELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPV 403
           ++NLD++F E++GWKL HGDVFRTP +S++LS+LVGSG QLFLM  C+I FA +GL+SP 
Sbjct: 359 QINLDDDFQEETGWKLIHGDVFRTPERSLILSVLVGSGAQLFLMAACTIGFALLGLLSPS 418

Query: 404 SRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNF 463
           SRGSL TVMF+LYALFG  GSY SM  YKFF GPYWK NM+LTPIL+PG +F +++ +NF
Sbjct: 419 SRGSLTTVMFILYALFGSFGSYTSMATYKFFGGPYWKVNMLLTPILVPGLLFCVMLALNF 478

Query: 464 FLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPY 523
           FL+   S+G IP  ++  I+LLWFL S+PLS AGS++A K+C WDEHPTKT QI RQIP+
Sbjct: 479 FLVVVESAGAIPFGTMCVIVLLWFLFSIPLSVAGSLIARKKCKWDEHPTKTKQIPRQIPF 538

Query: 524 QPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXX 583
           QPWYL+T  A+LIAGIF FGSIAVELYFIYSSLWFNKIFYMFGF                
Sbjct: 539 QPWYLKTVPASLIAGIFPFGSIAVELYFIYSSLWFNKIFYMFGFLFVSFLLLTLTTSLIT 598

Query: 584 XXXXYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIIS 643
               YYSLCLENW WQWR F IGG GC++Y FIH+ILFTKF+LGG  T+VLY+GYSL++S
Sbjct: 599 VLLTYYSLCLENWKWQWRGFWIGGAGCALYMFIHAILFTKFRLGGFTTIVLYVGYSLVMS 658

Query: 644 ALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
            L C++TG +GF SS++F+R+IYS++KV+
Sbjct: 659 LLSCLITGTVGFLSSLWFVRRIYSSVKVD 687

>TBLA0H01450 Chr8 complement(321416..323437) [2022 bp, 673 aa] {ON}
           Anc_8.254 YLR083C
          Length = 673

 Score =  824 bits (2129), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/666 (57%), Positives = 484/666 (72%), Gaps = 4/666 (0%)

Query: 8   LIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLY 67
           LI  +   +  F +PG+S  TYH GD I L VNRLTPS+YF+H DE G  V+ DKEHFLY
Sbjct: 11  LISFHIIFSNAFYIPGISANTYHPGDPIELEVNRLTPSMYFEHTDENGQSVANDKEHFLY 70

Query: 68  SYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKD 127
           SYDYY  +FHFCRPE VE++ ESLGSV+FGDRIYNSPF+L MLE KECV LCK+TIP  D
Sbjct: 71  SYDYYYDKFHFCRPEKVERKSESLGSVLFGDRIYNSPFELYMLEPKECVPLCKTTIPADD 130

Query: 128 AKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVP-S 186
           AKFIN LIK+GFF NWL+DGLP+ARK YDS+T++ +Y +GF LG   V+    G  V   
Sbjct: 131 AKFINKLIKNGFFYNWLIDGLPSARKIYDSKTESIFYSSGFPLGSVSVEHMSGGSKVTIP 190

Query: 187 TMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGV 246
            + +L +EA         R  KNV   L+   E+ YF NHF+I +E+HDRGN+NYRVVGV
Sbjct: 191 GVSKLVNEAVKA---YKKREAKNVPAGLITAEEVEYFANHFNIHIEYHDRGNNNYRVVGV 247

Query: 247 IVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDP 306
            V+P+SI+R    +C+ TG  L L+E+ +N+V FTYSV F+ S+T WATRWDKYLH YDP
Sbjct: 248 TVDPISIKRDDFESCTPTGNQLHLNENAENQVLFTYSVDFIKSETAWATRWDKYLHTYDP 307

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366
            IQWF                     RALK D++RY +LNLDN F EDSGWKL HGDVFR
Sbjct: 308 SIQWFSLINFTIVVVLLSTIVIHALLRALKKDISRYTDLNLDNSFTEDSGWKLTHGDVFR 367

Query: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426
            P K+M+LSI VGSG+QLFLM++C +  AA+G +SP  RG+LPT MFVLYA+FGFVGSY 
Sbjct: 368 MPRKAMVLSIYVGSGVQLFLMILCCLTVAALGFMSPSYRGALPTCMFVLYAIFGFVGSYT 427

Query: 427 SMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLW 486
           SMGVYKFF GPYWKANMILTP+L+PG++ LLI+ +NFFLL  HSSG IPA ++  +I LW
Sbjct: 428 SMGVYKFFHGPYWKANMILTPLLVPGSMLLLIIFLNFFLLGVHSSGTIPASTIILMICLW 487

Query: 487 FLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIA 546
            LVSVPLSF GS VA K+CNW+++PT  N+I R+IP QPWY+R+    L++GI  FG+IA
Sbjct: 488 LLVSVPLSFLGSFVAFKKCNWNDNPTTVNEIPREIPIQPWYMRSIPVVLLSGIVPFGAIA 547

Query: 547 VELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIG 606
           VELYFIYSSLW+NKIFYMFGF                    Y+SLCLENW WQWRSF+ G
Sbjct: 548 VELYFIYSSLWYNKIFYMFGFLLVSFILMIFTSVLVSIIVVYHSLCLENWRWQWRSFVAG 607

Query: 607 GLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           GLGC+ Y F++SI FT+FK  G ++++LY+GYS +I  + C++TGA+ F  +MFF+++I+
Sbjct: 608 GLGCAFYIFLYSIAFTRFKFTGFVSILLYMGYSSLICVVSCLITGAVSFMCNMFFVKRIF 667

Query: 667 SAIKVE 672
           ++IKV 
Sbjct: 668 TSIKVH 673

>TPHA0A01840 Chr1 (371758..373815) [2058 bp, 685 aa] {ON} Anc_8.254
           YLR083C
          Length = 685

 Score =  823 bits (2125), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/692 (58%), Positives = 487/692 (70%), Gaps = 30/692 (4%)

Query: 3   RGVWLLIYCYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDK 62
           R  +LLI    +    F LPG++P+TY+ GDE+PLLVN LTPS+ +Q +D+ G  V   +
Sbjct: 2   RCSYLLIAALVSFCNAFYLPGVAPSTYNEGDELPLLVNHLTPSLNYQKKDDLGKKVE-SR 60

Query: 63  EHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKST 122
           E  LYS+DYY  + HFC+PE + KQP+SLGS++FGDRIYNSPF + ML+ +  V LC  T
Sbjct: 61  EKMLYSFDYYFPKLHFCKPEKIVKQPDSLGSILFGDRIYNSPFSIKMLKPENNVKLCSIT 120

Query: 123 IPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGK 182
           IPG DAKFIN LIK+GFFQNWL+DGLPAARK YDS T T +Y  GF LGF ++K+ V G 
Sbjct: 121 IPGSDAKFINKLIKNGFFQNWLIDGLPAARKIYDSNTHTEFYDVGFPLGFVEIKKNVGGL 180

Query: 183 AVPSTMEELTS----------------------EASNEDVILDARLPKNVKPNLVKTVEL 220
            +P   +   S                      E SN+    + R PK +   LV  VE 
Sbjct: 181 GIPMDAKTKDSGKKNSNSDKKKDSKKKDDSQKKEDSNKK---EKREPKRIS-KLVHNVEF 236

Query: 221 PYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYF 280
           PY  NH+ I VE HDRG  NYRVVGV V+P S   S   A    G  L LDE KDNEV F
Sbjct: 237 PYLANHYVINVEVHDRGEGNYRVVGVTVDPYSTTDS---ANPEKGNKLFLDEKKDNEVTF 293

Query: 281 TYSVKFVASDTVWATRWDKYLHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLA 340
           +YSV F+ S+TVWATRWDKYLH Y+P IQWF                     +ALKSD A
Sbjct: 294 SYSVNFIESETVWATRWDKYLHTYNPTIQWFSLVNFSIIVLLLSALVTYSLLKALKSDFA 353

Query: 341 RYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLV 400
           RY E NLDN F+EDSGWKLGHGDVFR PS+SMLLSILVGSG QLFLM++ SIF AA+G++
Sbjct: 354 RYEEFNLDNSFNEDSGWKLGHGDVFRIPSQSMLLSILVGSGAQLFLMIISSIFLAAIGII 413

Query: 401 SPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVI 460
           SP SRGSLP+ MF  YALFGF GSY SM VYKFF+GPYWKANMILTP+L+PG I + I+ 
Sbjct: 414 SPSSRGSLPSAMFTFYALFGFWGSYISMSVYKFFKGPYWKANMILTPLLVPGFILVSILG 473

Query: 461 MNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQ 520
           +NFFLLF HSSG IP  +L  I+++WF++S+PLSF GS++A+K+ NW EHPTKTNQIARQ
Sbjct: 474 LNFFLLFVHSSGTIPMTALLLIVVIWFVISLPLSFLGSLLANKRSNWGEHPTKTNQIARQ 533

Query: 521 IPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXX 580
           IP+Q WYL+T  A LIAGIF FG+IAVELYFIY+SLWFNKIFYMFGF             
Sbjct: 534 IPFQSWYLKTIPAILIAGIFPFGAIAVELYFIYTSLWFNKIFYMFGFLFVSFLLLTLTTS 593

Query: 581 XXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSL 640
                  Y SLC+ENW WQWRSF IGG+GCS+Y FIHSILFTKFKLGG  T++LY+GY+L
Sbjct: 594 LVTVLITYQSLCMENWNWQWRSFTIGGVGCSLYIFIHSILFTKFKLGGFTTMILYIGYTL 653

Query: 641 IISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           ++S L C+VTGA+GF SSM F+RKIYS ++V+
Sbjct: 654 LLSILSCIVTGAVGFISSMIFVRKIYSNVRVD 685

>TDEL0F03810 Chr6 complement(696251..698221) [1971 bp, 656 aa] {ON}
           Anc_8.254 YLR083C
          Length = 656

 Score =  781 bits (2018), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/652 (56%), Positives = 466/652 (71%), Gaps = 15/652 (2%)

Query: 21  LPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCR 80
           LPG+SPT Y +  EI L VN LTPS +FQH+D++GN++  DKEH+LYSYDYYN + HFC+
Sbjct: 20  LPGISPTNYDAKSEIALYVNHLTPSRHFQHKDKDGNNIKSDKEHYLYSYDYYNSKLHFCK 79

Query: 81  PEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFF 140
           PE+V +Q ESLGSV+FGDR+YNSPF+LNMLE+K CV+LCKS IPG+DA FIN LIK+GF 
Sbjct: 80  PENVIEQAESLGSVLFGDRLYNSPFKLNMLEDKSCVSLCKSVIPGEDAAFINKLIKNGFL 139

Query: 141 QNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            NWLVDGLPA     + R  + +   GF LG  ++ Q V   A+ +  EE    A   +V
Sbjct: 140 HNWLVDGLPAGTLINNERESSAHITNGFPLGSVEIMQGVHNGAMATPREETGISAHGSNV 199

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGA 260
           +++              +ELP+  NH+DI +++H+     YR+VGV V P SI+++S  +
Sbjct: 200 VVN--------------LELPHLNNHYDITIQYHEPEAGKYRIVGVEVEPKSIKQTS-NS 244

Query: 261 CSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFXXXXXXXXX 320
           C  TG+ + L ED+DNEV +TYSV++V     WATRWD Y   YD  +QWF         
Sbjct: 245 CEFTGEQISLSEDQDNEVLYTYSVRYVRFSHTWATRWDNYRFSYDTTVQWFSLISCVIVV 304

Query: 321 XXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGS 380
                       RALKSD ARYNELNLD+EFHE+SGWKL HGDVFR P+KS+LLS+LVGS
Sbjct: 305 IGLSSVVLHMLLRALKSDFARYNELNLDDEFHEESGWKLSHGDVFRMPNKSLLLSVLVGS 364

Query: 381 GMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWK 440
           G+QL L+ +  I  AA+   +  SR  LPT+ FVLYALFGFVGSYASMGVY+FF+GPY K
Sbjct: 365 GVQLLLLAVGGIVIAAIAFNNAGSREVLPTIFFVLYALFGFVGSYASMGVYRFFKGPYPK 424

Query: 441 ANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIV 500
            NMILTP L+PG I L I+ +NFFLL AHSS  IP  +LF ++LLW ++SVPLS AGS+ 
Sbjct: 425 VNMILTPFLIPGLILLTIISLNFFLLIAHSSDAIPFSALFAVVLLWLIISVPLSLAGSLT 484

Query: 501 AHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNK 560
           A K C+WD+HPTKTNQIARQIP+QPWYL+T  A L+AGIF F SIAVELYFIY+SLWF++
Sbjct: 485 AIKTCSWDQHPTKTNQIARQIPFQPWYLKTLPAALVAGIFPFASIAVELYFIYNSLWFHQ 544

Query: 561 IFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSIL 620
            FYMFGF                    Y+SLCLENW WQWRSFI+GGLG ++Y FIHSI 
Sbjct: 545 FFYMFGFSMVSLFLLVLTTALVTVMITYHSLCLENWQWQWRSFIVGGLGSAVYIFIHSIF 604

Query: 621 FTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           FT+FKL G  T+VLY+GYS++IS LCC+ TGA+GFFSSMF +RKI+S++KV+
Sbjct: 605 FTEFKLRGFTTIVLYVGYSMLISILCCLTTGAVGFFSSMFLVRKIFSSVKVD 656

>NDAI0J01420 Chr10 (326749..328608) [1860 bp, 619 aa] {ON} Anc_8.254
          Length = 619

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/627 (57%), Positives = 455/627 (72%), Gaps = 8/627 (1%)

Query: 46  IYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPF 105
           +++ H+++EG D+S D +  +YSYDYY ++ HFC+PEHVEK   S+GSV+FGDR+YNSPF
Sbjct: 1   MHYHHKNQEGQDISTDDKRTIYSYDYYYEKLHFCKPEHVEKAGVSIGSVLFGDRLYNSPF 60

Query: 106 QLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYG 165
           QLNML+ K C  LC STI G+DAKFIN LIK+G++QNWL+DGLPAAR+ YD+RTK+N+YG
Sbjct: 61  QLNMLKNKTCERLCNSTIIGRDAKFINKLIKNGYYQNWLIDGLPAAREVYDTRTKSNFYG 120

Query: 166 TGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVN 225
            GFELG  +++QT   K +P++ +            L  R  KN+  NL++ +E+PYFVN
Sbjct: 121 NGFELGLVEIRQTTGEKLLPNSADTFRD--------LHKRDAKNIVQNLMQDIEVPYFVN 172

Query: 226 HFDIEVEFHDRGNDNYRVVGVIVNPVSIERSSPGACSTTGKPLILDEDKDNEVYFTYSVK 285
           HFDI +E+HDRGNDNYRVVGV VNPVSI+RS  G C  TGK L L E + N ++FTYSV+
Sbjct: 173 HFDIRIEYHDRGNDNYRVVGVTVNPVSIDRSPDGGCKPTGKALSLSESEVNYIHFTYSVE 232

Query: 286 FVASDTVWATRWDKYLHIYDPQIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNEL 345
           F+ S+T W TRWDKYLH+YDP IQW                      +ALKSD +RY EL
Sbjct: 233 FIPSETAWVTRWDKYLHVYDPTIQWVSIVNFSIVVIILSCAVARSLLQALKSDFSRYGEL 292

Query: 346 NLDNEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSR 405
           NLD    ED+ WKLGHGDVFR P   MLLSILVGSG+QLFLM++C+IF  AVGL++P SR
Sbjct: 293 NLDETIKEDASWKLGHGDVFRAPDHPMLLSILVGSGVQLFLMIICTIFLPAVGLITPGSR 352

Query: 406 GSLPTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFL 465
           G+LPTVMF+LY  F F+ S+ SMGVYKFF G  W  N ILTP L+PG + L+I+ +N FL
Sbjct: 353 GTLPTVMFLLYLGFSFISSFVSMGVYKFFNGQKWHINCILTPFLVPGLLLLVIIGLNIFL 412

Query: 466 LFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQP 525
           +F HSSGVIP  +   +ILLWF + VPLS  GS++A K C+WD HPTKTN +++ IP Q 
Sbjct: 413 IFVHSSGVIPLATFTSLILLWFFIGVPLSITGSLMARKTCHWDIHPTKTNTVSKVIPPQK 472

Query: 526 WYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXX 585
           WYL+T  A+LI G+FSFGS++VELYF+Y+SLWFNKIFYM+GF                  
Sbjct: 473 WYLQTIPASLIGGLFSFGSLSVELYFVYTSLWFNKIFYMYGFLFGSAILFTLTVSLVTVL 532

Query: 586 XXYYSLCLENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISAL 645
             YYSL  ENW WQWRSF+I GLGCS Y F+HS+LFT+ KLGG    +LY+GYS +I++L
Sbjct: 533 FTYYSLSAENWQWQWRSFLIAGLGCSFYVFLHSLLFTEVKLGGFTNALLYMGYSFVITSL 592

Query: 646 CCVVTGAIGFFSSMFFIRKIYSAIKVE 672
             VVTGA+GF SSM F+R IYSA+KV+
Sbjct: 593 AFVVTGALGFLSSMLFVRTIYSAVKVD 619

>AGR097W Chr7 (920133..922094) [1962 bp, 653 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR083C (EMP70) and
           YDR107C
          Length = 653

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/658 (55%), Positives = 464/658 (70%), Gaps = 17/658 (2%)

Query: 15  LTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNK 74
           L +GF LPG +PTTY  GD IPLLVN +TP+++    D  G D   DKE +LY+YDYY  
Sbjct: 13  LAQGFYLPGSAPTTYRRGDAIPLLVNHITPTVF--SDDRAGTDGQRDKERYLYAYDYYYP 70

Query: 75  RFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTL 134
           R H CRP+ +EK  ESLGS+IFGDR++NSPF+L MLEEK CVALC+ T+P +DAKFIN L
Sbjct: 71  RLHMCRPDKIEKVSESLGSIIFGDRLHNSPFELKMLEEKSCVALCEKTVPAEDAKFINQL 130

Query: 135 IKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSE 194
           I+SGFF NWLVDGLPA R+ +D+RT T +YGTGFELG     + + G       E+   E
Sbjct: 131 IRSGFFHNWLVDGLPAGREMHDARTNTVFYGTGFELG-----RVIRGT------EDRNQE 179

Query: 195 ASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSIE 254
              E   ++ +  + ++P     V +PYF+NHF+I V++H R  D  RVVGV V P S++
Sbjct: 180 EPGE---IELQTRRVLQPG-ESVVAVPYFINHFEITVDYHKRAEDELRVVGVSVLPRSLQ 235

Query: 255 RSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFXXX 314
                 C+ +G  L+L E  D +V FTYSV+F  SD  WATRW KYLH+YDP++QW+   
Sbjct: 236 NPVGDKCANSGNGLVLSETADTKVTFTYSVRFHESDVSWATRWGKYLHVYDPKVQWYSLI 295

Query: 315 XXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSMLL 374
                             RALK+DL RYN+ NLDNEF ED GWKL H DVFR+PSK++LL
Sbjct: 296 NFSLVVLLLSSIMVHSLFRALKTDLDRYNDFNLDNEFQEDYGWKLLHSDVFRSPSKTLLL 355

Query: 375 SILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYKFF 434
           S+ VGSG QLFLM  C++F A +G +SP SRGSL T+MFVLYA+FG  GSY SM  YK F
Sbjct: 356 SVFVGSGGQLFLMSACTLFIAMLGFLSPSSRGSLGTIMFVLYAIFGGFGSYLSMSTYKMF 415

Query: 435 RGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLS 494
            G  WK NM+LTP+L+PG IF  +++MNFFL+   SSG +P  ++  I++LWF++S+P+S
Sbjct: 416 GGEKWKVNMVLTPLLVPGIIFATMLLMNFFLVMVQSSGAMPFGTMLAIVVLWFVLSIPIS 475

Query: 495 FAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYS 554
             GS+ A K+  WD+HPTKT+QIA+QIP QPWYLRT  A  IAG+F FG+IAVELYFIY+
Sbjct: 476 IMGSLFARKKNTWDQHPTKTSQIAKQIPPQPWYLRTWPAAYIAGLFPFGAIAVELYFIYT 535

Query: 555 SLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSIYT 614
           S+WFN +FYMFGF                    YYSLC+ENW WQWRSFIIGG+GCS Y 
Sbjct: 536 SIWFNTMFYMFGFLFFTFLLLTLTTALVTILLTYYSLCMENWSWQWRSFIIGGIGCSTYV 595

Query: 615 FIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           FI+SILFTKF+LGG +T+VLY+GYSL+IS L C+VTG IGF SS++F+RKIYS+IKV+
Sbjct: 596 FINSILFTKFRLGGFVTIVLYVGYSLLISFLFCLVTGTIGFVSSLWFVRKIYSSIKVD 653

>Ecym_4317 Chr4 (685854..687671) [1818 bp, 605 aa] {ON} similar to
           Ashbya gossypii AGR097W
          Length = 605

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/660 (45%), Positives = 402/660 (60%), Gaps = 65/660 (9%)

Query: 13  ATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYY 72
           A ++ GF  PG+SP TYH GDEIPLLVN L+                     FL++ DYY
Sbjct: 11  AGVSYGFYFPGVSPVTYHIGDEIPLLVNYLS-------------------SDFLWNIDYY 51

Query: 73  NKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFIN 132
           +     C+P  +++Q ESLGSVIFGDR+YNSPF+++ML+  ECV LC +TI   D    N
Sbjct: 52  SDSIGLCKPNTIKEQSESLGSVIFGDRLYNSPFKVSMLKNSECVKLCDTTI---DTALWN 108

Query: 133 TLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELT 192
           T     +  NWLVDGLP                    LG   +  T D     +  E   
Sbjct: 109 TFFGYRYSYNWLVDGLPV-------------------LG---IDGTSDANGYHNNSELFM 146

Query: 193 SEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVS 252
              ++E                       Y  NHFDI + ++DRG   YRVV     P+S
Sbjct: 147 GYQADEQ---------------------KYIYNHFDIYIHYNDRGKGEYRVVFAEAKPIS 185

Query: 253 IERSSPGACSTTGKPLILDEDKDNEVYFTYSVKFVASDTVWATRWDKYLHIYDPQIQWFX 312
           + R+    CS   KP+ +       + FTYSV F  SD  W+TRWD+YLH+YD  IQ   
Sbjct: 186 LPRTGSELCSKDAKPVPIGSGNHENITFTYSVIFKKSDISWSTRWDQYLHVYDFDIQLAE 245

Query: 313 XXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSM 372
                               R LK D+A Y+E NLD+EF +D  WK+ HG+VFR+PSK++
Sbjct: 246 LISFSLVVLLLSSVLVHSLFRVLKRDIAAYSEFNLDDEFQQDYCWKIIHGEVFRSPSKAL 305

Query: 373 LLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYK 432
           LLS+ VGSG QLF M +C++   + G +SP +RGSL TVMFVLYALFG VGSY SM +YK
Sbjct: 306 LLSVFVGSGSQLFFMALCTVLLGSCGFLSPSARGSLGTVMFVLYALFGGVGSYTSMSIYK 365

Query: 433 FFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVP 492
           FF G  WK N+ILTP+L+P  +F+  V++NFFL++A SSG +P  ++  II+LWF++SVP
Sbjct: 366 FFGGQNWKLNLILTPLLIPVFLFVTTVLLNFFLIYAKSSGAMPFGTMVTIIILWFILSVP 425

Query: 493 LSFAGSIVAHKQCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFI 552
           +S  GS+++ K   WDEHP KTNQIARQ+P QPWY++T  AT +AG+F FG++AVELY+I
Sbjct: 426 VSIIGSLLSWKLNRWDEHPAKTNQIARQVPSQPWYIKTWVATFLAGMFPFGAMAVELYYI 485

Query: 553 YSSLWFNKIFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWLWQWRSFIIGGLGCSI 612
           Y+S+W   IF+M+GF                    YYSLC+ENW WQWRSFIIGG+GCS+
Sbjct: 486 YASIWGEIIFFMYGFLFVAFILLTLTTSLVTILLTYYSLCMENWKWQWRSFIIGGVGCSV 545

Query: 613 YTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSAIKVE 672
           Y F+HS+ F KFK  G +++VLYLGYS ++S +CC+VTG+IGF ++++F+RKIYS IKV+
Sbjct: 546 YVFLHSLFFIKFKFPGFVSMVLYLGYSAMVSIVCCLVTGSIGFLANLWFVRKIYSNIKVD 605

>YER113C Chr5 complement(387932..390052) [2121 bp, 706 aa] {ON}
           TMN3Protein with a role in cellular adhesion and
           filamentous growth; similar to Emp70p and Tmn2p; member
           of Transmembrane Nine family with 9 transmembrane
           segments; localizes to Golgi; induced by
           8-methoxypsoralen plus UVA irradiation
          Length = 706

 Score =  143 bits (360), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 160/711 (22%), Positives = 274/711 (38%), Gaps = 130/711 (18%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           ++P  Y  GD + L+VN+                V  D     Y+Y        F  P  
Sbjct: 52  ITPNFYRKGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K+P   SL  +I GDR + S ++L   E+  C  LC      +  + ++ L++ G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYKLKFGEDNPCETLCARKTTKEGMQTLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +     YY +GF LGF D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFID-------------------------- 185

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  + + FH   ND   +VG  V P S+ +   PG
Sbjct: 186 -----------PDTDKT----YLHNHVMLVIRFHASDNDKNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQIQ 309
           A     +  +++ ED++   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNAGELSDEQSIQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNE----LNLDNEFHEDS--GWKLGHGD 363
           W                      R + +D +        +N++    ED     K G   
Sbjct: 291 WMSLANSVGIVLSISFITLIIYVRVMYTDKSNSKSPKYMINIEGIETEDDLDDDKYGKYS 350

Query: 364 VFRTPSKSM-----------LLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVM 412
           V+      +           +L +LV  G+Q    ++ S+  +         R S+ T+ 
Sbjct: 351 VYTVAKDWIQNGRPNLFGLKVLILLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 410

Query: 413 FVLYALFGFVGSYASMGVYKFFRGPYWKANMI-----------LTPIL-------LPGAI 454
            + + L  F+ S+    +    +    KAN +            +PI        LPG +
Sbjct: 411 ILFFVLGAFMASFVGTRLSMVTKTKRTKANYLDDNRYLKDYKKFSPIFTILCGSSLPGIV 470

Query: 455 FLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK---------QC 505
            +   ++N  +    S+  +P +++ F + ++F+V +PLS  G IVA+            
Sbjct: 471 MVSTFLLNSIVWAHDSTSALPFKTIVFFMSIYFIVCIPLSLFGGIVANNIPLPQYWLSGI 530

Query: 506 NWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFY 563
             DE  +  N +        +         + GIF    I VE+ ++Y SLW  K   +Y
Sbjct: 531 TKDESNSDGNGLFVPKSRAKFNPLVYCGIYLCGIFPLLVIYVEMQYVYKSLWLEKTTFYY 590

Query: 564 MFGFXXXXXXXXXXXXXXXXXXXXYYSL--CLENWL----WQWRSFIIGGLGCSIYTFIH 617
            +GF                    Y  +  C E+ +    W+W+ F +G  G  +Y  ++
Sbjct: 591 FYGFLFLSIILLCVLTMEISIIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 618 SI--LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           S+  +F    + G  ++++ + YSLI + +C +  GA+ + ++ +FI KIY
Sbjct: 650 SLYYIFAVLNIHGFSSILISICYSLIFNVMCSLGLGALSYLTASWFINKIY 700

>NCAS0A14520 Chr1 complement(2860704..2862716) [2013 bp, 670 aa]
           {ON} Anc_7.411 YER113C
          Length = 670

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 162/695 (23%), Positives = 268/695 (38%), Gaps = 124/695 (17%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L P  Y  GD + L+VN+                V  D     Y+Y        F  P  
Sbjct: 42  LRPNYYSKGDPVELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K+P   SL  +I GDR + S + LN  E+ +C  LC      +  K    L+K+G+  
Sbjct: 82  MHKKPLHLSLNEIIRGDRKWQSDYILNFGEDDQCHILCTRKTTKEGMKEAQELVKNGYVV 141

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPA      +     YY +GF LGF D                          
Sbjct: 142 QWLIDDELPAVTTFISTTDHKKYYASGFPLGFVD-------------------------- 175

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVS-IERSSPG 259
                      P   KT    Y   H  I + ++    + + + G  + P S ++   PG
Sbjct: 176 -----------PETGKT----YLNTHVMIVIRYNTVDTNKHTIFGFELYPKSTVDFHCPG 220

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQIQ 309
           A     +  L++ E+ D+  +  FTYSV +     V W  RWD YL+  +       Q  
Sbjct: 221 ASKDYEQYELVVPENDDDLTFIPFTYSVYWREEYLVDWEHRWDLYLNAGELSNDKSKQFH 280

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSG--------WKLGH 361
           W                      R  K     +++++ +    +D G        W L  
Sbjct: 281 WISLANSFGIVFLISSITAVILYRTFKISRRSFSDISKE---EDDKGSIYVVARKWLLNE 337

Query: 362 GDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGF 421
               +TP  ++L+ I V  G+Q    V+ S+  +         R S+ T+  + +    F
Sbjct: 338 ----QTPLANVLI-IFVSMGVQFLFTVLGSLIISCSLKKLHNVRDSVLTMGLLCFVTGAF 392

Query: 422 VGSYASMGVYKFFR----------GPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSS 471
           + S+    + K               Y+    +L   LLP  + L+ +++N  +    S+
Sbjct: 393 MASFTGAHLLKSREEMCSESQMKPTRYYPVFALLCGSLLPSFVMLVALLLNSIVWAHDST 452

Query: 472 GVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQIA---------RQIP 522
             +P  ++ F+I ++F+V +PLS  G  +A K  N    P+ +  I          + I 
Sbjct: 453 HALPFGTVLFLISVYFVVCIPLSLLGGYIAVKSTN--SKPSFSFSIGNYSDRIFVYKTIT 510

Query: 523 YQPWYL----RTAQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXX 576
             P  L     ++ A L  G+F F  I VEL ++Y SLW  K   +Y +GF         
Sbjct: 511 MSPSVLINRPLSSLAILAGGLFPFIIIYVELQYVYKSLWLEKTTFYYFYGFLLANILLLC 570

Query: 577 XXXXXXXXXXXYYSLCLENW---LWQWRSFIIGGLGCSIYTFIHSILFTKFKLG--GVIT 631
                      +  L   +     W+W SF IG   C+ Y  ++S+ +  F L   G  +
Sbjct: 571 IVICEISIIGTFILLNSADKNSNNWRWTSFQIGA-SCAFYMEVYSLYYVFFILNIRGFSS 629

Query: 632 VVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           + + + Y  + + +C   TG+I   +S +F++KIY
Sbjct: 630 IFISVCYGTLFNIMCGCATGSIACLTSHWFVQKIY 664

>Smik_5.258 Chr5 complement(396781..398901) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  137 bits (345), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 164/718 (22%), Positives = 279/718 (38%), Gaps = 144/718 (20%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           ++P  Y +GD + L+VN+                V  D     Y+Y        F  P  
Sbjct: 52  ITPNFYKNGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K P   SL  +I GDR + S ++L   E+  C  LC      +  + ++ LI+ G+  
Sbjct: 92  MHKTPLHLSLNEIIRGDRKWESDYKLTFGEDNPCEVLCARKTTKEGMQTLDKLIREGYVV 151

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +     YY +GF LGF D                          
Sbjct: 152 QWLIDDELPAATTFISTTDHKKYYASGFPLGFMD-------------------------- 185

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  + + FH   N    +VG  V P S+ +   PG
Sbjct: 186 -----------PDTGKT----YLHNHVMLVIRFHSGDNGKNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQIQ 309
           A  T  +  + + ED++   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKTYEQYEITIPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSDEQSSQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSD---------------LARYNELNLDNEFHED 354
           W                        + +D               +   + LN D ++ ++
Sbjct: 291 WMSFANSVIIVLSISLITLIIYIGVMHTDKNNPHSNKFMINIEGIGAEDVLNND-KYSKN 349

Query: 355 SGWKL-------GHGDVFRTPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGS 407
           S + +       G  D+F        L +LV  G+Q    V+ S+  +         R S
Sbjct: 350 SVYMVAKDWIQNGKPDLFSLKG----LIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNS 405

Query: 408 LPTVMFVLYALFGFVGSYAS-----MGVYKFFRGPYW------KANMILTPIL------- 449
           + T+  + + +  F+ S+       +   + F   Y+      K     +PI        
Sbjct: 406 VLTMAILCFVIGAFMASFVGTRLSIVSKTRRFNANYFGDNKNFKCREKFSPIFAIICGSS 465

Query: 450 LPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK------ 503
           LPG I +   ++N  +    S+  +P +++ F I ++F+V +PLS  G IVA+       
Sbjct: 466 LPGMIMISTFLLNSIVWAHDSTNALPFKTIVFFISVYFIVCIPLSLFGGIVANNIPLPQY 525

Query: 504 ---QCNWDEHPTKTNQIARQIPYQPWYLR--TAQATLIAGIFSFGSIAVELYFIYSSLWF 558
                  DE  +K N++   +P  P            + G+F    I VE+ ++Y SLW 
Sbjct: 526 WLSGITIDESDSKNNKLF--LPKSPNKFNPLVNCGIYLCGVFPLLVIYVEMQYVYKSLWL 583

Query: 559 NK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYYSL--CLENWL----WQWRSFIIGGLGC 610
            K   +Y +GF                    Y  +  C E+ +    W+W+ F +G  G 
Sbjct: 584 EKTTFYYFYGFLFLSIILLCVLTMEISVIGSYLLMRFCFEDKVVRNNWRWKCFEMGFSG- 642

Query: 611 SIYTFIHSI--LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
            +Y  ++S+  +F    + G  ++++ + YSL+ + +C +  GA+ + ++ +FI KIY
Sbjct: 643 GVYMELYSLYYIFAVLNIHGFSSILISICYSLLFNIMCGLGLGALSYLTASWFINKIY 700

>KNAG0C03430 Chr3 (674411..676453) [2043 bp, 680 aa] {ON} Anc_7.411
           YER113C
          Length = 680

 Score =  137 bits (344), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 157/710 (22%), Positives = 276/710 (38%), Gaps = 131/710 (18%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L+PT Y  GD + ++VN+                +  D       Y YY+    F  P  
Sbjct: 33  LTPTIYRHGDPVEIIVNK----------------IESDATQL--PYGYYD--LPFTCPPT 72

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           V+K+P   SL  VI GDR + S ++L   ++ EC  LC         + ++  IK  +  
Sbjct: 73  VDKKPLHLSLNEVIRGDRKWQSNYELEFGKDTECTVLCARKTNPDGMRSLDKFIKQEYVV 132

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            W +D  LPAA     +  +  YYG+GF LGF D +    GK                  
Sbjct: 133 QWFIDKELPAATTFISTVDQKKYYGSGFPLGFVDEET---GKV----------------- 172

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                                Y  NH  + + +H   + N+ +VG  + P S+ +   PG
Sbjct: 173 ---------------------YVNNHVMMVIRYHAIDDYNFTIVGFEIYPKSVSDYHCPG 211

Query: 260 ACSTTGKPLILDEDKDNE---VYFTYSVKFVAS-DTVWATRWDKYLHI------YDPQIQ 309
           A     +  ++  +  NE   + FTYSV +    D  W  R++ +            +  
Sbjct: 212 ASKDYDQYEVVVPEIANEDTFIPFTYSVYWREEFDVEWKDRYNLFFDSGELSGSVSRKFH 271

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR-TP 368
           W                      +         N L    E  + S + +     +   P
Sbjct: 272 WISLANSASIAFLMTFIVSLIFIKITGIP----NRLETKKESPKASIFVIARNWFYDDRP 327

Query: 369 SKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASM 428
               L   +V  G+     V+ S+  +         R S+ T+  + + L  F+ S+   
Sbjct: 328 VMPHLFICIVSMGVHFLFTVIGSLTISCSLNSLHTIRNSVLTMALLFFVLGAFMASFVGG 387

Query: 429 GVYK------FFRGPYWK--ANMILTPI----LLPGAIFLLIVIMNFFLLFAHSSGVIPA 476
            +          RG      +N++L  +    LLPG + L  +I+N  +    S+ V+P 
Sbjct: 388 TLLIENNKLIMRRGSLKNVFSNILLFSVVCGSLLPGMVILTAIILNCIIWLHTSTNVLPF 447

Query: 477 RSLFFIILLWFLVSVPLS-FAGSIVAHKQCN---------------------WDEHPTKT 514
            ++  ++ ++F+V +PLS   GSI A+K                         DE     
Sbjct: 448 ATIMKLLFIYFIVCIPLSVLGGSIAANKDSEEYSRLRSDSIKRISRTRANKIMDEDQGTD 507

Query: 515 NQIARQIPYQ-PWYLR-------TAQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYM 564
            +  R++ Y+  W L+       T  + L +GIF F  I VEL F+Y S+W+ K   +Y 
Sbjct: 508 VRTTRKLKYKVRWQLKKMMLDTVTVVSLLASGIFPFIMIYVELQFVYKSVWYEKTTFYYY 567

Query: 565 FGFXXXXXXXXXXXXXXXXXXXXYYSLCLENW----LWQWRSFIIGGLGCSIYTFIHSI- 619
           +GF                    Y  + + +      W+W++F +    C+ Y   +SI 
Sbjct: 568 YGFLLANIILLCLVICDIAIICSYLMMTVSSKDNSDSWKWKTFQLSS-SCAWYMEAYSIY 626

Query: 620 -LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSA 668
            +F    +    ++++ + YSL+ +ALC +  G+IG+ +S++F++++Y +
Sbjct: 627 YVFKVLNMRDFSSILISVCYSLLFNALCGLAMGSIGYLASLWFVKRVYRS 676

>TDEL0C02710 Chr3 complement(474759..476795) [2037 bp, 678 aa] {ON}
           Anc_7.411 YER113C
          Length = 678

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 159/695 (22%), Positives = 273/695 (39%), Gaps = 116/695 (16%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L P  Y  GD + LLVN+                V  D   F   Y YY+  F  C P  
Sbjct: 41  LQPNVYRWGDHVELLVNK----------------VESDLTQF--PYGYYDLPFT-CPPTE 81

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
            +K+P   SL  +I GDR + S ++L   ++  C ALC         +    L++ G+  
Sbjct: 82  -DKKPLHLSLNEIIRGDRKWESDYKLKFGQDASCEALCARKTKPAGMRRAQELVRQGYVV 140

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +     YY +GF LGF D                          
Sbjct: 141 QWLIDQELPAATTFISTIDHKKYYVSGFPLGFVD-------------------------- 174

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  KT    Y   H  + + ++    + + +VG  V P S+ +   PG
Sbjct: 175 -----------PDTEKT----YLNTHVMMVIRYNAIDPETFTIVGFEVYPKSVSDYHCPG 219

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLH------IYDPQIQ 309
           A     +  LI+ E++D   Y  FTYSV +     V W+ RW+ +L+          +  
Sbjct: 220 ASKGYEQYELIVPENEDELTYIPFTYSVYWREEFKVDWSHRWNFFLNSGEMSEASSRRFH 279

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNE---LNLDNEFHEDSGWKLGHGDVFR 366
           W                      R ++      +E      D     DS + +    + +
Sbjct: 280 WMTLGNSVGISFLLMLIVIANLYRIVRVGHEAGSEEFQFTFDENEEADSIYGVAKTWLAQ 339

Query: 367 TPSKSM---LLSILVGSGMQLFLMVMCSIFFA-AVGLVSPVSRGSLPTVMFVL----YAL 418
           T S S+   +L+I V  G+Q    ++ S+ F+ ++  +  +    L    F L    Y  
Sbjct: 340 TDSSSISFKILTIFVSIGVQFLFTIIGSLAFSCSLNKLHNIRNSVLSVASFFLCHWSYLW 399

Query: 419 FGFVGSYASMGVYKFFRGPYWKANM--ILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPA 476
             FVG++  +       G   +     IL    LPG + +   ++N+ +    SS  +P 
Sbjct: 400 HLFVGTWLHIDHRTTNDGSAGRCRTFSILCGSALPGLVMISTQMLNWIVWANESSHALPF 459

Query: 477 RSLFFIILLWFLVSVPLSFAGSIVAHK--QCNWDEHPTKTNQIARQIPYQPWYLRTAQAT 534
           R++   + ++F++ +PLS  G  V+H+  +      P  ++  AR I  +P    T  A 
Sbjct: 460 RTIVLFVSIYFVICIPLSLLGEEVSHRVHRKQAQNFPILSSLGARSI--KPCRAPTTLAP 517

Query: 535 --------------LIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXX 578
                          I G   F  I VEL +IY S+W  K   +Y++GF           
Sbjct: 518 RKISERLTFDFATFAICGFLPFAVIYVELQYIYKSVWLEKTDFYYLYGFLLANIILLCIV 577

Query: 579 XXXXXXXXXYYSLCLENWL-----WQWRSFIIGGLGCSIYTFIHSI--LFTKFKLGGVIT 631
                    Y  +     +     W+W+ F++G   C+ Y  ++S+  +F   K+ G  +
Sbjct: 578 VCEVSFLGCYVMMRKHKRVATFDSWRWKCFMMGT-SCAWYMELYSLYYIFHTLKMTGFPS 636

Query: 632 VVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           + + + YSLI + +C    G++G+ +S + + +++
Sbjct: 637 IFISVSYSLIFNIMCGCGMGSLGYLTSCWLVNRVF 671

>NDAI0A01510 Chr1 (335693..337732) [2040 bp, 679 aa] {ON} Anc_7.411
           YER113C
          Length = 679

 Score =  132 bits (332), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 159/698 (22%), Positives = 273/698 (39%), Gaps = 123/698 (17%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L P  Y  GDE+ L+VN+                V  D     Y+Y        F  P  
Sbjct: 41  LQPNFYFQGDEVELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K+P   SL  +I GDR + S + L   ++  C  LC      +  K    L++ G+  
Sbjct: 81  MHKKPLHLSLNEIIRGDRKWQSDYILKFGQDDTCHILCTRKTTKEGLKNAKKLVEDGYVV 140

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +  +  YY +GF LGF D                          
Sbjct: 141 QWLIDEELPAATTFISTIDQKKYYASGFPLGFVD-------------------------- 174

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  K     Y   H  + + ++    + + +VG  V P S+ +   PG
Sbjct: 175 -----------PDTGKV----YLNTHVMLVIRYNTVDVNKHTIVGFEVYPKSVSDFHCPG 219

Query: 260 ACSTTGKP--LILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQI 308
           A S   +P  +++ E+ D+  +  FTYSV +     V W  RWD YL+  +       Q 
Sbjct: 220 A-SKNYEPYEIVIPENDDDLTFIPFTYSVYWREEYLVDWDHRWDLYLNSGELSENKTTQF 278

Query: 309 QWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVF--R 366
            W                      R+ KS      ++N   E      +++    +   R
Sbjct: 279 HWISLANSAGIVFLMSFVVSVILLRSFKSSRDISTDINKSEEHRNGLVYEVARNWIINER 338

Query: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYA 426
           TP  ++L+ + V  G+Q    V+ S+  +           S+ T+  + + L  F+ SY 
Sbjct: 339 TPLANLLI-LFVSMGVQFLFTVLGSLTISCSLNKLHDIGDSVLTMAVLCFVLGAFMSSYI 397

Query: 427 SMGVYKFFRGPYWKANMILTPI--------------LLPGAIFLLIVIMNFFLLFAHSSG 472
              + +       KA M   PI               LPG + ++ +++N  +    S+ 
Sbjct: 398 GSVLLRLKN----KATMKKQPIKKGFHLFFAILCGSFLPGIVMIVTLLLNSIVWAHDSTH 453

Query: 473 VIPARSLFFIILLWFLVSVPLSFAGSIVAHK---QCNWDEHPTKTNQIARQI------PY 523
            +P +++   I ++F+V +PLS  G  +A+    + +  +    T++   ++      P 
Sbjct: 454 ALPFKTVVMFITVYFIVCIPLSILGGYMANSSKTKGSLTDPKFHTSRPELELFANKLKPK 513

Query: 524 QPWYL--------RTAQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXX 573
           +  +L        + A   L++GIF F  I VEL ++Y S+W  K   +Y +GF      
Sbjct: 514 KHIFLFGARLKSIKIALPILLSGIFPFVIIYVELQYVYKSVWLEKTAFYYFYGFLFANIL 573

Query: 574 XXXXXXXXXXXXXXYYSLCL---ENWLWQWRSFIIGGLGCSIYTFIHSILFTKFKLG--G 628
                         Y  L +    N  W+W SF +G   C+ Y  ++S+ +  F L   G
Sbjct: 574 LLCIVVGEIAIIGTYTMLHMADRNNTDWRWISFFMGS-SCAWYMELYSLYYVFFILNIRG 632

Query: 629 VITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
             ++ + + Y  + + LC    G+I   +S FF+ K+Y
Sbjct: 633 FSSIFISVCYGALFNTLCGCAMGSIASLTSHFFVEKLY 670

>Suva_5.234 Chr5 complement(363605..365725) [2121 bp, 706 aa] {ON}
           YER113C (REAL)
          Length = 706

 Score =  130 bits (328), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 159/713 (22%), Positives = 271/713 (38%), Gaps = 130/713 (18%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           ++P  Y  GD + L+VN+                V  D     Y+Y        F  P  
Sbjct: 52  ITPNFYKKGDPLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 91

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K+P   SL  +I GDR + S + L   E+  C  LC      +  + ++ L++ G+  
Sbjct: 92  MHKKPLHLSLNEIIRGDRKWESDYILAFGEDNACQTLCARKTTKEGMQSLDKLVREGYVV 151

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +     YY +GF LGF D                          
Sbjct: 152 QWLIDDKLPAATTFISTTDHKKYYASGFPLGFVD-------------------------- 185

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  + + FH   ND   +VG  V P S+ +   PG
Sbjct: 186 -----------PDTGKT----YLHNHVMLVIRFHSGDNDQNTIVGFEVYPRSVSDYHCPG 230

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQIQ 309
           A     +  +++ ED++   Y  FTYSV +     V W  RWD +L+  +       Q  
Sbjct: 231 ASKNYEQYEIVVPEDENELTYLPFTYSVYWREEFEVDWNHRWDYFLNSGELSNEKSAQFH 290

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYN-------------ELNLDNEFHEDSG 356
           W                      + +  D    +             E NLD++ +  + 
Sbjct: 291 WMSFANSMGIVLSISFITAVIYIQVMHRDKKNTDSTKYLINIEGAEVEDNLDDDKYGKNS 350

Query: 357 WKLGHGDVFRTPSKSM----LLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVM 412
             +   D  +    +M    +L +LV  G+Q    V+ S+  +         R S+ T+ 
Sbjct: 351 VYMVTKDWIQNGRPNMFGLKVLIVLVSFGVQFLFTVIGSLTISCSMNKLHNVRNSVITMA 410

Query: 413 FVLYALFGFVGSYASMGVYKFFRGPYWKANMI-----------LTPIL-------LPGAI 454
            + + L  F+ S+    +    +    + N +            +P+        LPG +
Sbjct: 411 ILCFVLGAFMASFVGTRLSIVTKRRSIEINYLDDSKNFNNCNKFSPVFAIICGSSLPGLV 470

Query: 455 FLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK---QCNWDEHP 511
            +   ++N  +    S+  +P R++ F I ++F+V +PLS  G  VA+      +W    
Sbjct: 471 MVSTFLLNSIVWAHDSTNALPFRTIVFFISVYFIVCIPLSLFGGTVANNIPLPRHWLSGI 530

Query: 512 TKTNQIARQIPYQPWYLRTAQATLI------AGIFSFGSIAVELYFIYSSLWFNKI--FY 563
           TK               RT    L+       G+F F  I VEL ++Y S+W  K   +Y
Sbjct: 531 TKDETCGNSSRLFVPRSRTKFNPLVYCGIYLCGLFPFLVIYVELQYVYKSVWLEKTTFYY 590

Query: 564 MFGFXXXXXXXXXXXXXXXXXXXXY--YSLCLENW----LWQWRSFIIGGLGCSIYTFIH 617
            +GF                    Y     C E+      W+W+ F +G  G  +Y  ++
Sbjct: 591 FYGFLLLNIILLCVLTMEISIIGSYSLMRFCFEDKDVRNNWRWKCFEMGFSG-GVYMELY 649

Query: 618 SI--LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIYSA 668
           S+  +F    + G  + ++ + YSL+ + +C +  G + + ++ +FI KIY +
Sbjct: 650 SLYYIFAVLNIHGFSSTLISICYSLLFNIMCGLGLGGLSYLTASWFINKIYHS 702

>Skud_5.266 Chr5 (431486..433609) [2124 bp, 707 aa] {ON} YER113C
           (REAL)
          Length = 707

 Score =  127 bits (319), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 161/714 (22%), Positives = 272/714 (38%), Gaps = 136/714 (19%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           ++P  Y   D + L+VN+                V  D     Y+Y        F  P  
Sbjct: 53  ITPNFYKKNDFLELIVNK----------------VESDLTQLPYAY----YDLPFTCPPT 92

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
           + K+P   SL  +I GDR + S ++L   E+  C  LC      K  + ++ L++ G+  
Sbjct: 93  MHKKPLHLSLNEIIRGDRKWESDYKLRFGEDNACETLCARKTDKKGMQTLDKLVREGYVV 152

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            WL+D  LPAA     +     YY +GF LGF D                          
Sbjct: 153 QWLIDDELPAATTFISTTDHKKYYASGFPLGFVD-------------------------- 186

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                      P+  KT    Y  NH  + + FH  G+D   VVG  V P S+ +   PG
Sbjct: 187 -----------PDTDKT----YLHNHVILVIRFHGGGDDKNTVVGFEVYPKSVSDYHCPG 231

Query: 260 ACSTTGK-PLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLHIYD------PQIQ 309
           A     +  +++ ED+ +  Y  FTYSV +     V W  RW+ +L+  +       Q  
Sbjct: 232 ASKNYEQYEIVVPEDEHDLTYLPFTYSVYWREEFEVDWNHRWNYFLNAGELSDEQSAQFH 291

Query: 310 WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNE----LNLDNEFHEDS--GWKLGHGD 363
           W                      R +++D    +     +N +    EDS    K G   
Sbjct: 292 WMSLANSLGIVLSISFITFVIYIRVMRTDKKNTDSHKYLINTEGIEAEDSLDDDKYGKNS 351

Query: 364 VFRTPSKSM-----------LLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVM 412
           V+      +           +L +LV  G+Q    ++ S+  +         R S+ T+ 
Sbjct: 352 VYMVTKDWIQNGKPDLFGLKVLIVLVSFGVQFLFTIIGSLTISCSMNKLHNVRNSVLTMA 411

Query: 413 FVLYALFGFVGSYA-----------SMGVYKFFRGPYWKANMILTPIL-------LPGAI 454
            + + L  F+ S+            ++ V        +K     +PI        LPG +
Sbjct: 412 ILCFVLGAFMASFVGTRLGIVTKRRNINVNYLDHNKSFKNCREFSPIFAVICGSSLPGMV 471

Query: 455 FLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK----------- 503
            +   ++N  +    S+  +P R++ F I ++F+V +PLS  G IVA+            
Sbjct: 472 MIGTFLLNSVVGAHDSTNALPFRTIVFFISIYFVVCIPLSLFGGIVANNIPLPKYWLSGI 531

Query: 504 -QCNWDEHPTKTNQIARQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFNKI- 561
            +   D + +K  +   +  + P          + GIF    I VE+ ++Y SLW  K  
Sbjct: 532 TKDETDGNGSKLFKPKSRTRFNPL---VHCGVYLCGIFPLLVIYVEMQYVYKSLWLEKTT 588

Query: 562 ---FYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLENWL----WQWRSFIIGGLGCSIYT 614
              FY F F                        C ++      W+WR F +G  G  +Y 
Sbjct: 589 FYFFYGFLFLSIILLCVLTMEISIIGSYLLMRFCFDDKEVRNNWRWRCFEMGFSG-GVYM 647

Query: 615 FIHSI--LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
            ++S+  +F    + G  ++++ + YSL+ + LC +  GA+   ++ +FI +IY
Sbjct: 648 ELYSLYYIFVVLNIHGFSSILISICYSLLFNILCGLGLGALSCLTASWFINRIY 701

>KLLA0E20835g Chr5 complement(1857426..1859456) [2031 bp, 676 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 676

 Score =  127 bits (318), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 154/693 (22%), Positives = 264/693 (38%), Gaps = 131/693 (18%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           LSP  Y  GD++ + VN+                V  D  HF  SY YY+  F     + 
Sbjct: 57  LSPNFYEYGDKVDITVNK----------------VESDLTHF--SYGYYDLHFTCPPSQD 98

Query: 84  VEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQNW 143
           ++  P +   +++G++ + S +QL   ++++CV LC     G+  K    LIK  +   W
Sbjct: 99  MKPLPLTFSDILYGNKKWQSDYQLTFGKDEDCVRLCDRKTNGEGKKQAYELIKQNYVVQW 158

Query: 144 LV-DGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVIL 202
           L  D LP A    +++ K  YY +GF LG  D          P T E             
Sbjct: 159 LADDDLPGATTYLNTKDKKKYYSSGFPLGQYD----------PETDE------------- 195

Query: 203 DARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPGAC 261
                              Y  NH  I + +H        +VG  V P S+ +   PGA 
Sbjct: 196 ------------------AYINNHVMIVIRYHTIDQGKNTIVGFEVYPKSVSDHHCPGAS 237

Query: 262 STTGKPLILDEDKDNE-VYFTYSVKFVASDTV-WATRWDKYLH------IYDPQIQWFXX 313
                  I   ++D E + FTY+V +     V W  RW+ +++          Q  W   
Sbjct: 238 KDYTPYKIDPTNEDIEFISFTYAVYWREDFKVDWKNRWNFFINGGELKESTSNQFHWITF 297

Query: 314 XXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSML 373
                              R  ++D +   +L  +        W      +F        
Sbjct: 298 ANGIIVTSCLLLIVIAILKRQ-ETDGSITTQLAAE--------WSKARVPLF------FQ 342

Query: 374 LSILVGSGMQ-LFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFVGSYASMGVYK 432
           L++LV  G+  LF  +   I   ++     +    L   +F+  +     GS+ S  +  
Sbjct: 343 LNLLVSMGIHFLFTTLGTLIISCSLNHTHRIGSSVLTCAVFLFIS-----GSFTSSFIGA 397

Query: 433 FFRGPYWKANMILTPIL---LPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLV 489
              G   +  ++ + I    LPG   ++++++N+ L   +++  +P  ++  +   +F+V
Sbjct: 398 LLEGQMSQHKLVNSIIFGSTLPGITLVIVLLLNYILKANNAANTLPHGTVALLFGAYFIV 457

Query: 490 SVPLSFAGSIVAHKQCNWDEHPTKTNQIA----RQIPYQPWYLRTAQA-----------T 534
            VP+S  G   A +    +   T  N  A     +   +P Y+ +  +           T
Sbjct: 458 CVPISIIGGKCADRFLKVNSTNTLLNSFALAEVNKHDTRPLYVESKNSIPFVLKNPIAIT 517

Query: 535 LIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYYSLC 592
           L  G+  F  I VEL F Y SLW  K  ++Y++GF                    Y  L 
Sbjct: 518 LTFGLIPFALIYVELLFAYKSLWLQKTTLYYLYGFLLSNIVIVCICICLLSIIGCYIHLN 577

Query: 593 LEN------W------------LWQWRSFIIGGLGCSIYTFIHSILFTKF--KLGGVITV 632
             N      W             W+W++F +GG   + Y   +SIL+  F  +    I+ 
Sbjct: 578 YGNDSLNFKWDNVIGRVLEACHSWRWKAFHMGG-AVAWYMEAYSILYLIFVARYRDFISS 636

Query: 633 VLYLGYSLIISALCCVVTGAIGFFSSMFFIRKI 665
            L++ YS + + LC    G++ + SS++FI K+
Sbjct: 637 FLFVCYSTLFNILCWTAFGSLSYLSSLWFIGKL 669

>ZYRO0B03784g Chr2 complement(314902..316878) [1977 bp, 658 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 658

 Score =  124 bits (311), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 155/686 (22%), Positives = 271/686 (39%), Gaps = 118/686 (17%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L P  Y  GD + L+VN +         + E  D+          + YY+    F  P  
Sbjct: 41  LKPNVYSIGDPLELVVNTV---------ESEITDIP---------FGYYD--LPFTCPPT 80

Query: 84  VEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
            EK+P   SL  +I GDR + S ++L + ++  C  LC      +  +    LIKSG+  
Sbjct: 81  PEKKPLHLSLNEIIKGDRKWESDYKLVVGQDNPCEILCARKTTREGLQTAKDLIKSGYMV 140

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            W++D  LPAA     +     YY  GF LG  D                          
Sbjct: 141 QWMIDDDLPAATTYISTTDNLKYYAPGFPLGSVD-------------------------- 174

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                 P++ +          +F NH  + + ++   +D   +VG    P S+ +   PG
Sbjct: 175 ------PRSSRV---------FFNNHVMLVIRYNLVDSDKVTIVGFEAYPKSVSDYHCPG 219

Query: 260 ACSTTGKPLILDEDKDNEVYF---TYSVKFVASDTV-WATRWDKYLH---IYDPQIQWFX 312
           A S   KP  + +    E+ +   TYSV +     + W+ RW  Y++   + D     F 
Sbjct: 220 A-SKDFKPFEITDPPLEEIVYIPVTYSVYWREDAEIDWSDRWSLYINRAQLADSSSSTFH 278

Query: 313 XXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKSM 372
                                 +   + R     L+++ +EDS       D+F   +  +
Sbjct: 279 WMALANSVGIVLFVTFIVIVNLIM--IFRNPNEQLESKENEDSS------DIFNVANNWL 330

Query: 373 L---------LSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYA----LF 419
                     L + V  G+Q+  M++  +  +         + S+ T+  + +     + 
Sbjct: 331 RARQGFQLNRLIVCVSMGIQVMFMILGPLAISLSLTRLHNIKNSVLTIAALCFVAGAFMA 390

Query: 420 GFVGSYASM----GVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIP 475
            FVG++  M      Y F+   +     +L    LPG+I +L + +N  +    S+  +P
Sbjct: 391 SFVGTWLKMDQNISAYTFYNPVF----AVLCGSALPGSIMVLTLSLNCIIWIWDSTKALP 446

Query: 476 ARSLFFIILLWFLVSVPLSFAGSIVA---HKQCNWDEHPTKT---NQIARQIPYQPWYLR 529
             ++   +  +F+V + +S  G  VA   H+    D  P  T    ++ R+       L 
Sbjct: 447 FGTMVVFVSWYFVVCIVVSLLGGAVAAQMHRSVRHDAPPATTASDRKVLRRSRAISGKLV 506

Query: 530 TAQATLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGFXXXXXXXXXXXXXXXXXXXX 587
              A LI+G   F  I VEL ++Y S+W  K  ++Y++ F                    
Sbjct: 507 VFLAGLISGFLPFVIIYVELEYLYKSVWLEKTTLYYLYSFLFANVLLLCIVVCEISLLGC 566

Query: 588 YYSLCLENWL-----WQWRSFIIGGLGCSIYTFIHSILFTKF--KLGGVITVVLYLGYSL 640
              + L +       W+WR F+I   GCS Y  I+S+ +  F   + G   V + + YS 
Sbjct: 567 LVLMKLNHKFINDQNWRWRCFVIST-GCSWYMEIYSLYYIFFIIHMTGDSAVFISVCYSF 625

Query: 641 IISALCCVVTGAIGFFSSMFFIRKIY 666
           I + LC + TG++G+ +S +F++KI+
Sbjct: 626 IFNVLCGLATGSLGYLTSSWFVKKIH 651

>SAKL0F12914g Chr6 complement(1013914..1016037) [2124 bp, 707 aa]
           {ON} similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113C Hypothetical ORF
          Length = 707

 Score =  121 bits (304), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 164/742 (22%), Positives = 275/742 (37%), Gaps = 183/742 (24%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           + P  Y   D + ++VN+                +  D   F Y+Y  Y   F  C P +
Sbjct: 56  IRPNVYEENDPVEIIVNK----------------IESDLTQFPYAY--YELPFT-CPPTN 96

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQN 142
           V+K    SL  +I GDR + S + L+  +++ C+ LC         +  + LIK G+   
Sbjct: 97  VKKPLHLSLNEIIRGDRKWQSDYLLHFKKDEHCLRLCDRKTSPDALRKAHELIKQGYVVQ 156

Query: 143 WLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVI 201
           WL+D  LPAA     ++    YY +GF LGF D K T  GK                   
Sbjct: 157 WLIDDELPAATTFISTKDHKKYYASGFPLGFMD-KDT--GKT------------------ 195

Query: 202 LDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPGA 260
                               Y  NH  + + +H    + + +VG+ V P S+ +   PGA
Sbjct: 196 --------------------YLNNHVMLVIRYHTVDINKFTIVGLEVYPKSVSDYHCPGA 235

Query: 261 CSTTGKPLILDEDKDNE-------VYFTYSVKFVASDTV-WATRWDKYLHIYD------P 306
                     D  + N        + FTYS+ +     V W  RW+ +++  +       
Sbjct: 236 SKN------FDHYEVNTEETETTYIPFTYSIYWREEFNVDWTNRWNFFINSGEISQEKSS 289

Query: 307 QIQWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFR 366
           Q  W                      +++ +D     E    +     S W + H  +  
Sbjct: 290 QFHWISLANSVVIVTLMTLVVALILAKSVSTD-----ETVSTSTSQVASQWVVQHSYLLN 344

Query: 367 TPSKSMLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTVMFVLYALFGFV-GSY 425
                  L++    G+Q    ++ S+  +         R S+ T+     AL  F+ G+Y
Sbjct: 345 H------LNVFTAMGVQFLFTILGSLIISCSMNKLHNIRNSVLTM-----ALMCFISGAY 393

Query: 426 ASMGVYKFFRGPYWKANMILTPIL-------LPGAIFLLIVIMNFFLLFAHSSGVIPARS 478
            S      F G    AN   T  +       LPG    +++I+N  +    S+  +P  +
Sbjct: 394 TSS-----FVGALLSANHNTTIKISIACGSALPGFTLCVVLILNCIIWAKDSTHALPFGT 448

Query: 479 LFFIILLWFLVSVPLSFAGSIVA---HKQC-----------------NWDEHPTKTNQIA 518
           +  +I ++F+V +PLS  G + A    ++C                 ++D+ P   N++ 
Sbjct: 449 IVLLITVYFIVCIPLSILGGVSATYTRRKCLSLDPRSIINRFFLLNIHYDDQPVVENKV- 507

Query: 519 RQIPY------QPWYLRT-AQATLIAGIFSFGSIAVELYFIYSSLWFNKI--FYMFGFXX 569
             +P        P  LR     T+I+GI  F  I VEL F+Y SLW  K   +Y++GF  
Sbjct: 508 -HLPRISGNSKLPLMLRQPVLLTVISGIVPFIVIYVELLFVYKSLWLEKTTFYYLYGFLL 566

Query: 570 XXXXXXXXXXXXXXXXXXYYSLC------------------------------------- 592
                             Y +L                                      
Sbjct: 567 ANIVLLCVVVCEISIIGCYLTLIHVSPDEFIPIATPEQAMHSPMLKQVRVQAMNFVCAIG 626

Query: 593 LENWLWQWRSFIIGGLGCSIYTFIHSILF--TKFKLGGVITVVLYLGYSLIISALCCVVT 650
           L    W+W+SF IGG   + Y   +S+ +  T  K+    +++L+  YS + + LC    
Sbjct: 627 LAMTQWRWKSFQIGG-SVAWYLEAYSLYYFLTVLKIRDFSSILLFFCYSALFNFLCWCSF 685

Query: 651 GAIGFFSSMFFIRKIYSAIKVE 672
           GA+G+ S  +F+ +I++  K E
Sbjct: 686 GALGYLSCCWFVNRIHTNSKKE 707

>CAGL0G03487g Chr7 complement(337133..339247) [2115 bp, 704 aa] {ON}
           similar to uniprot|P40071 Saccharomyces cerevisiae
           YER113c
          Length = 704

 Score =  121 bits (303), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 162/732 (22%), Positives = 280/732 (38%), Gaps = 136/732 (18%)

Query: 6   WLLIYCYATLTKGFSLPG-LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEH 64
           W++    + +T  ++  G ++P  Y  GD + L+VN+                V  D   
Sbjct: 32  WIIPSVLSAITLNYNSHGWVNPNLYKIGDHVELIVNK----------------VESDLTQ 75

Query: 65  FLYSYDYYNKRFHFCRPEHVEKQPE--SLGSVIFGDRIYNSPFQLNMLEEKECVALCKST 122
             Y+Y  Y+  F  C P   EK+P   SL  +  GDR + S ++L+   +  C  LC   
Sbjct: 76  LPYAY--YDLPF-ICPPTK-EKKPLHLSLDEIFRGDRKWQSDYKLSFGIDSPCEILCARK 131

Query: 123 IPGKDAKFINTLIKSGFFQNWLVD-GLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDG 181
              +       L++ G+   WL+D  LPAA     S     YY  GF +G+ D +    G
Sbjct: 132 TKKEGMIKAKELVQQGYVTQWLIDESLPAATTFISSTNHNKYYAAGFPVGYVDDRT---G 188

Query: 182 KAVPSTMEELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNY 241
           K                                       +  NH  + + +H    + +
Sbjct: 189 KT--------------------------------------FLNNHVMLVIRYHPVSEEEF 210

Query: 242 RVVGVIVNPVSI-ERSSPGACSTTGKPLILDEDKDNE---VYFTYSVKFVASDTV-WATR 296
            +VG  V P S+ +   PGA     K  I+  +KD+E   + FTYSV +     V W  R
Sbjct: 211 TIVGFEVYPKSVSDYHCPGANKNHDKYEIIVPEKDDELTFIPFTYSVYWREEFEVDWNHR 270

Query: 297 WDKYLHIYD------PQIQWFXXXXXXXXXXXXXXXXXXXXXRALKS------DLARYNE 344
           W+ +L+  +       Q  W                      +          ++     
Sbjct: 271 WNYFLNNGELSNSKANQFHWMSFLNSVGIASMTTTIVSIILLKIFSKKERESRNINTSTN 330

Query: 345 LNLDNEFHED---SGWKLGHGDVFRTPSKS---MLLSILVGSGMQLFLMVMCSIFFAAVG 398
           L  DNE   D   SG    +   + T  K      L  L   G+Q    ++ S+  +   
Sbjct: 331 LGQDNEDDNDDKISGSVFVNAKTWITVGKIPYWKALICLTSMGIQFSFTILGSLIISCSL 390

Query: 399 LVSPVSRGSLPTVMFVLY----ALFGFVGSYASMGVYKFFRGPYWKANMILTPIL----- 449
                 R ++ T+  + +    A+ G++GS   +  Y+  +G Y +  +  T +      
Sbjct: 391 SKLHNIRFTVLTMSLICFICGAAISGYIGSRLYIE-YQILKG-YLRNEVNRTKVYKFSVV 448

Query: 450 ----LPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQC 505
               LPG + ++   +N  +L   S+  +P ++  F++ ++F+  +PLS  G ++A   C
Sbjct: 449 CGSSLPGLLMVISFSLNCIILAHDSTNALPFKTEVFLVSIYFVTCIPLSLLGGVLA-LNC 507

Query: 506 NWDEHPT-------KTNQIARQ-----IPYQPWYLR----------TAQATLIAGIFSFG 543
             D + T       + N I+R+           Y R          T    L  G FSF 
Sbjct: 508 KVDSYNTLKRITSLRRNTISRKSRSDFTKKVSLYQRLVFDIKHDSFTTFGALAGGFFSFI 567

Query: 544 SIAVELYFIYSSLWFNKI--FYMFGFXXXXXXXXXXXXXXXXXXXXYYSLCLEN-----W 596
            I VEL ++Y S+W  K   +Y +GF                    Y  L  +N      
Sbjct: 568 IIWVELQYVYKSVWLEKTSFYYYYGFLLANILILSIVTIEIAIIGCYVMLKAKNDRYLRH 627

Query: 597 LWQWRSFIIGGLGCSIYTFIHSILFTKFKLG--GVITVVLYLGYSLIISALCCVVTGAIG 654
            W W+SF++G   C+ Y  ++S+ +  F L   G  ++ + + YSL+ + +C    G++ 
Sbjct: 628 TWGWKSFLMGS-SCAWYMELYSLYYIFFVLNMQGFSSIFISVCYSLLFNGMCGWALGSLS 686

Query: 655 FFSSMFFIRKIY 666
           + +S   + +IY
Sbjct: 687 YLTSYMLVTQIY 698

>Ecym_7143 Chr7 (290555..292585) [2031 bp, 676 aa] {ON} similar to
           Ashbya gossypii AGL295C
          Length = 676

 Score = 79.7 bits (195), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 158/726 (21%), Positives = 258/726 (35%), Gaps = 181/726 (24%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           + P  Y  G+E+ +L+N+                V G       SY YY+ +F  C P  
Sbjct: 40  VRPRIYQDGEEVEMLLNQ----------------VVGKPGEL--SYGYYDLQFT-CTPTK 80

Query: 84  VEKQ-PESLGSVIFGDRIYNSPFQLNMLEEKECVALC-KSTIPGKDAKFINTLIKSGFFQ 141
             +    SL  V  GDR + S ++L    E +C  LC + T P    +  ++LI+  +  
Sbjct: 81  SRRMVHHSLYEVFSGDRKWQSDYKLYFNRENKCSTLCFRKTQPSGLIE-ADSLIRQNYTV 139

Query: 142 NWLVDGLPAARKAYDS-RTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
             L+D +  A K Y S R    YY  GF LGF D          P T             
Sbjct: 140 QLLIDEIMPASKTYVSMRDNKRYYVPGFPLGFVD----------PET------------- 176

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                             ++ Y  NHF + + ++    + Y +VG  V P S+ +   PG
Sbjct: 177 ------------------DVTYLHNHFMLVIRYNAVDINKYTIVGFEVYPKSVSDDHCPG 218

Query: 260 ACSTTGKPLILDEDKDNE-VYFTYSVKFVASDTV-WATRWDKYLHIYDPQIQWFXXXXXX 317
           +        +   +KD   +  TYSV +     V W  RW+ YL   D  +         
Sbjct: 219 SSKDYENYAVNPSEKDVVFIPITYSVYWREEFMVDWENRWNFYLSAGDLDVN-------- 270

Query: 318 XXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTPSKS------ 371
                          R +K  +  +  L L +     S   LG G +F T   S      
Sbjct: 271 ----------KSLCFRGIKVTMV-FIILTLMSLAIIVSRLGLGTGSMFITAVASEWVRRG 319

Query: 372 ----MLLSILVGSGMQLFLMVMCSIFFAAVGLVSPVSRGSLPTV---MFVLYALFGFVGS 424
               + L+  V  G+Q+       IF A   L+   S G L  +   +  + AL    G 
Sbjct: 320 APCLLFLNTFVSMGIQV-------IFAAPATLLLICSMGKLHNISNFLVCIAALCYMTGI 372

Query: 425 YASMGVYKFFRGPYWKANM-----------ILTPILLPGAIFLLIVIMNFFLLFAHSSGV 473
           + S      F G     N+           +L    LP     ++V+ N           
Sbjct: 373 FMSA-----FGGILLSGNLLDNKAQIRKYSVLYGSALPALTVAVLVLANSIAWIIERGKE 427

Query: 474 IPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEH----------------PTK---- 513
           +P R +  ++ L+F+VS+PLS  G   A  +   D+H                P+K    
Sbjct: 428 MPFRDITLLLALYFMVSLPLSLLGGTSASYKLK-DQHFQLYSLSTKYTGTPVSPSKPTFW 486

Query: 514 ---------TNQIA-RQIPYQPWYLRTAQATLIAGIFSFGSIAVELYFIYSSLWFN--KI 561
                    T   A  QIP   W  +    T I GI  F +I +++ FI+  LW +   +
Sbjct: 487 FNFEYDTRGTPACAHEQIPM--WLSKPFLITSIIGIIPFLAIYLQMEFIWKPLWTHSKSL 544

Query: 562 FYMFGFXXXXXXXXXXXXXXXXXXXXYYSL--------CLENWL-----------WQWRS 602
           F ++                      Y  +        C ++             W+W++
Sbjct: 545 FQIYVSLIIGMILQSILVMEICILIMYVHMHHGDDSECCFDDTCVTGRISNAVSSWRWKA 604

Query: 603 FIIGGLGC---SIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSM 659
           F +GG        Y+  + I   + +  G  +++LYL Y  +++       G+IG+ +  
Sbjct: 605 FYMGGAAAWYWEAYSLYYMIFILRLRNFG--SILLYLSYGTLLNVFYFYSFGSIGYLACC 662

Query: 660 FFIRKI 665
           +F+ K+
Sbjct: 663 WFLNKL 668

>KAFR0K01950 Chr11 complement(401168..403162) [1995 bp, 664 aa] {ON}
           Anc_7.411 YER113C
          Length = 664

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 115/278 (41%), Gaps = 60/278 (21%)

Query: 34  EIPLL----VNRLTPSIYFQHQDEE--GNDVSGDKEHFLYSYDYYNKRFHFCRPEHVEKQ 87
            IP++     NRLTP+IY +  D E   N +  D       Y YY+  F  C P + +++
Sbjct: 25  HIPIIQRHDANRLTPNIYRKGDDVELIVNKIESDLTKL--PYGYYDLPF-ICPPTN-QRK 80

Query: 88  P--ESLGSVIFGDRIYNSPFQLNMLEEKECVALC-KSTIPGKDAKFINTLIKSGFFQNWL 144
           P   SL  ++ GDR + S + L   ++ +C  LC + T P    K IN L+K  +   W 
Sbjct: 81  PLHMSLTEILRGDRKWQSDYSLTFGKDNDCAVLCARKTTPEGIQKAIN-LVKKDYIVQWS 139

Query: 145 VDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVILD 203
           +D  LPA+     +     YY  GF LGF D          P T                
Sbjct: 140 IDNDLPASTTFISTSENRKYYIPGFSLGFVD----------PDT---------------- 173

Query: 204 ARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPGACS 262
                          E  Y  NH  + + +H   ++++ +VG+ V P S+ +   PGA  
Sbjct: 174 ---------------ETAYLNNHVMLVIRYHAIDDEHFTIVGLEVYPKSVSDYHCPGASR 218

Query: 263 TTGKPLILDEDKDNEVY--FTYSVKFVAS-DTVWATRW 297
              +  ++  D +   Y  FTYSV +    D  W  R+
Sbjct: 219 NYEQFELVANDDEEVTYIPFTYSVYWREEFDVEWKDRY 256

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 105/238 (44%), Gaps = 22/238 (9%)

Query: 449 LLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWD 508
           LLP  I ++ + +N  +    SS  +P +++ F+I ++F+V +PLS  G   A   C   
Sbjct: 421 LLPAVIMIITIFLNNIVWAHGSSRALPLKTILFLISIYFIVCIPLSLLGGSYASDICQKR 480

Query: 509 EHPTKTNQIARQIPYQPWYL-RTAQATL----------IAGIFSFGSIAVELYFIYSSLW 557
                ++   +++      L RT ++            I G+F F  I VEL  +Y  +W
Sbjct: 481 TLRAFSSPAQQKLAVTNSNLARTIKSIFDDPFSGLLASIGGLFPFFIIYVELQHVYKFVW 540

Query: 558 FNK--IFYMFGFXXXXXXXXXXXXXXXXXXXXYYSL-----CLENWLWQWRSFIIGGLGC 610
             K   +Y+  F                    Y  +      LEN  W+WRSF I    C
Sbjct: 541 LEKASFYYLRWFLFANIIILCIVVVEIAIISAYIMMHSSRSSLEN-SWRWRSFQISS-SC 598

Query: 611 SIYTFIHSI--LFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFFSSMFFIRKIY 666
           + Y  ++S+  +F      G  +++L +  S + + LC    G+IG+ ++ +F+ ++Y
Sbjct: 599 AWYMELYSLYYIFYVLNTTGFSSILLSVCSSALFNGLCGCALGSIGYLATCWFVGRVY 656

>Kwal_27.10746 s27 (479237..481309) [2073 bp, 690 aa] {ON} YER113C -
           Hypothetical ORF [contig 33] FULL
          Length = 690

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/292 (21%), Positives = 115/292 (39%), Gaps = 65/292 (22%)

Query: 16  TKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKR 75
           ++ +    + P  Y  GD++ +++N++                    E   + Y YY+ +
Sbjct: 32  SQSYDFGWIKPNVYKKGDKVDVIINKVV------------------SETARFPYGYYDLQ 73

Query: 76  FHFCRPEHVEKQPE-SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTL 134
           F  C P   +K    SL  +I GDR + S + L   E  +C+ LC      +  K  + L
Sbjct: 74  F-VCPPSDKKKPLHLSLNEIIRGDRKWESDYNLAFGERHDCLRLCDRKTKPEGLKQADAL 132

Query: 135 IKSGFFQNWLV-DGLPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTS 193
           I+ G+  +WL+ D LPAA     +++   +Y  GF LG  D    V GK           
Sbjct: 133 IRQGYVAHWLIDDDLPAATTFAKTKSGKKFYTAGFPLGEVD---AVTGK----------- 178

Query: 194 EASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI 253
                      RL                  NH  + V +     + + ++G  V P S+
Sbjct: 179 ----------TRL-----------------YNHLMLVVRYQTVDVNKHTIIGFEVYPKSV 211

Query: 254 ERSSPGACSTTGKPLILDEDKDNEVY--FTYSVKFVASDTV-WATRWDKYLH 302
             +     +   +P  ++ ++    Y  FTYS+ +     + W+ RW+ ++H
Sbjct: 212 SDAHCPGANKDYQPYEINTEESEITYIPFTYSIYWREESNIDWSHRWNFFIH 263

 Score = 48.1 bits (113), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 64/142 (45%), Gaps = 26/142 (18%)

Query: 450 LPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDE 509
           LPG +   ++++N  +    SS  IP  ++   +  +F++S PLS  G   A K  N   
Sbjct: 400 LPGLVLFTVLVLNGIVWLKDSSSAIPFGTVVVFVAGYFMISFPLSLLGGFSARKMKN-AA 458

Query: 510 HPTKTNQIARQIPY-------------------QPWYLRTAQA---TLIAGIFSFGSIAV 547
                N I++  P+                   +P+ +  +     T++AGI  F  I V
Sbjct: 459 KLAPANAISKS-PFSFLLTLSYDTRSWPATALGKPFPIALSNPILLTILAGIAPFVVICV 517

Query: 548 ELYFIYSSLWFN--KIFYMFGF 567
           EL+++Y S+W      +Y++GF
Sbjct: 518 ELFYVYKSMWLQTTNFYYLYGF 539

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 598 WQWRSFIIGG-LGCSIYTFIHSILFTKFKLGGVITVVLYLGYSLIISALCCVVTGAIGFF 656
           W+W+SF+ GG +   +  +    L     L  + +++L++ Y+ + + +C    GA+G+ 
Sbjct: 615 WRWKSFVAGGSVAWYLELYSLYYLIFVLHLRDLSSILLFVCYTALFNFMCWCAFGALGYL 674

Query: 657 SSMFFIRKIYSAIKVE 672
           S ++F+  I S+ K  
Sbjct: 675 SCLWFLSHISSSSKAH 690

>KLTH0C06226g Chr3 (541022..543106) [2085 bp, 694 aa] {ON} similar
           to uniprot|P40071 Saccharomyces cerevisiae YER113C
           Hypothetical ORF
          Length = 694

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 109/281 (38%), Gaps = 67/281 (23%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           + P  Y  GD++ L VN++        + E  N            Y YY+ RF  C P  
Sbjct: 44  IKPNVYKRGDKVDLTVNKV--------ESEITN----------LPYGYYDLRF-VCPPSE 84

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQN 142
            +K    SL  VI GDR + S + L     ++C  LC         +  + LI+  +  +
Sbjct: 85  TKKPLHLSLDEVIRGDRKWESDYNLEFGVGQDCERLCDRKTMPDGLRQADRLIRENYMVH 144

Query: 143 WLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVI 201
           WL+DG LPAA     +R+   +Y  GF LG  D                           
Sbjct: 145 WLIDGDLPAATTFASTRSGKKFYTAGFPLGRVD--------------------------- 177

Query: 202 LDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPGA 260
                            +  +  NH  + + +     + Y +VG  V P S+ +   PGA
Sbjct: 178 --------------HETDKTHLHNHLMLVIRYQAFDFNRYAIVGFEVYPRSVSDYQCPGA 223

Query: 261 CSTTGKPLILDEDKDNEVY--FTYSVKFVASDTV-WATRWD 298
            S + +P +++ ++    Y  FTYSV +     + W+ RW+
Sbjct: 224 -SKSFEPYVINTEETEVTYIPFTYSVYWREESNIDWSHRWN 263

 Score = 35.8 bits (81), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 50/262 (19%), Positives = 97/262 (37%), Gaps = 70/262 (26%)

Query: 470 SSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKTNQ------IARQIPY 523
           SS  +P  +L  ++  +F++ +PLSF G   A K  +   +     Q          I Y
Sbjct: 424 SSAALPFGTLLALLTSYFVICLPLSFLGGFSARKLRSAPANGLNYEQSKVPFSFLLSIEY 483

Query: 524 QPWYLRTAQA--------------TLIAGIFSFGSIAVELYFIYSSLWFNK--IFYMFGF 567
             + L  A                T++ G   F     EL F+Y SLW  K  ++ ++GF
Sbjct: 484 HEYNLLPAGQEKEIPAILSNPFLLTIVTGFPPFVVTCTELLFVYRSLWLQKTNLYSLYGF 543

Query: 568 XXXXXXXXXXXXXXXXXXXXY-----------------------YSLC---------LEN 595
                               Y                       +S+C         L+N
Sbjct: 544 LLVNFIFLCITVCEVSLVVCYVLMIYTQPGSTDRQASNEGPDIRWSICRSPMTIVKSLKN 603

Query: 596 WL-------------WQWRSFIIGGLGCSIYTFIHSILFTKF--KLGGVITVVLYLGYSL 640
           ++             W+W++F+ G    + Y  ++S+ +  F   L    +++L++ Y+ 
Sbjct: 604 YMASTARRWKASFSSWRWKAFMAGA-SVAWYFELYSLYYLIFVLHLRDFSSILLFVCYTS 662

Query: 641 IISALCCVVTGAIGFFSSMFFI 662
           + + +C    GA+G+ + ++F+
Sbjct: 663 LFNLMCWCAFGALGYLTCLWFL 684

>TPHA0K00730 Chr11 (150877..153078) [2202 bp, 733 aa] {ON} Anc_7.411
           YER113C
          Length = 733

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 115/520 (22%), Positives = 199/520 (38%), Gaps = 92/520 (17%)

Query: 12  YATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDY 71
           Y   +KG+    + P TY  GD + ++VN++      Q +D  G+   G       SY Y
Sbjct: 38  YGKQSKGW----VHPNTYTFGDPVEVIVNKMV-----QEKDMLGDSNEG------VSYKY 82

Query: 72  YNKRFHFCRPEHVEKQ-PESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKF 130
           ++  +  C P + +K    SL  +  GD    S + L    + +C ALC         + 
Sbjct: 83  HDLPY-ICPPTNTKKSIHNSLKELFNGDYNEQSDYILKFGVDNDCQALCLRKTYNAGIRK 141

Query: 131 INTLIKSGFFQNWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTME 189
              +I   +  NW +D  LPAA     S T+   Y  GF LG+ D          P T  
Sbjct: 142 AKEMIDEDYIVNWFIDDYLPAATTYISSVTRKKKYFEGFSLGWKD----------PETGS 191

Query: 190 ELTSEASNEDVILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVN 249
                                           Y  NH  + + ++   ++ + +VG  V 
Sbjct: 192 Y-------------------------------YINNHVMLVIRYNAVDDNKFNIVGFEVY 220

Query: 250 PVSI-ERSSPGACSTTGKPLILDEDKDNE---VYFTYSVKFVAS-DTVWATRWDKY---- 300
           P SI +   PGA    G   + D + ++E   + F+YSV +    +  W TRW  +    
Sbjct: 221 PKSIPDLQCPGARRGHGHYELKDLENNDEFSLIPFSYSVYWREEFEYDWRTRWSLFVRPN 280

Query: 301 ---LHIYDPQIQ---------WFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLD 348
              L   D  +Q         W+                       L  D+  +  + + 
Sbjct: 281 YMDLDAEDESLQLGFISNLLHWY-----SPYTTVIIFTILLFLVSLLVLDINSHKLVFMS 335

Query: 349 NEFHEDSGWKLGHGDVFRTPSKSMLLSILVGSGMQ-LFLMVMCSIFFAAVGLVSPVSRGS 407
           N       W      + +T    +L +ILV  G Q LF+ +   +  +++  +  +S   
Sbjct: 336 NP-KTVIAWATTANKLNKTWKNILL-NILVSMGCQALFIFMPVIVIQSSLWSLHNISNYV 393

Query: 408 LPTVMFVLYA--LFG-FVGSYASMGVYKFFRGPYWKANM-ILTPILLPGAIFLLIVIMNF 463
           +  ++  + A  L G FVG++  M +++    P +   M I+   +LPG     + + N 
Sbjct: 394 MLQIICWISASLLVGSFVGTWLRMYMFQKKMTPNYDPKMSIVCGSILPGLTLAGVTVFNT 453

Query: 464 FLLFAHSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHK 503
              F   +   P R L ++I ++F+ S+P+S  G  +A K
Sbjct: 454 VTWFLEGNSSYPFRKLSWLIFVYFIFSIPMSLIGGSLAVK 493

>TBLA0I00330 Chr9 (52200..54341) [2142 bp, 713 aa] {ON} Anc_7.411
           YER113C
          Length = 713

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 113/526 (21%), Positives = 189/526 (35%), Gaps = 121/526 (23%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           + P  Y  GD++ +  N+  P           +D +  +    Y YD       F  P  
Sbjct: 60  IKPNLYKVGDKVQITTNKALP-----------DDPAVSQPALCY-YD-----LPFVCPPS 102

Query: 84  VEKQP--ESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQ 141
             K+P   SL  +  GD +  S + L   +++ C  LC      K  +    LIK+ +  
Sbjct: 103 DTKRPIHNSLTELFNGDYLSESDYILEFAKDEPCHILCSRKTSKKGMQRAYDLIKNDYIV 162

Query: 142 NWLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDV 200
            W VD  LP       ++     Y  GF LG+ D  QT  G+A                 
Sbjct: 163 QWYVDNDLPVGTTYISNKVNKKQYLPGFSLGYFD-NQT--GQA----------------- 202

Query: 201 ILDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPG 259
                                Y   H    V +H   +D + +VG+ V P SI + + PG
Sbjct: 203 ---------------------YLNTHLMFVVRYHAVTSDTFTIVGLEVYPRSIVDYNCPG 241

Query: 260 ACSTTGKPLILD--EDKDNEVY--FTYSVKFVAS-DTVWATRWDKY------LHIYDPQI 308
           A S    PL +   E+ D+  Y  F+YSV +    D  W  RWD +      L   D   
Sbjct: 242 A-SKDFIPLEVKVPENNDDPTYLPFSYSVYWREEFDLPWNQRWDLFKTADELLREKDLSF 300

Query: 309 QWFXXXXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSGWKLGHGDVFRTP 368
            W+                       L   + R   L   N+  +     +      R P
Sbjct: 301 HWYSLINSNSITVGVITFL------CLVISMNRMRILY--NKSWKKRQLSITTTTTTRYP 352

Query: 369 SKSMLLSILVGSGMQLFLMVMCSI--------------------FFAAVGLVSPVSRGSL 408
           +   + +I + SG+Q F +++ S+                    FF A G++  V  G+L
Sbjct: 353 N---IFTICITSGIQFFFLLISSVLITFQISKFHQIKDTIIVALFFIAFGIIVSVFIGTL 409

Query: 409 PTVMFVLYALFGFVGSYASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFA 468
               F+L                  F   Y+  N IL    LP  I L + I+N  +  +
Sbjct: 410 IQRTFILTN----------------FPDKYYLTNPILFGSTLPAFILLSMFIINSIIYLS 453

Query: 469 HSSGVIPARSLFFIILLWFLVSVPLSFAGSIVAHKQCNWDEHPTKT 514
             +   P +   +    +F++S+PLS    +++ +  ++ ++P+++
Sbjct: 454 EKNHAFPFKLSMYFFTSYFILSIPLSIISGVLSTRFISFPKYPSRS 499

>Kpol_1045.28 s1045 (64235..66280) [2046 bp, 681 aa] {ON}
           (64237..66282) [2046 nt, 682 aa]
          Length = 681

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 113/571 (19%), Positives = 206/571 (36%), Gaps = 95/571 (16%)

Query: 24  LSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYDYYNKRFHFCRPEH 83
           L P  Y  GD + LLVN+   ++            + D    L  Y Y++  F  C P  
Sbjct: 47  LQPNVYKVGDNVDLLVNKAISTL------------NAD----LKPYIYHDLPF-VCPPTS 89

Query: 84  VEKQPE-SLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKFINTLIKSGFFQN 142
           V K       S+  GD +  S ++L   ++ EC  LC              +IK  +   
Sbjct: 90  VRKPVHLEFDSLFRGDTLSESDYKLKFGDDYECEILCARKTNKNGVSKAIDMIKQDYQIL 149

Query: 143 WLVDG-LPAARKAYDSRTKTNYYGTGFELGFTDVKQTVDGKAVPSTMEELTSEASNEDVI 201
           W +D  LP +     + T+   Y  GF LG  D                           
Sbjct: 150 WSIDDELPISMPYISTITQRKKYIPGFPLGRFD--------------------------- 182

Query: 202 LDARLPKNVKPNLVKTVELPYFVNHFDIEVEFHDRGNDNYRVVGVIVNPVSI-ERSSPGA 260
                         K     Y  NH  + + ++   +D + +VG  V   S+ +   PGA
Sbjct: 183 --------------KDKNKVYLYNHSMLVIRYNAIDDDKFTIVGFEVYLRSVSDYHCPGA 228

Query: 261 CSTTGK-PLILDEDKDNEVY--FTYSVKFVAS-DTVWATRW---DKYLHIYDPQIQWFXX 313
                +  L++ E+ D+  +  FTYSV +    D  W +RW   D  +   DP++     
Sbjct: 229 SKNYEEYELVIPENDDDLTFIPFTYSVYWREEFDIDWTSRWNLFDNDIEEEDPKL--INK 286

Query: 314 XXXXXXXXXXXXXXXXXXXRALKSDLARYNELNLDNEFHEDSG-----WKLGHGDVFRTP 368
                                    + +  E    N+F  ++      W   +    ++ 
Sbjct: 287 SMLSNIMQPTRTGLFLLPLIIFSIIIVKVVENGEKNKFTTEAQLASKCWIESNNINLKSS 346

Query: 369 SKSMLLSILVGSGMQ-LFLMVMCSIFFAAVGLVSPVSRGSLPTV-MFVLYALFG--FVGS 424
             + +L++++  G+Q +F ++   I   ++  +  +S   L  + ++ +  +    F+G+
Sbjct: 347 FSASILTLVISMGVQSIFSLIGIIILKLSIYKLHDISNIVLLNIFIWFIEGILASSFLGT 406

Query: 425 YASMGVYKFFRGPYWKANMILTPILLPGAIFLLIVIMNFFLLFAHSSGVIPARSLFFIIL 484
           +  M +       Y     IL   LLP  + + +  ++  +    SS   P ++L  +I 
Sbjct: 407 WLRMNILNKKSINYNPKFSILCGSLLPFLLMIFVYPIHSIVWLIESSSRYPFKTLTMMIS 466

Query: 485 LWFLVSVPLSFAGSIVAHK----------------QCNWDEHPTKTNQIARQIPYQPWYL 528
            ++++ VP S  G  +A K                + N ++   +     R        L
Sbjct: 467 FFYIICVPFSIIGGGLAKKYRKHYKEMFGNITLDNENNDNDEKKRFKAQHRPSSINKNKL 526

Query: 529 RTAQATLIAGIFSFGSIAVELYFIYSSLWFN 559
            T   +LI  I  F  I  ELY+I+++ W N
Sbjct: 527 GTLVYSLITAIVPFFIIKSELYWIFTNKWLN 557

>AGL295C Chr7 complement(152197..154170) [1974 bp, 657 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER113C
          Length = 657

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 69/166 (41%), Gaps = 22/166 (13%)

Query: 11  CYATLTKGFSLPGLSPTTYHSGDEIPLLVNRLTPSIYFQHQDEEGNDVSGDKEHFLYSYD 70
           C  ++ + +S P   P+ Y  G+ + LLV+                ++  D+E     + 
Sbjct: 25  CGHSIWQRWSRPP-QPSAYTRGERVQLLVD----------------NIWTDRE----VWG 63

Query: 71  YYNKRFHFCRPEHVEKQPESLGSVIFGDRIYNSPFQLNMLEEKECVALCKSTIPGKDAKF 130
           YY   F    P        SLG V   +  + S + L++  E +C  LC   +     + 
Sbjct: 64  YYETLFTCPPPAEARAIYGSLGQVFRREMPWESNYVLHVRAETQCQPLCMRELRPDSHRR 123

Query: 131 INTLIKSGFFQNWLVDGLPAARKAYDSRTKTNYYGTGFELGFTDVK 176
           +  +I+ G    W +DGLPAA   Y  R  +  Y  GF+LG  D +
Sbjct: 124 LIQMIRDGAQVRWTLDGLPAA-TTYPDRQSSYRYEAGFKLGEVDAE 168

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 9/94 (9%)

Query: 145 VDG--LPAARKAYDSRT------KTNYYGTGFEL-GFTDVKQTVDGKAVPSTMEELTSEA 195
           VDG  +PAAR      T        N+  +G     + D+     GK  P  + E TS  
Sbjct: 96  VDGKHVPAARNERTEATLFGVPEDPNFQSSGINFDNYDDIPVDASGKDAPEPITEFTSPP 155

Query: 196 SNEDVILDARLPKNVKPNLVKTVELPYFVNHFDI 229
            +E ++ + +L +  KP  V+   +P   N  D+
Sbjct: 156 LDELLLENIKLARFTKPTPVQKYSVPIVANGRDL 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.141    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,665,051
Number of extensions: 3128204
Number of successful extensions: 9868
Number of sequences better than 10.0: 58
Number of HSP's gapped: 9903
Number of HSP's successfully gapped: 93
Length of query: 672
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 556
Effective length of database: 40,180,143
Effective search space: 22340159508
Effective search space used: 22340159508
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)