Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL168W (SFA1)7.350ON38638618960.0
Smik_4.707.350ON38638618290.0
Skud_4.897.350ON38538417830.0
Suva_4.787.350ON38538417740.0
Kpol_530.317.350ON38037715840.0
CAGL0L01111g7.350ON38137615620.0
Kwal_56.246427.350ON38137415520.0
KLTH0H01254g7.350ON38137415360.0
KLLA0D12342g7.350ON38438015350.0
TDEL0C019807.350ON38537815220.0
ZYRO0F11704g7.350ON38237815190.0
NCAS0A141607.350ON45137815150.0
TBLA0E00390singletonON38337815030.0
SAKL0F11374g7.350ON38337614950.0
TPHA0F029707.350ON38138214940.0
ACL148C7.350ON38137814750.0
Ecym_47237.350ON38137714660.0
KAFR0B008807.350ON38137914520.0
KNAG0C037907.350ON38238112891e-178
NDAI0A018907.350ON42238012551e-172
SAKL0A00880gsingletonON38837710531e-142
YBR145W (ADH5)3.118ON3512652302e-20
KLLA0D19929gsingletonON3863432241e-19
SAKL0C10164g3.118ON3512932222e-19
AER032W3.118ON3512722195e-19
KLLA0B00451gsingletonON3863732206e-19
Suva_4.3943.118ON3512732187e-19
NCAS0I023503.118ON3512952179e-19
KNAG0K020003.118ON3502712152e-18
SAKL0F06270gna 1ON3512932152e-18
Smik_2.2843.118ON3512732134e-18
NCAS0I01720singletonON3512732125e-18
TBLA0I011402.480ON3772722117e-18
Skud_2.2723.118ON3512932109e-18
KAFR0G014203.118ON3512722091e-17
CAGL0D00198g7.3ON3832942101e-17
Skud_13.2402.480ON3752582064e-17
TDEL0C003908.16ON3532882037e-17
Skud_13.477na 2ON3482812037e-17
SAKL0B08184gna 3ON3732712039e-17
TPHA0G032102.480ON3772772039e-17
KLLA0F18260gsingletonON3482582029e-17
KLLA0F21010g3.118ON3502582029e-17
Smik_13.520na 2ON3482572021e-16
Suva_13.2612.480ON3752702021e-16
CAGL0J01441g2.480ON3722882011e-16
KLLA0B09064gna 3ON3742592002e-16
YOL086C (ADH1)3.118ON3482771992e-16
KLTH0G15686g3.118ON3512731993e-16
Suva_13.494na 2ON3482781983e-16
Smik_15.713.118ON3482781974e-16
NDAI0A069303.118ON3512951965e-16
YMR303C (ADH2)na 2ON3482801966e-16
Skud_15.683.118ON3482781958e-16
KAFR0A007902.480ON3772211958e-16
YMR083W (ADH3)2.480ON3752581951e-15
KLTH0A00418gsingletonON3562021941e-15
Kwal_56.231983.118ON3512241931e-15
Ecym_53313.118ON3482591931e-15
TDEL0D050503.118ON3512721932e-15
AAR084WsingletonON3852591942e-15
Suva_15.813.118ON3482791922e-15
KAFR0L02010singletonON3513791922e-15
ZYRO0B05940g3.118ON3792741932e-15
CAGL0I07843g3.118ON3522571922e-15
Smik_13.2662.480ON3752581922e-15
NDAI0H021602.480ON3812601913e-15
TBLA0E034403.118ON3512231904e-15
TBLA0E03430singletonON3512241894e-15
Ecym_73912.480ON3752721905e-15
KLTH0D00616g7.3ON3823111895e-15
KLTH0G18986g8.16ON3543691871e-14
Kpol_431.82.480ON3802491871e-14
KLLA0F13530g2.480ON3752581871e-14
NCAS0A077802.480ON3732711871e-14
KLLA0F00506g7.3ON3852961871e-14
SAKL0E02838g2.480ON3772581861e-14
ZYRO0C12562gna 1ON3482601842e-14
YAL060W (BDH1)7.3ON3823081843e-14
KLTH0D05588g2.480ON3892081833e-14
SAKL0B00814g8.16ON3543851824e-14
KLTH0E05588gna 1ON3482501814e-14
Suva_10.1548.16ON3563831815e-14
Skud_1.37.3ON3823081815e-14
TPHA0M007303.118ON3502091806e-14
ZYRO0G03388g2.480ON3702891807e-14
ZYRO0G03410gsingletonON3733661808e-14
Kwal_55.20564singletonON2162001749e-14
YLR070C (XYL2)8.16ON3563831762e-13
TDEL0A025602.480ON3732581763e-13
TDEL0H044607.3ON3822761737e-13
Smik_1.67.3ON3823091727e-13
Kpol_1058.118.16ON3532611728e-13
Kwal_26.77992.480ON3872221721e-12
KAFR0L02000singletonON3612491692e-12
TDEL0F03190na 1ON3512621692e-12
Kpol_1049.187.2ON3862421682e-12
TBLA0A042907.3ON3952951683e-12
Suva_1.77.3ON3823081665e-12
KNAG0E025902.480ON3742211631e-11
Kwal_55.19574singletonON3563691612e-11
ABR229C8.16ON3533601612e-11
Kpol_1036.193.118ON3532091602e-11
Kwal_26.67397.3ON3822881603e-11
ABL033C2.480ON3731981568e-11
NCAS0J003008.16ON3572631551e-10
SAKL0D14872g7.3ON3833121561e-10
SAKL0D14894g7.2ON3852411542e-10
KAFR0I001607.2ON3853091523e-10
NDAI0H020507.3ON3853041514e-10
KNAG0K01040singletonON3913081505e-10
Suva_12.260singletonON3573691496e-10
Smik_48.1singletonON3573801471e-09
Skud_20.2singletonON3573691471e-09
Skud_4.2singletonON3573691471e-09
ZYRO0F02552g8.16ON3512621452e-09
Suva_1.67.2ON4172961453e-09
YAL061W (BDH2)7.2ON4172911425e-09
YJR159W (SOR1)na 4ON3573621408e-09
KNAG0D00110singletonON3623421409e-09
NCAS0A076707.2ON4393091401e-08
Kwal_26.6684singletonON3563751391e-08
Smik_1.57.2ON4173061391e-08
YDL246C (SOR2)singletonON3573621372e-08
Skud_1.27.2ON4173061373e-08
KAFR0I001707.3ON3812941336e-08
KNAG0I00120singletonON3812311337e-08
KLLA0D05511g8.16ON3543841292e-07
NCAS0A076607.3ON3862451292e-07
Smik_2.1703.253ON3342681273e-07
TPHA0H03100singletonON3922811283e-07
NDAI0H02950singletonON3631741273e-07
NCAS0D01220na 5ON3621571264e-07
YBR046C (ZTA1)3.253ON3342611256e-07
Kwal_47.17532na 6ON3732191257e-07
KLLA0F00528g7.2ON3812971249e-07
KAFR0C005803.253ON3342471212e-06
NDAI0G04880singletonON3613691193e-06
TPHA0J00170singletonON3613731167e-06
Skud_2.1623.253ON3342481141e-05
Kwal_56.229853.253ON3463501132e-05
NCAS0I017303.253ON3493691122e-05
KAFR0A08730singletonON3601571113e-05
NCAS0C03020singletonON3623781095e-05
TDEL0D037203.253ON3352521095e-05
KLTH0E07964gna 6ON3742191095e-05
KLLA0E19889gna 7ON3661201088e-05
NDAI0A08470singletonON3633891079e-05
Suva_4.2793.253ON3342631052e-04
SAKL0H22088gna 6ON3761981043e-04
NDAI0H02940na 5ON3611781024e-04
KLTH0C07854g3.253ON3583541015e-04
KLLA0F00638gna 8ON3822471008e-04
KLLA0A10549g3.253ON3533491008e-04
NDAI0H020607.2ON3993231008e-04
NDAI0A063203.253ON349263990.001
SAKL0D03872g3.253ON348360980.001
KLTH0B04972gna 7ON360157980.001
CAGL0M14047gna 9ON359185980.001
Suva_13.513na 9ON360157970.002
Kwal_26.9050singletonON364110950.003
Smik_13.535na 9ON360157940.004
KNAG0K02680singletonON359151930.006
KNAG0E042007.2ON385281930.006
Ecym_1093singletonON383192930.006
Skud_13.494na 9ON360157900.013
CAGL0H06853gsingletonON360175900.014
SAKL0H00374gsingletonON42897890.020
Kpol_526.18singletonON361155880.022
KAFR0C01550singletonON359178880.025
ABL090W3.253ON33493870.032
ZYRO0G10318gna 6ON37692870.033
Kwal_8.605singletonON379109860.037
TDEL0E00230singletonON362111850.046
Kwal_27.12835singletonON364109850.055
Smik_26.3singletonON12580800.056
SAKL0D14938gsingletonON378322840.079
KNAG0B06990singletonON358343830.081
TDEL0F02300na 6ON37990830.082
YMR318C (ADH6)na 9ON360157830.089
KAFR0H03770singletonON365163810.15
SAKL0C00264gsingletonON359102810.17
Skud_3.175singletonON361182790.27
CAGL0H09944g3.253ON33373790.28
Smik_3.203singletonON120106740.38
YNL223W (ATG4)2.18ON49489770.47
KLTH0C10538gsingletonON273146750.64
ZYRO0A03366g3.253ON349287760.66
TPHA0A00140singletonON362163760.68
YCR105W (ADH7)na 10ON361160760.70
TBLA0C014901.400ON86287751.1
TPHA0E007307.413ON97860741.3
Kpol_1018.1077.413ON112733722.3
CAGL0G03509g7.413ON91861722.3
KNAG0I013001.400ON80674704.4
SAKL0A10560gsingletonON409162679.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL168W
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   734   0.0  
Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   709   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   691   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   687   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   614   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   606   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   602   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   596   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   595   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   590   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   589   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   588   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      583   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   580   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   580   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   572   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   569   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   563   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   501   e-178
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    488   e-172
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   410   e-142
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...    93   2e-20
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...    91   1e-19
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    90   2e-19
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    89   5e-19
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...    89   6e-19
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    89   7e-19
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     88   9e-19
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    87   2e-18
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    87   2e-18
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    87   4e-18
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               86   5e-18
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    86   7e-18
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    86   9e-18
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    85   1e-17
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    86   1e-17
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    84   4e-17
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    83   7e-17
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    83   7e-17
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    83   9e-17
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    83   9e-17
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    82   9e-17
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    82   9e-17
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    82   1e-16
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    82   1e-16
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    82   1e-16
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    82   2e-16
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    81   2e-16
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    81   3e-16
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    81   3e-16
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    80   4e-16
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    80   5e-16
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    80   6e-16
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    80   8e-16
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    80   8e-16
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    80   1e-15
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    79   1e-15
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    79   1e-15
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    79   1e-15
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    79   2e-15
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    79   2e-15
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    79   2e-15
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              79   2e-15
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    79   2e-15
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    79   2e-15
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    79   2e-15
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     78   3e-15
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    78   4e-15
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               77   4e-15
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    78   5e-15
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    77   5e-15
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    77   1e-14
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    77   1e-14
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    77   1e-14
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    77   1e-14
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    77   1e-14
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    76   1e-14
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    75   2e-14
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    75   3e-14
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    75   3e-14
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    75   4e-14
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    74   4e-14
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    74   5e-14
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     74   5e-14
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    74   6e-14
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    74   7e-14
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    74   8e-14
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    72   9e-14
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    72   2e-13
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    72   3e-13
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    71   7e-13
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     71   7e-13
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    71   8e-13
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    71   1e-12
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              70   2e-12
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    70   2e-12
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    69   2e-12
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    69   3e-12
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     69   5e-12
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    67   1e-11
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    67   2e-11
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    67   2e-11
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    66   2e-11
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    66   3e-11
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    65   8e-11
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       64   1e-10
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    65   1e-10
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    64   2e-10
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    63   3e-10
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    63   4e-10
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    62   5e-10
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    62   6e-10
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    61   1e-09
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     61   1e-09
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    61   1e-09
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    60   2e-09
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     60   3e-09
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    59   5e-09
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    59   8e-09
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   59   9e-09
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    59   1e-08
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    58   1e-08
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     58   1e-08
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    57   2e-08
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      57   3e-08
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    56   6e-08
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  56   7e-08
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    54   2e-07
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    54   2e-07
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    54   3e-07
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    54   3e-07
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    54   3e-07
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               53   4e-07
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    53   6e-07
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    53   7e-07
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    52   9e-07
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    51   2e-06
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    50   3e-06
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                49   7e-06
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    49   1e-05
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    48   2e-05
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     48   2e-05
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    47   3e-05
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    47   5e-05
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    47   5e-05
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    47   5e-05
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    46   8e-05
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             46   9e-05
Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON...    45   2e-04
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    45   3e-04
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    44   4e-04
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    44   5e-04
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    43   8e-04
KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly...    43   8e-04
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    43   8e-04
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    43   0.001
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    42   0.001
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    42   0.001
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    42   0.001
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    42   0.002
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    41   0.003
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    41   0.004
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    40   0.006
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    40   0.006
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    40   0.006
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    39   0.013
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    39   0.014
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    39   0.020
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    39   0.022
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    39   0.025
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    38   0.032
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    38   0.033
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    38   0.037
TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3...    37   0.046
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    37   0.055
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      35   0.056
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    37   0.079
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             37   0.081
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    37   0.082
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    37   0.089
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    36   0.15 
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    36   0.17 
Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W ...    35   0.27 
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    35   0.28 
Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]...    33   0.38 
YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}  ATG4Conse...    34   0.47 
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    33   0.64 
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    34   0.66 
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 34   0.68 
YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}  ADH7NADPH-...    34   0.70 
TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {O...    33   1.1  
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    33   1.3  
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    32   2.3  
CAGL0G03509g Chr7 complement(340079..342835) [2757 bp, 918 aa] {...    32   2.3  
KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.4...    32   4.4  
SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} simila...    30   9.4  

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  734 bits (1896), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/386 (93%), Positives = 362/386 (93%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS            QYCSQF
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLKSDEIK 386
           KEINQAFEDLHNGDCLRTVLKSDEIK
Sbjct: 361 KEINQAFEDLHNGDCLRTVLKSDEIK 386

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/386 (89%), Positives = 354/386 (91%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSAATVGKPIKCIAAVAYDAKKP SVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEGLFPC+LGHEGAGIVESVGD V+TVKPGDHVIALYTAECGKCKFCTSGKTNLC AVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKG+DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDA+CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS            +YCSQF
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPKEDLAKDQTIVEKL+EMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLKSDEIK 386
           KEIN AFEDLHNGDCLRTVLK DE K
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKFDETK 386

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/384 (87%), Positives = 349/384 (90%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           M AATVGKPI+C+AAVAY+AKK LSVEEITVD PKAHEVRIKIE+TAVCHTDAYTLSGSD
Sbjct: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEGLFPC+LGHEGAGIVESVGDDV+TVKPGDHVIALYTAECGKCKFCTSGKTNLC AVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTANVQ+GDTVAVFGCGTVGLSV+QGAK RGAS            QY S F
Sbjct: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPKEDLA+DQTIVEKLI+MTDGGLDFTFDCTGNT IMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLKSDE 384
           KEINQAFEDLHNGDCLRTVL+  E
Sbjct: 361 KEINQAFEDLHNGDCLRTVLRFQE 384

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  687 bits (1774), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/384 (87%), Positives = 346/384 (90%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA+TVGKPI+CIAA+AYDAKKPLSVEEITVD PKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEGLFPC+LGHEGAGIVESVGDDV TVKPGDHVIALYTAECGKCKFCTSGKTNLC AVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQG+G+MPD TTRFHN KGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAA LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTANVQKGDTVAVFGCGTVGLSVIQGAK RGAS            QYC  F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPKEDLAK QTIVEKLIE TDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLKSDE 384
           KEINQAFEDLH GDCLRTVLK D+
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKFDK 384

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/377 (79%), Positives = 323/377 (85%), Gaps = 1/377 (0%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TVGKPI C AAVAY+A KPL VEEI VD PKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 64  LFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQG 123
           LFPCVLGHEG+GIVESVGD+V TVKPGDHV+ALYTAECGKCKFC SGKTNLCG+VRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183
           KGVMPDGT RFHN KGE +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 184 GFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGAT 243
           G+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS            ++ ++FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 244 DFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXX 303
           DFVNP E L + Q IV KL+EMTDGGLDFTFDCTGN  +MRDALEACHKGWGQS      
Sbjct: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G+LKV+EFIT+RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 364 NQAFEDLHNGDCLRTVL 380
           N AFE+LH+G+CLRTVL
Sbjct: 361 NDAFEELHHGNCLRTVL 377

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/376 (77%), Positives = 318/376 (84%)

Query: 5   TVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           T GKPI+C+AAVAY+A KP  VE+I VD PKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
           FPCVLGHEGAGIVESVGD V  VKPGDHVIALYTAEC KCKFC SGKTNLCGAVRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           GVMPDGT+RFHN KGE +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATD 244
           +GAA+KTANVQKGDTVAVFGCGTVGLSV+QGA  RGAS             +C+QFGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           F+NP +DL +++TIV KLIEMTDGGLD TFDCTGN  +MR ALEACHKGWGQS       
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+KG LKV+EFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 365 QAFEDLHNGDCLRTVL 380
           +AF+DLHNG CLRTVL
Sbjct: 362 EAFDDLHNGLCLRTVL 377

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/374 (77%), Positives = 317/374 (84%)

Query: 7   GKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C+AAVAY+A KPL++EEI VD PKAHEVR+KI YTAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126
            +LGHEGAGIVES+G+ V  VKPGDHVIALYTAEC +CKFC SGKTNLCG+VRATQGKGV
Sbjct: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186
           MPDGTTRFHN KGEDI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD  CLLGCGVTTG+G
Sbjct: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFV 246
           AA+KTANVQKGDTVAVFG GTVGLSV+QGAK+RGAS            Q+ ++FGATDFV
Sbjct: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243

Query: 247 NPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXX 306
           NP +DL   +TIV+ L+EMTDGGLD+TFDCTGNT +MR ALEACHKGWG+S         
Sbjct: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVL 380
           FEDLH+GDCLRTVL
Sbjct: 364 FEDLHHGDCLRTVL 377

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  596 bits (1536), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/374 (76%), Positives = 313/374 (83%)

Query: 7   GKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C AAVAY+A KPL+VEEI VD PKAHEVRIK+EYTAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126
            +LGHEGAG+VESVG+ V  VK GDHVIALYTAEC +CKFC SGKTNLCG+VRATQGKGV
Sbjct: 64  SILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186
           MPDGT+RFHN KGED+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD  CLLGCGVTTG+G
Sbjct: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFV 246
           AA+KTA+VQKGDTVA+FG GTVGLSV+QGA +RGAS            Q+   FGATDFV
Sbjct: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243

Query: 247 NPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXX 306
           NP + L   QTIV+KL+EMTDGGLDFTFDCTGNT +MR ALEACHKGWGQS         
Sbjct: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVL 380
           FEDLH+GDCLRTVL
Sbjct: 364 FEDLHHGDCLRTVL 377

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/380 (74%), Positives = 318/380 (83%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           M++AT GKPI+C+AAVAY+A KPL+VE+I VDAPKAHEVR+++ +TAVCHTDAYTLSG D
Sbjct: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEG FP +LGHEGAGIVESVGD V  VK GDHV+ LYTAECGKCKFC S KTNLCG+VRA
Sbjct: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFHN KGE + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTANVQ+GDTVAVFG GTVGLSV+QGAK RGAS            Q+   F
Sbjct: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GAT FVNP +DL + +TIV KLI+MTDGGLDFTFDCTGN K+MRDALEACHKGWGQS   
Sbjct: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQKG LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 361 TEINNAFEDLHHGDCLRTVL 380

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/378 (78%), Positives = 324/378 (85%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           AAT GK I C+AAVAY+A KPL+VEEITV+AP+AHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122
           G FP +LGHEGAGIVESVG+ V  VKPGDHVIALYTAEC KCKFC SGKTNLC +VRATQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RF N KGE++ HFMGCSTFS+YTVVADVSVVA+DP APL++ CLLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           TG+GAA KTANVQKGDTVAVFG GTVGLSVIQGAK+RGAS            +Y ++FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDF+NPK DL   QTIVEKLIEMTDGGLD+TFDCTGNTK+MRDALEACHKGWG S     
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+KG LKV+EFIT+ RPF E
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 363 INQAFEDLHNGDCLRTVL 380
           IN+AFEDLH GDCLRTVL
Sbjct: 364 INKAFEDLHAGDCLRTVL 381

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/378 (77%), Positives = 323/378 (85%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T GKP+  +AAVAY+A KPLSVEEITVD PKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 64  LFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQG 123
            FP +LGHEGAGIVESVG+ V +VKPGDHV+ALYTAECGKCKFC SGKTNLCG+VRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTT 183
           KGVMPDGT+RF N KGE + HFMGCSTFSEYTVVADVSVVA+DPKAPL++ACLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 184 GFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGAT 243
           G+GAA+KTANVQKGDTVA+FG GTVGLSV QGAK RGAS            +Y  +FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 244 DFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXX 303
           DF+NP  DL   QTIVEKLIEMTDGGLDFTFDCTGN K+MRDALEACHKGWG S      
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ GALKV+EFIT+RRPFK+I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 364 NQAFEDLHNGDCLRTVLK 381
           N+AFEDLH GD LRTVL 
Sbjct: 362 NEAFEDLHAGDSLRTVLN 379

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/378 (78%), Positives = 322/378 (85%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           ++T GKPI C AAVAY A KPL+VE+I VD PKAHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129

Query: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122
           G FP +LGHEG+GIVESVG+ V  VK GDHVIALYTAECGKCKFC SGKTNLCG+VRATQ
Sbjct: 130 GAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RFHN KGE + HFMGCSTFS+YTVVADVSVVA+DPKAPLD+  LLGCGVT
Sbjct: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVT 249

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           TG+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS            Q+   FGA
Sbjct: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309

Query: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDFVNPKEDL + +TIV+KLIEMTDGGL++TFDCTGN K+MRDALEACHKGWG+S     
Sbjct: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGV 369

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ G LKV+EFITHRRPF E
Sbjct: 370 AGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429

Query: 363 INQAFEDLHNGDCLRTVL 380
           IN AFEDLH+GDCLRTVL
Sbjct: 430 INDAFEDLHHGDCLRTVL 447

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 312/378 (82%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           + T GKPIKC+AAVAY A +PL+VEEI V+ P+AHEVRIKI +TAVCHTDAYTLSG DPE
Sbjct: 2   SETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPE 61

Query: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122
           G FPCVLGHEG+GIVESVG+ V +VK GDHVIALYTAECG CKFC SGKTNLCG+VR TQ
Sbjct: 62  GAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQ 121

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RF N KGE + HFMGCSTFS+YTVVADVSVVAI+  APL + CLLGCGVT
Sbjct: 122 GKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVT 181

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           TG+GAA+KTANVQK DTVAVFG GTVGLSV+QGA+ RGAS             Y  QFGA
Sbjct: 182 TGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGA 241

Query: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDF+NP  DL   +TIV KL+EMTDGGLD TFDCTGN K+MRDALE CHKGWGQS     
Sbjct: 242 TDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQKG LKV++FIT++RPF E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTE 361

Query: 363 INQAFEDLHNGDCLRTVL 380
           IN AFEDLH+GDCLRTVL
Sbjct: 362 INAAFEDLHHGDCLRTVL 379

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/376 (77%), Positives = 316/376 (84%)

Query: 5   TVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           TVGKPI C+AAVAY+A KPL+VEEI V+ PKAHEVRI+I YTAVCHTDAYTLSG DPEG 
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
           FP +LGHEGAG+VESVG  V  VKPGDHV+ALYTAEC KCKFCTSGKTNLCG+VRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           GVMPDGT+RF    GE I HFMGCSTFS+YTVVADVSVVA+D +APLD  CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATD 244
           +GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS            Q+ S FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           FVNP +DL + +TIV KLIE+TDGGLDFTFDCTGNTK+MRDALEACHKGWGQS       
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 365 QAFEDLHNGDCLRTVL 380
            AF+DLH+GDCLRTVL
Sbjct: 364 AAFDDLHHGDCLRTVL 379

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/382 (74%), Positives = 310/382 (81%), Gaps = 3/382 (0%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  VGKPI C AA+AY+A KPL+V EI VD PKAHEVRIKI  TAVCHTDAY+LSG D
Sbjct: 1   MSA--VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVD 58

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEGLFPCVLGHEG+GIVES+G DV  VK GDHVIALYTAECGKCKFC SGKTNLCG+VRA
Sbjct: 59  PEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRA 118

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGTTRFH+  G+ IYHFMGCSTFS+YTVVADVS+VA D     +   LLGCG
Sbjct: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTAN+QKGDTVAVFG GTVGLSV+QGAK RGAS             +  +F
Sbjct: 179 VTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFVNPKE L   + IV KLIEMTDGGLDFTFDCTGN  +MR+ALEACHKGWGQS   
Sbjct: 239 GATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    +TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQ G LKV+EFIT RRPF
Sbjct: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357

Query: 361 KEINQAFEDLHNGDCLRTVLKS 382
            EIN AFEDLHNG CLRTVL +
Sbjct: 358 TEINAAFEDLHNGSCLRTVLDT 379

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/378 (74%), Positives = 319/378 (84%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           + T GKPI+C AAVAY A +PL +E++TVD PKAHEVRIKI  +A+CHTDAYTLSGSDPE
Sbjct: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61

Query: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122
           GLFPC+LGHEG+GIVESVG+ V  VKPGDHV+ LYTAEC +CKFC SGKTNLCGAVRATQ
Sbjct: 62  GLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RF N KGE +YHFMGCSTFSEYTVVADVSVVA+D +APL+  CLLGCGVT
Sbjct: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVT 181

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           TG+GAA+KTA+VQ+GDTVAVFG GTVGLSV+QGAK R AS            ++ S+FGA
Sbjct: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241

Query: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDF+NPK DL + +TIV +LIEMTDGGLD TFDCTGNTK+MRDALEACHKGWGQS     
Sbjct: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY  G LKV+EF+TH+RPF+E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361

Query: 363 INQAFEDLHNGDCLRTVL 380
           IN  FEDLH+GDCLRTVL
Sbjct: 362 INSGFEDLHHGDCLRTVL 379

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/377 (73%), Positives = 305/377 (80%)

Query: 5   TVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           T GK I+C AA+AY A  PL +E ITVD PKAHEVRIKI +TA+CHTDAYTLSG DPEG+
Sbjct: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
           FP +LGHEG+GIVESVG  V  VK GDHVI LYTAEC +CKFC SGKTNLCG+VRATQGK
Sbjct: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           G+MPDGT+RF N+KGE IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGVTTG
Sbjct: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183

Query: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATD 244
           +GAA+KTA+VQKGDTVAVFG GTVGLSV+QGA+ RGAS            ++   FGATD
Sbjct: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243

Query: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           F+NP +DL   +TIV KLI+MTDGGLD TFDCTGNTK+MRDALEACHKGWGQS       
Sbjct: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY  G LKV+EF+TH RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363

Query: 365 QAFEDLHNGDCLRTVLK 381
               DLH+GDCLRTVL 
Sbjct: 364 DGLTDLHHGDCLRTVLN 380

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/379 (71%), Positives = 307/379 (81%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           ++T GK I+C AAVAY+AKKPL V+++ VDAPKAHEVRIKI  TA+CHTDAYTLSG DPE
Sbjct: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61

Query: 63  GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQ 122
           GLFPC+LGHEG+GIVES+G+ V +VK GDHVI LYTAEC KCKFC SGKTNLCGAVR TQ
Sbjct: 62  GLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
           GKGVMPDGT+RFH  +G+DI+HFMGCSTFSEYTVVADVSVVAID K  L+ A LLGCGVT
Sbjct: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           TGFGAA+K ANVQKGDTVAVFG GTVGLSV+QGA++RG S            Q+   FGA
Sbjct: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241

Query: 243 TDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDFVNP  DL   +TIV KLI MTDGGLD+TFDCTGN  +MR+ALEACHKGWGQS     
Sbjct: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                  STRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+KG LK++EFITHRR F E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361

Query: 363 INQAFEDLHNGDCLRTVLK 381
           IN  FEDLH G CLRTVLK
Sbjct: 362 INDGFEDLHMGTCLRTVLK 380

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  501 bits (1289), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 293/381 (76%), Gaps = 3/381 (0%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPK-AHEVRIKIEYTAVCHTDAYTLS-GSD 60
           A T G+ I C AAVAY A KPL+VE+ITV+AP  A       ++  + H   +++  GS+
Sbjct: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
              +  C  G  GAG+VESVG DV +VK GDHVIALYTAEC +CK C SGKTNLC AVRA
Sbjct: 62  VRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
           TQGKGVMPDGT+RF N+KGE + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAALKTANVQKGDTVAVFG GT+GLSV+QGAK R AS            ++   F
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFVNPK DL   QTIVEKL+EMTDGGLDFTFD TGN ++MRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY KG LK++EFIT++RPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 361 KEINQAFEDLHNGDCLRTVLK 381
           KEIN+ FEDLH+GDCLRTVL 
Sbjct: 361 KEINEGFEDLHHGDCLRTVLN 381

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  488 bits (1255), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 271/380 (71%), Gaps = 46/380 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           + + T GKPI C AAVAY+A KPL+VE+I VD PKAHEVRIKI+YTAVCHTDAYTLSG D
Sbjct: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           PEG FP +LGHEG+GIVESVG+ V  VK GDHVIALYTAECG+CKFC SG          
Sbjct: 145 PEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
                                                      A+D  AP+D+ CLLGCG
Sbjct: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218

Query: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
           VTTG+GAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS            Q+   F
Sbjct: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPK DL + +TIV KLIEMTDGGL++TFDCTGNTK+MRDALEACHKGWG+S   
Sbjct: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIII 338

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKV+EFITHRRPF
Sbjct: 339 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398

Query: 361 KEINQAFEDLHNGDCLRTVL 380
            EIN AFEDLH+GDCLRTVL
Sbjct: 399 TEINNAFEDLHHGDCLRTVL 418

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  410 bits (1053), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/377 (51%), Positives = 261/377 (69%), Gaps = 3/377 (0%)

Query: 7   GKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           G+PI+C AAVAY   KPL +E+I VD P+ HEVR+K+  TA+C TD +TL G +PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 67  CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126
           CVLGHEG+GIVES G  V TVK GDHV+ LY  ECG C  C S K+NLC  ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186
           MP G++R HN + + ++HFMGCS+FS+Y VV+D+S V I   APLD  CLLGCGVTTGFG
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFV 246
           A +    V+ GD VAVFG GTVGLSV+Q                    ++   FGATDF+
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 247 NPKEDLAKDQTIVEKLIEMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXX 305
           NP++ + K++++++ LI+ + G G DFTFDCTG+T +MR ALE+C KGWG S        
Sbjct: 245 NPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGA 303

Query: 306 XXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQ 365
               ST P+ L+ GR W+G AFGG+KGRSE+  L++ Y    +K++E+IT++RP KEIN+
Sbjct: 304 GEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINE 363

Query: 366 AFEDLHNGDCLRTVLKS 382
           A ++L +G  L+TVL +
Sbjct: 364 ALKELEDGLVLKTVLDT 380

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 115/265 (43%), Gaps = 33/265 (12%)

Query: 9   PIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPC 67
           P K  A V Y+    L  +++TV  PK +E+ + ++Y+ VCH+D +   G  P  L FP 
Sbjct: 7   PEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 68  VLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126
           + GHEGAG+V  +G +V   K GD   I      C  C++C  G  + C  +        
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-------- 118

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGF 185
             DGT   H+             TF EY     V    I P   L + A +L  G+T   
Sbjct: 119 --DGTGFTHDG------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITV-- 162

Query: 186 GAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATD 244
             ALK ANV  G  V + G CG +G   IQ A   G               +  Q G   
Sbjct: 163 YKALKRANVIPGQWVTISGACGGLGSLAIQYALAMGYRVIGIDGGNAKRKLF-EQLGGEI 221

Query: 245 FVNPKEDLAKDQTIVEKLIEMTDGG 269
           F+    D  +++ IV  +I+ T+GG
Sbjct: 222 FI----DFTEEKDIVGAIIKATNGG 242

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 90.9 bits (224), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 90/343 (26%), Positives = 140/343 (40%), Gaps = 48/343 (13%)

Query: 41  IKIEYTAVCHTDAYTLSGSDPE---------GLFPC-VLGHEGAGIVESVGDDVITVKPG 90
           IK+ +T++C TD     G +PE         G F   +LGHEG GI++ VGD V   K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 91  DHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST 150
           D VI    + CG C+ C     + C     T G G                I  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 151 FSEY--TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTV 208
            +EY  T  AD S+ ++      +AA +L   + T     ++  NV+ GDTVA+ G G V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 209 GLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG 268
           G+  +  ++L   S                + G+T  +N  ++ A     V K++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAKEDA-----VSKILEYTNG 274

Query: 269 -GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW--KGS 325
            G+D   +  G  +   D  +   K  G                +P      ++W    +
Sbjct: 275 RGVDCVMEAVG-AQATWDICQRVIKEGGH-------LANVGVHGKPVNFEIDKLWIKNLT 326

Query: 326 AFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFE 368
              G+   +  G L+K    G LK E  +TH   F E++  + 
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMSGNYN 369

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 90.1 bits (222), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 128/293 (43%), Gaps = 39/293 (13%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + +  K  A + Y+    L  ++I V  PK++E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPQIPETQK--AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAGIV  +G++V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    PD           D+  +    +F +Y     V    I P   L + A +L
Sbjct: 116 ---------PDA----------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK+AN++ G+ VA+ G CG +G   IQ AK  G               +
Sbjct: 157 CAGITV--YKALKSANLRAGEWVAISGACGGLGSLAIQYAKAMGYRVLGIDGGDEKAALF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
             + G   F+    D  K + +V+ +++ T+GG         N  +   A+EA
Sbjct: 215 -KELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 116/272 (42%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ +  K  A + Y+   PL   +I V  PKA E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPTIPRTQK--AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAG+V ++G++V   K GD   I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPIL 156

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
           C   T +  ALK+AN++ GD VA+ G CG +G   IQ A   G              Q  
Sbjct: 157 CAGITVY-KALKSANLRAGDWVAISGACGGLGSLAIQYATAMGYR-VLGIDGGEEKEQLF 214

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
            Q G   F+    D  K + IV  +++ T+GG
Sbjct: 215 RQLGGEVFI----DFRKSKDIVADVVKATNGG 242

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score = 89.4 bits (220), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 95/373 (25%), Positives = 145/373 (38%), Gaps = 51/373 (13%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKAHEVR---IKIEYTAVCHTDAYTLSGSDPE------- 62
           + A+ Y     L  E+  +  PK  + R   IK+  T++C TD     G  PE       
Sbjct: 31  MKAMVYYGANDLRFEDRAI--PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVK 88

Query: 63  --GLFPC-VLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVR 119
             G F   VLGHEG GIV  VGD V  +K GD VI      CG C+ C  G    C    
Sbjct: 89  NEGSFNGRVLGHEGTGIVTEVGDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC---- 144

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
                  M DG            Y   G       T  AD S+ A+      + A LL  
Sbjct: 145 -------MNDGGWALG-------YSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSD 190

Query: 180 GVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQ 239
            + T     ++  NV+ GD+VA+ G G VG+  +  ++L   S            +   +
Sbjct: 191 ALPTAHEIGVQMGNVKPGDSVAILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKE 250

Query: 240 FGATDFVNP-KEDLAKDQTIVEKLIEMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQS 297
            GAT  +N  KED       V K++E+T+G G+D   +  G     +   + C     Q 
Sbjct: 251 MGATHTINSGKEDA------VAKILEITNGRGVDCAMEAVG----AQPTWDICQ----QI 296

Query: 298 XXXXXXXXXXXXSTRPFQLVTGRVW--KGSAFGGIKGRSEMGGLIKDYQKGALKVEEFIT 355
                         +P      ++W    +   G+   +    L+K+   G L+ ++ ++
Sbjct: 297 IKEGGHLANVGVHGKPVDFAIDKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVS 356

Query: 356 HRRPFKEINQAFE 368
           H   FK++   + 
Sbjct: 357 HHCNFKDMANNYN 369

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 88.6 bits (218), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 117/273 (42%), Gaps = 35/273 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  + +  K I  V Y+    L  ++I V  PKA+E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQAIPESQKAI--VFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  L FP + GHEGAG+V  +G +V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                     DGT   H+             TF EY     V    +     L + A +L
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHLPENVDLAEVAPIL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             GVT     ALK AN+  G  V + G CG +G   IQ A   G              Q 
Sbjct: 157 CAGVTV--YKALKRANLIPGQWVTISGACGGLGSLAIQYATAMGYR-VIGIDEGETKKQL 213

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
               G   F+    D  K++ IV  +I+ TDGG
Sbjct: 214 FEGLGGEVFI----DFTKEKDIVGAVIKATDGG 242

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 88.2 bits (217), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 127/295 (43%), Gaps = 35/295 (11%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +       K  L  ++I V  PK++E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQKAVIFETNGGK--LEYKDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAG+V ++GD V   K GD+  I      C  C++C  G  + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAMGDAVKGWKIGDYAGIKWLNGSCMSCEYCELGNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                                 D+  +    +F +Y     V    I P + L + A +L
Sbjct: 116 -------------------PHADLSGYTHDGSFQQYATADAVQAARIAPGSDLAEVAPVL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK+AN++ G+ VA+ G CG +G   IQ AK  G               +
Sbjct: 157 CAGITV--YKALKSANLRAGEWVAISGACGGLGSLAIQFAKAMGYRVVGIDGGDEKAKMF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACH 291
               G   F+    D  K + IV  +I+ T+GG     + + + + +  +++ C 
Sbjct: 215 -KDLGGEVFI----DFTKTKDIVGDIIKATNGGAHGVINVSVSEQAIDASVKYCR 264

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 116/271 (42%), Gaps = 37/271 (13%)

Query: 23  PLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGAGIVESVG 81
           PL  +EI V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P V GHEGAGIV ++G
Sbjct: 20  PLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVAMG 79

Query: 82  DDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGE 140
           D V     GD+  I      C  C+ C     + C            P            
Sbjct: 80  DSVKNWNIGDYAGIKWLNGSCMNCESCELANESNC------------PQA---------- 117

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTANVQKGDT 199
           D+  +    +F +Y     V    I     L + A +L  GVT     ALK+AN++ GD 
Sbjct: 118 DLSGYTHDGSFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTV--YKALKSANLKAGDW 175

Query: 200 VAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTI 258
           VA+ G CG +G   IQ A   G               +  + G   F+    D  K + +
Sbjct: 176 VAISGACGGLGSLAIQYATAMGYRVLGIDGGEEKAELF-KKLGGEYFI----DFTKCKDV 230

Query: 259 VEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
           + +++E+TDGG         N  +   A+EA
Sbjct: 231 IAEILEVTDGGAHGVI----NVSVSEAAIEA 257

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 129/293 (44%), Gaps = 39/293 (13%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA+ + K  K  A + Y+    L  ++I V  PK++E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSASQIPKTQK--AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAG+V ++G++V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    P+           D+  +    +F +Y     V    I     L + A +L
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK+AN++ G+ VA+ G CG +G   IQ AK  G               +
Sbjct: 157 CAGITV--YKALKSANLRAGEWVAISGACGGLGSLAIQYAKAMGYRVLGIDGGEEKAALF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
             + G   F+    D  K + +V+ +++ T+GG         N  +   A+EA
Sbjct: 215 -KELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 117/273 (42%), Gaps = 35/273 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  + K  K I  V Y+    L  +++TV  PK +E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQAIPKTQKAI--VFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  L FP + GHEGAG+V  +G +V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                     DGT   H+             TF EY     V    I     L + A +L
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVNLAEVAPIL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK AN+  G  V + G CG +G   IQ A   G               +
Sbjct: 157 CAGITV--YKALKRANLMPGQWVTISGACGGLGSLAIQYALAMGFRVIGIDGGEAKRKLF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
             + G   F+    D  K++ +   +I+ T+GG
Sbjct: 215 -EKLGGEIFI----DFTKERDVAGAVIKATNGG 242

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 117/273 (42%), Gaps = 35/273 (12%)

Query: 23  PLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGAGIVESVG 81
           PL  ++I V  PK++E+ + I+Y+ VCHTD +   G  P +   P V GHEGAGIV ++G
Sbjct: 21  PLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGIVVAIG 80

Query: 82  DDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGE 140
           D+V   K GD+  +      C  C++C  G  + C            P+           
Sbjct: 81  DNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNC------------PNA---------- 118

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTV 200
           D+  +    +F +Y     V    I     L     + C   T +  ALK+AN++ G+ V
Sbjct: 119 DLSGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKSANLRAGEWV 177

Query: 201 AVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIV 259
           A+ G CG +G   IQ A   G               +  Q     F+    D  K + ++
Sbjct: 178 AISGACGGLGSLCIQYANAMGYRVLGIDGGDDKAKLF-KQLHGEVFI----DFTKTKDVI 232

Query: 260 EKLIEMTDGGLDFTFDCTGNTKIMRDALEACHK 292
            ++ ++T+GG         N  +   A+EA  K
Sbjct: 233 SEVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 115/272 (42%), Gaps = 33/272 (12%)

Query: 2   SAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP 61
           +A +   P    A V Y+   PL    I V  PK +E+ I ++Y+ VCHTD +   G  P
Sbjct: 26  TATSFKIPTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWP 85

Query: 62  EGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVR 119
             +  P V GHEGAG+V + G +V   + GD+  I      C  C+ C  G  + C    
Sbjct: 86  LAVKLPLVGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNC---- 141

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLG 178
                             +  D+  +    +F +Y     V    I     L + A +L 
Sbjct: 142 ------------------EQADLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILC 183

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
            GVT     ALKTA+V+ G  VA+ G CG +G   +Q AK  G               + 
Sbjct: 184 AGVTV--YKALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGLRVVGIDGGDEKKKLFH 241

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
           S  G   FV    D  K  +IV+ + ++T+GG
Sbjct: 242 S-LGGDIFV----DFTKTHSIVKDIQDVTNGG 268

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 84/293 (28%), Positives = 122/293 (41%), Gaps = 39/293 (13%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  V K  K I  V Y+    L  +++ V  PK +E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQVVPKTQKAI--VFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  L FP + GHEGAG+V  +G +V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                     DGT   H+             TF EY     V    I     L + A +L
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVDLAEVAPIL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK AN+  G  V + G CG +G   +Q A   G               +
Sbjct: 157 CAGITV--YKALKRANLMPGQWVTISGACGGLGSLAVQYALAMGYRVIGIDGGEAKQKLF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
               G   F+    D  K++ +V  +I+ TDGG         N  +   A+EA
Sbjct: 215 EELHGEI-FI----DFTKEKDVVGAVIKATDGGSHGVI----NVSVSEAAIEA 258

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 117/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +  + Y+    L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQKGV--IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  +  P V GHEGAG+V ++G++V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLDVKLPLVGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPIL 156

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
           C   T +  ALK+AN+  G+ VA+ G CG +G   IQ AK  G               + 
Sbjct: 157 CAGITVY-KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMGYRILGIDGGDEKAALF- 214

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
            + G   F+    D  K + I   +IE T+GG
Sbjct: 215 KELGGEVFI----DFTKTKDIEAAVIEATNGG 242

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/294 (28%), Positives = 117/294 (39%), Gaps = 65/294 (22%)

Query: 31  VDAPKA---HEVRIKIEYTAVCHTD----------------AYTLSGSDPEGLFPCVLGH 71
           +D PK    HE+ I + +  +C TD                 + LSG D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 72  EGAGIVESVGDDVITVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCGA 117
           E +GIV+ VG  V   KPGD V+   T  CG               C  C  G  N C  
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCC-T 132

Query: 118 VRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLL 177
             + QG G +  G                    F+E  VV +  VV I  K PLD A L+
Sbjct: 133 HGSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
              ++  + AA + A  ++G    V G G +GL++I   K   A             +  
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMT--DGGLDFTFDCTGNTKIMRDALEA 289
            +     F NP    A  Q  +EKL E++  D G D+TFDC+G       A++A
Sbjct: 231 EKLNVVVF-NPTHTRA--QNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/258 (28%), Positives = 109/258 (42%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+    L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPLVGGHEGA 97

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G +V   K GD   I      C  C+FC SG  + C            P+    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PEA--- 142

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F ++     +    I P   L + A +L  GVT     ALK A
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTV--YKALKEA 193

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N++ GD VA+ G  G +G   +Q A   G               +  Q G   F+    D
Sbjct: 194 NLKAGDWVAISGAAGGLGSLAVQYATAMGYRVLGIDAGEEKEKLF-KQLGGEVFI----D 248

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + +V  + E T GG
Sbjct: 249 FTKTKDMVSDIQEATKGG 266

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 90/288 (31%), Positives = 123/288 (42%), Gaps = 37/288 (12%)

Query: 15  AVAYDAKKPLSVEEITVDAPK-AHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLG 70
           AV  + K+ + +E   +   K  H+V+I+I+ T +C +D  Y   GS  + +   P VLG
Sbjct: 6   AVVLEKKELIQIESRPIPEIKNPHDVKIQIKATGICGSDVHYFTQGSIGDFVVKSPLVLG 65

Query: 71  HEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCG--AVRATQGKGVMP 128
           HE AG+V  VGD V +VK GD V           K   SG  NLC   A  AT       
Sbjct: 66  HESAGVVVEVGDAVSSVKVGDRVAVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY---- 121

Query: 129 DGTTRFHNAKGED-IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGA 187
           DGT   +    ED +Y      +F E  VV  +SV                         
Sbjct: 122 DGTLVKYYLSPEDFVYKLADHISFEEGAVVEPLSVAV----------------------H 159

Query: 188 ALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN 247
           A + AN   G  V V G G VGL     AK  GA+            +   QFGAT  V 
Sbjct: 160 ANRLANTAFGQAVLVLGAGPVGLLAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVL 219

Query: 248 PKEDLAKDQTIVEKLIEMTDGGL--DFTFDCTGNTKIMRDALEACHKG 293
            K D   D+  +  L+  + GGL  D  F+C+G  K +R A+++  +G
Sbjct: 220 FKPD--SDENDLVSLVTKSLGGLHPDVVFECSGAEKCIRAAVKSVKRG 265

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 82.8 bits (203), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 119/281 (42%), Gaps = 37/281 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y++   L  + I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++GD+V   K GD   +    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNC------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I     L + A +L  G+T     ALK+A
Sbjct: 113 ----PHADLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITV--YKALKSA 166

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N++ G+ VA+ G  G +G   +Q AK  G               + S  G   F+    D
Sbjct: 167 NLRAGNWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGPGKQELFTS-LGGEVFI----D 221

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHK 292
             K++ I+  +++ TDGG         N  +   A+EA  K
Sbjct: 222 FTKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 119/271 (43%), Gaps = 31/271 (11%)

Query: 2   SAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP 61
           + AT   P K    + Y+    L  E+I V  PK +E+ I ++Y+ VCHTD +   G  P
Sbjct: 22  TMATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWP 81

Query: 62  -EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVR 119
                P V GHEGAG+V ++G++V   K GD   I      C  C++C     + C    
Sbjct: 82  LPTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHAD 141

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
            +   G   DG+  F      D   ++  +   E T +A+VS +             L  
Sbjct: 142 LS---GYTHDGS--FQQYATAD---YVQAARIPEGTDLAEVSPI-------------LCA 180

Query: 180 GVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCS 238
           GVT     ALK+AN++ GD VA+ G  G +G   +Q AK  G              +   
Sbjct: 181 GVTV--YKALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMGYR-VLGIDGGAEKGELVK 237

Query: 239 QFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
           + G   F+    D  K + +VE + E T+GG
Sbjct: 238 KLGGEVFI----DFTKHKNLVEAVQEATNGG 264

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 82.8 bits (203), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 118/277 (42%), Gaps = 33/277 (11%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+   PL  ++I V  PK++E+ I +EY+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +GD+V   K GD   I      C  C+ C +G    C                  
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANC------------------ 141

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
               +  D+  +    +F +Y     V    I     L + A +L  GVT     ALKTA
Sbjct: 142 ----EHADLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTV--YKALKTA 195

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ GD VA+ G  G +G   +Q A   G               +  + G   F+    D
Sbjct: 196 DLKPGDWVAISGAAGGLGSLAVQYAAAMGLRVIGIDGGEDKKKLF-EKCGGEVFI----D 250

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALE 288
             K + IV+ + E T GG     + + + K +  +++
Sbjct: 251 FTKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQ 287

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 114/258 (44%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y+    L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C     + C            PD    
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I     L + A +L  GVT     ALK+A
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTV--YKALKSA 166

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ GD VA+ G CG +G   IQ AK  G               +  + G   FV    D
Sbjct: 167 DLKAGDWVAISGACGGLGSLAIQYAKAMGYRVLGIDTGAEKAKLF-KELGGEYFV----D 221

Query: 252 LAKDQTIVEKLIEMTDGG 269
            A  + +++++++ T+GG
Sbjct: 222 YAVSKDLIKEIVDATNGG 239

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/258 (29%), Positives = 111/258 (43%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y+    L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 13  IFYENGGELQYKDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 72

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD   I      C  C++C     + C            P+    
Sbjct: 73  GVVVAMGENVKGWKIGDFAGIKWLNGSCMSCEYCELSNESNC------------PEA--- 117

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I     L + A +L  GVT     ALK+A
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTV--YKALKSA 168

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N++ GD VA+ G  G +G   +Q AK  G               +    G   F+    D
Sbjct: 169 NLKAGDWVAISGAAGGLGSLAVQYAKAMGYRVLGIDAGEEKAKLF-KDLGGEYFI----D 223

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + I E++IE T GG
Sbjct: 224 FTKSKNIPEEVIEATKGG 241

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 109/257 (42%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y++   L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++GD+V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T +  ALK+AN
Sbjct: 113 ----PHADLSGYTHDGSFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDL 252
           ++ G  VA+ G  G +G   +Q AK  G               + S  G   F+    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFTS-LGGEVFI----DF 222

Query: 253 AKDQTIVEKLIEMTDGG 269
            K++ IV  +++ TDGG
Sbjct: 223 TKEKDIVSAVVKATDGG 239

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 112/270 (41%), Gaps = 33/270 (12%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+    L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 26  STIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
           +  P V GHEGAG+V  +G +V   K GD   I      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCG 180
                 PD           D+  +    +F ++     +    I     L + A +L  G
Sbjct: 140 ------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 181 VTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQ 239
           VT     ALK AN++ GD VA+ G  G +G   +Q A   G               +  Q
Sbjct: 184 VTV--YKALKEANLKAGDWVAISGAAGGLGSLAVQYATAMGYRVLGIDAGAEKEKLF-KQ 240

Query: 240 FGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
            G   F+    D  K + +V  + E T GG
Sbjct: 241 LGGEVFI----DFTKTKDMVSDIQEATKGG 266

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 116/288 (40%), Gaps = 31/288 (10%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+    L  +++ V  PK +E+ I + Y+ VCHTD +   G  P G
Sbjct: 23  STLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLG 82

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
              P V GHEGAG+V + G  V   + GD+  I      C  C+FC  G  + C      
Sbjct: 83  AKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA--- 139

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
                              D+  +    +F +Y     +    I     L     + C  
Sbjct: 140 -------------------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAG 180

Query: 182 TTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQF 240
            T +  ALK ++V+ G  VA+ G  G +G   +Q AK  G               + S  
Sbjct: 181 VTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGMRVLGIDAGDEKRKLFES-L 238

Query: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALE 288
           G   FV    D  K + +V ++ E+T+GG     + + + K +  ++E
Sbjct: 239 GGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 113/259 (43%), Gaps = 35/259 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y+    L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 37  IFYENGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 96

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C     + C            PD    
Sbjct: 97  GVVVAMGENVKGWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA--- 141

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP--LDAACLLGCGVTTGFGAALKT 191
                  D+  +    +F +Y   AD    A  PK     + A +L  GVT     ALK+
Sbjct: 142 -------DLSGYTHDGSFQQYA-TADAVQAARIPKGTDLAEVAPILCAGVTV--YKALKS 191

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE 250
           AN++ GD VA+ G  G +G   +Q AK  G              +   Q G   FV    
Sbjct: 192 ANLKAGDWVAISGAAGGLGSLAVQYAKAMGYR-VVGIDGGEEKGKLVKQLGGEAFV---- 246

Query: 251 DLAKDQTIVEKLIEMTDGG 269
           D  K + +V ++ E+T+GG
Sbjct: 247 DFTKTKDMVAEIQEITNGG 265

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 116/277 (41%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y++   L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G++V   K GD+  I      C  C++C  G  + C            P     
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC------------PHA--- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T +  ALK+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDL 252
           +  G  VA+ G  G +G   +Q AK  G               + S  G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRS-IGGEVFI----DF 222

Query: 253 AKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
            K++ IV  +++ TDGG         N  +   A+EA
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/273 (29%), Positives = 120/273 (43%), Gaps = 35/273 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +  + Y+    L  ++I V  PKA+E+ + ++Y+ VCHTD +   G  
Sbjct: 1   MSAHEIPKTQKGV--IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  +  P V GHEGAG+V ++G++V   K GD   I      C  C+ C  G  + C   
Sbjct: 59  PLPVKLPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    P+           D+  +    +F +Y     V    I   A L + A +L
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPAGADLAEIAPIL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK+AN+Q GD VA+ G  G +G   +Q AK  G              Q 
Sbjct: 157 CAGITV--YKALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMGYR-VLGIDGGEEKEQL 213

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
             Q G   F+    D    + I  ++I+ T+GG
Sbjct: 214 FRQLGGEVFI----DFRTCKDIEGEIIKATNGG 242

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 118/278 (42%), Gaps = 37/278 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y++   L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNC------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I     L + A +L  G+T     ALK+A
Sbjct: 113 ----PHADLSGYTHDGSFQQYATADAVQAAHIPEGTDLAEVAPILCAGITV--YKALKSA 166

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N++ G  VA+ G  G +G   +Q AK  G               + S  G   F+    D
Sbjct: 167 NLRAGHWVAISGAAGGLGSLAVQYAKAMGYRVVGIDGGPGKEELFTS-LGGEVFI----D 221

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
             K++ IV  +I+ TDGG         N  +   A+EA
Sbjct: 222 FTKEKDIVGAVIKATDGGAHGIV----NVSVSEAAIEA 255

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 80.5 bits (197), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 118/278 (42%), Gaps = 37/278 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y++   L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD+  I      C  C++C  G  + C            P     
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNC------------PHA--- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I     L + A +L  G+T     ALK+A
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITV--YKALKSA 166

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N+  G  VA+ G  G +G   +Q AK  G               + S  G   F+    D
Sbjct: 167 NLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVLGIDGGEGKEELFRS-IGGEVFI----D 221

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
             K++ IV  +++ TDGG         N  +   A+EA
Sbjct: 222 FTKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 80.1 bits (196), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 123/295 (41%), Gaps = 35/295 (11%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +       K  L  ++I V  PK+ E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQKAVIFETNGGK--LEYKDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAGIV  VG++V   K GD   I      C  C++C  G  + C   
Sbjct: 59  PLATKLPLVGGHEGAGIVVQVGENVQGWKVGDLAGIKWLNGSCMACEYCELGNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    P+           D+  +    +F +Y     V    I     L + A +L
Sbjct: 116 ---------PNA----------DLSGYTHDGSFQQYATADAVQAARIPQGTDLAEVAPVL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQY 236
             G+T     ALK+AN++ G+ VA+ G  G +G   +Q AK  G               +
Sbjct: 157 CAGITV--YKALKSANLRAGEWVAISGAAGGLGSLAVQYAKAMGYRILGIDGGEEKEKLF 214

Query: 237 CSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACH 291
             + G   F+    D  K + IV  +I+ T+GG     + + +   +  + E C 
Sbjct: 215 -RELGGEIFI----DFTKTKDIVGDIIKATNGGAHGVINVSVSEAAIGASTEYCR 264

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 80.1 bits (196), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 117/280 (41%), Gaps = 37/280 (13%)

Query: 14  AAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           A + Y++   L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           GAG+V  +G++V   K GD+  I      C  C++C  G  + C                
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNC---------------- 112

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALK 190
                    D+  +    +F EY     V    I     L + A +L  G+T     ALK
Sbjct: 113 ------PHADLSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITV--YKALK 164

Query: 191 TANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPK 249
           +AN++ G   A+ G  G +G   +Q AK  G               + S  G   F+   
Sbjct: 165 SANLRAGHWAAISGAAGGLGSLAVQYAKAMGYRVLGIDGGPGKEELFTS-LGGEVFI--- 220

Query: 250 EDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
            D  K++ IV  +++ T+GG         N  +   A+EA
Sbjct: 221 -DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 118/278 (42%), Gaps = 37/278 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y++   L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C  G  + C            P     
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC------------PHA--- 115

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    + P   L + A +L  G+T     ALK+A
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITV--YKALKSA 166

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           N+  G  VA+ G  G +G   +Q AK  G               + S  G   FV    D
Sbjct: 167 NLMAGHWVAISGAAGGLGSLAVQYAKAMGYRVIGIDGGEGKEELFRS-IGGEVFV----D 221

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
             K++ IV  +++ T+GG         N  +   A+EA
Sbjct: 222 FTKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 79.7 bits (195), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 97/221 (43%), Gaps = 28/221 (12%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+   PL+ +++ V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 25  STIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLP 84

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
           +  P V GHEGAGIV + G +V   + GD   I      C  C+ C  G  + C      
Sbjct: 85  VKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNC------ 138

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCG 180
                           +  D+  +    +F +Y          I     L + A +L  G
Sbjct: 139 ----------------EHADLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAG 182

Query: 181 VTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           VT     ALKTA +Q G+ VA+ G CG +G   IQ AK  G
Sbjct: 183 VTV--YKALKTAALQPGEWVAISGACGGLGSLAIQYAKAMG 221

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 109/258 (42%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+ K  L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G +V   K GD   I      C  C+FC SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F ++     +    I     L + A +L  GVT     ALK A
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTV--YKALKEA 193

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ GD VA+ G  G +G   +Q A   G               +  + G   F+    D
Sbjct: 194 DLKAGDWVAISGAAGGLGSLAVQYATAMGYRVLGIDAGEEKEKLF-KKLGGEVFI----D 248

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + +V  + E T GG
Sbjct: 249 FTKTKNMVSDIQEATKGG 266

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 89/202 (44%), Gaps = 26/202 (12%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGAGIVESVGD 82
           L ++ I V +PKA+E+ I ++++ VCH+D +   G  P +   P V GHEGAGIV ++G 
Sbjct: 25  LELKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGA 84

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
            V   K GD+  I    + C  C+ C       C                         D
Sbjct: 85  SVRGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA----------------------D 122

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
           I  F    +F +Y     V    I P   L     + C   T F  ALKTAN+  G+ VA
Sbjct: 123 ISGFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITVF-KALKTANLTAGNWVA 181

Query: 202 VFG-CGTVGLSVIQGAKLRGAS 222
           + G CG +G   IQ AK  G S
Sbjct: 182 ISGACGGLGSMAIQYAKAMGYS 203

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 100/224 (44%), Gaps = 30/224 (13%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K  A + Y+   PL  ++I V  P A E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPEIPKTQK--AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAG+V ++G++V   K GD+  I      C  C+ C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    P+           D+  +    +F +Y     V    I     L + A +L
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAEVAPVL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
             G+T     ALK+AN+  GD VA+ G CG +G   IQ A   G
Sbjct: 157 CAGITV--YKALKSANLSAGDWVAISGACGGLGSLCIQYATAMG 198

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 109/259 (42%), Gaps = 31/259 (11%)

Query: 14  AAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           A + Y+    L   +I V  PK  E+ I ++Y+ VCHTD +   G  P     P V GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           GAG+V ++G++V   K GD   I      C  C++C     + C            PD  
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDA- 115

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                    D+  +    +F +Y     V    I     L     + C   T +  ALK+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKS 165

Query: 192 ANVQKGDTVAVFGC-GTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE 250
           A +Q G+ VA+ G  G +G   +Q AK  G               +  + G   F+    
Sbjct: 166 ARLQAGEWVAISGASGGLGSLAVQYAKAMGYRILGIDSGEEKKKLF-KELGGEYFI---- 220

Query: 251 DLAKDQTIVEKLIEMTDGG 269
           D A+ + +V ++I++T+GG
Sbjct: 221 DFAESKDVVAEVIKVTNGG 239

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 116/272 (42%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ +  K +  + Y+    L  ++I V  P  +E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPTIPETQKGV--IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  +  P V GHEGAG+V ++G +V   K GD+  I      C  C+ C  G  + C   
Sbjct: 59  PLPVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
                    P            D+  +    +F +Y     V    I P   L     + 
Sbjct: 116 ---------PQA----------DLSGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVL 156

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
           C   T +  ALK+A ++ G  VA+ G CG +G   +Q AK  G               + 
Sbjct: 157 CAGLTVY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMGYRVLGIDGGDEKAKMF- 214

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
            + G   F+    D  K + I+ ++++ T+GG
Sbjct: 215 KELGGEYFI----DFTKCKDIIGEVVKATNGG 242

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 79.3 bits (194), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 108/259 (41%), Gaps = 32/259 (12%)

Query: 15  AVAYDAKK-PLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           A+ +D    PL   EI V  PK  E+ I ++Y+ VCHTD +   G  P     P V GHE
Sbjct: 46  AIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 105

Query: 73  GAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           GAG+V ++G++V   + GD   I      C  C+ C  G  + C            P+  
Sbjct: 106 GAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEA- 152

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                    D+  +    +F +Y     V    I     L     + C   T +  ALK+
Sbjct: 153 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKS 202

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE 250
           AN++ G+ VA+ G CG +G   IQ A+  G               +  + G   FV    
Sbjct: 203 ANLRAGNWVAISGACGGLGSLAIQYARAMGYRVLEIDGGDEKEALF-RKLGGEVFV---- 257

Query: 251 DLAKDQTIVEKLIEMTDGG 269
           D  K + +V  +++ T GG
Sbjct: 258 DFRKSKDVVADVVKATGGG 276

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/279 (27%), Positives = 117/279 (41%), Gaps = 39/279 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y++   L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V ++G++V     GD   I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNC------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAAC--LLGCGVTTGFGAALKT 191
                  D+  +    +F +Y     V    I PK    A C  +L  G+T     ALK+
Sbjct: 113 ----PHADLSGYTHDGSFQQYATADSVQAAHI-PKGTDLAECAPVLCAGITV--YKALKS 165

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE 250
           AN+  G  VA+ G  G +G   +Q AK  G               + S  G   F+    
Sbjct: 166 ANLSAGQWVAISGAAGGLGSLAVQYAKAMGYRVVGIDGGEGKEELFRS-IGGEVFI---- 220

Query: 251 DLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
           D   ++ IV  +I+ TDGG         N  +   A+EA
Sbjct: 221 DFTTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 96/379 (25%), Positives = 148/379 (39%), Gaps = 40/379 (10%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ K  K I  +  +    L  ++I V  PK++E+ I + Y+ VCH+D +   G  
Sbjct: 1   MSAPTIPKTQKAI--IFSEVGGKLEYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDL 58

Query: 61  PEGLFPCVL-GHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P  L   ++ GHEGAG+V  +G +V   K GD+  I      C  C+FC       C   
Sbjct: 59  PLPLKLPLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHA 118

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
             T   G + DG                   +F +Y     V    I     L A   L 
Sbjct: 119 DFT---GTVHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLL 156

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
           C   T +  ALK+AN++ G  VA+ G CG +G   IQ A   G              +Y 
Sbjct: 157 CAGLTAY-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMGYR-VLGIDSGEEKAKYF 214

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQS 297
              G   F+    D  K + +V  +I+ TDGG     +   + + +  + +      G S
Sbjct: 215 KTLGGEVFI----DYKKSKDVVADVIKATDGGAHGVLNIAVDPRAISMSTKYVRSN-GTS 269

Query: 298 XXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHR 357
                       S    Q+V      GS  G    R++    I  + +G +K+     H 
Sbjct: 270 VLVSLPKDAVCESEVFTQVVKSTSIVGSCVG---NRADTREAIDFFTRGLIKIP---IHM 323

Query: 358 RPFKEINQAFEDLHNGDCL 376
            P   + Q ++ L   + +
Sbjct: 324 APLSSLPQIYDKLMQNEVV 342

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 112/274 (40%), Gaps = 34/274 (12%)

Query: 1   MSAATVGKPIKCIAAVAYD-AKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS 59
           MSAA      K    V ++ +  PL  +EI V  PK +E+ I + Y+ VCHTD +   G 
Sbjct: 26  MSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGD 85

Query: 60  DP-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGA 117
            P     P V GHEGAG V ++G +V   K GD   I      C  C+ C     + C  
Sbjct: 86  WPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC-- 143

Query: 118 VRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACL 176
                     PD           D+  +    +F +Y     V    I P   L + A +
Sbjct: 144 ----------PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPV 183

Query: 177 LGCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQ 235
           L  G+T     ALK+AN++ G  VA+ G  G +G   +Q AK  G               
Sbjct: 184 LCAGITV--YKALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGLRVVGIDGGPGKEEL 241

Query: 236 YCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
           +    G   F+    D  K+  IV  ++  T+GG
Sbjct: 242 F-KTLGGEVFI----DFQKESDIVGAVVNATNGG 270

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 107/257 (41%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+    L  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G++V   K GD+  I      C  C++C     + C            P+    
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC------------PEA--- 119

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T +  ALK+AN
Sbjct: 120 -------DLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSAN 171

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDL 252
           +  G+ VA+ G  G +G   +Q AK  G               +  + G   FV    D 
Sbjct: 172 LNAGEWVAISGAAGGLGSLAVQYAKAMGYRILGIDGGDEKKALF-HELGGEIFV----DF 226

Query: 253 AKDQTIVEKLIEMTDGG 269
            K + + + ++  T+GG
Sbjct: 227 TKSKNVEQDILVATNGG 243

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 109/258 (42%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+ K  L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G +V   K GD   I      C  C+FC SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F ++     +    I     L + A +L  GVT     ALK A
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTV--YKALKEA 193

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ GD VA+ G  G +G   +Q A   G               +  + G   F+    D
Sbjct: 194 DLKAGDWVAISGAAGGLGSLAVQYATAMGYRVLGIDAGEEKEKLF-KKLGGEVFI----D 248

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + +V  + E T GG
Sbjct: 249 FTKTKDMVSDIQEATKGG 266

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 109/260 (41%), Gaps = 33/260 (12%)

Query: 14  AAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           A V Y+   PL  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P V GHE
Sbjct: 42  AVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 101

Query: 73  GAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           G+G+V  VG++V   K GD   I      C  C+ C +G  + C                
Sbjct: 102 GSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNC---------------- 145

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALK 190
                 +  D+  +    +F +Y     V    I     L + A +L  G+T     ALK
Sbjct: 146 ------EHADLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITV--YKALK 197

Query: 191 TANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPK 249
            A+++ G  V + G  G +G   +Q AK  G               + S  G   F+   
Sbjct: 198 EADLKAGQWVCISGAAGGLGSLAVQYAKAMGYRVIGIDGGKAKEELFKS-MGGEVFI--- 253

Query: 250 EDLAKDQTIVEKLIEMTDGG 269
            D  K + +V+ + E T GG
Sbjct: 254 -DFTKSKDMVKDIQEATKGG 272

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/223 (29%), Positives = 96/223 (43%), Gaps = 28/223 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + +  K  A + Y    PL  +++ V  PK +E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPQTQK--AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P +   P + GHEGAG+V  +G +V   K GD+  +      C  C+ C     + C   
Sbjct: 59  PLDTKLPLIGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
                    P+           D+  +    +F EY     V    I     L     L 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGTDLAQVAPLL 156

Query: 179 CGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           C   T +  ALK+A++  G  VA+ G CG +G   IQ AK  G
Sbjct: 157 CAGVTVY-KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMG 198

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/224 (30%), Positives = 102/224 (45%), Gaps = 30/224 (13%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K  A + Y++   L  +++ V  PK +E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQK--AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P +   P + GHEGAG+V  +G +V   K GD+  +      C  C+ C     + C   
Sbjct: 59  PLDTKLPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLL 177
                    P+           D+  +    +F EY     V    I   A L + A +L
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGADLAEVAPIL 156

Query: 178 GCGVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
             GVT     ALK+A++  G+ VA+ G CG +G   +Q AK  G
Sbjct: 157 CAGVTV--YKALKSADLAAGEWVAISGACGGLGSLAVQFAKAMG 198

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 112/272 (41%), Gaps = 31/272 (11%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           +S+ + G P+   A + Y+    L  ++I V  PK +E+ + ++Y+ VCHTD +   G  
Sbjct: 23  LSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDW 82

Query: 61  PEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAV 118
           P     P V GHEGAGIV + G +V   + GD+  +      C  C++C +G  + C   
Sbjct: 83  PLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA 142

Query: 119 RATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLG 178
             +   G   DG                   +F +Y     V    I     L     + 
Sbjct: 143 DLS---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPIL 180

Query: 179 CGVTTGFGAALKTANVQKGDTVAV-FGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYC 237
           C   T +  ALKTAN+  G  VA+    G +G   +Q AK  G               + 
Sbjct: 181 CAGVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGLRVVGIDGGAAKDALF- 238

Query: 238 SQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
            + G   F+    D  K + IV  + E T+GG
Sbjct: 239 KKLGGEVFI----DFTKSKDIVADIQEATNGG 266

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 125/311 (40%), Gaps = 69/311 (22%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKAHE--VRIKIEYTAVCHTD----------------AY 54
           + A+AY  +K +   +       +HE  V I + +  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 55  TLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAEC------------- 101
            +SG   +GL P  +GHE +GIV  VG DV  VK GDHV+      C             
Sbjct: 61  AMSG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 102 -GKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST--FSEYTVVA 158
            G C  C +G  N C  +                        +  +GC +  F+E  V++
Sbjct: 117 EGLCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLS 153

Query: 159 DVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKL 218
           + +VV I    PLD A L+   ++  +  A++ + +Q G T  V G G +GL+ +   + 
Sbjct: 154 ERNVVKIPNSLPLDVAALVE-PISVSW-HAVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 219 RGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDC 276
            GA             Q     GA  F NP E       ++E L ++  G  G +F++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NPTE---HGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 277 TGNTKIMRDAL 287
            G ++     L
Sbjct: 268 CGTSETFSAGL 278

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 96/369 (26%), Positives = 152/369 (41%), Gaps = 47/369 (12%)

Query: 26  VEEITVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGD 82
           V EIT      H V+++I+ T +C +D  Y ++G+  + +   P +LGHE +G+V  VG 
Sbjct: 23  VPEIT----DPHYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILGHESSGLVVEVGS 78

Query: 83  DVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT-TRFHNAKGED 141
           +V  V+ GD V               +G+ NLC  ++      +  DGT  +++ A  + 
Sbjct: 79  EVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYYLAPEDF 136

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
           +       ++ E  +V  +SV                 GV      A K A V     VA
Sbjct: 137 LVKLPDHVSYEEGALVEPLSV-----------------GVH-----ANKLAGVAFNQRVA 174

Query: 202 VFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEK 261
           VFG G VGL     A+  GAS               S FG T FVN      KD+  + K
Sbjct: 175 VFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSAN--IKDEDDLVK 232

Query: 262 LIEMTDGGL--DFTFDCTGNTKIMRDALEACHKG--WGQSXXXXXXXXXXXXSTRPFQLV 317
            IE   GG   D  FDCTG    +R  ++ C+ G  + Q             +    +L 
Sbjct: 233 EIERVLGGARPDVVFDCTGAEICIRTGIKVCNSGGTYVQVGMGHDDVNFPIGAIGAKELK 292

Query: 318 TGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFE--DLHNGDC 375
               ++  AFG  +   ++         G + V+  +THR  F++   A+E    H  + 
Sbjct: 293 VLGCFR-YAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNIKHGSEV 345

Query: 376 LRTVLKSDE 384
           ++T++   E
Sbjct: 346 IKTIISGPE 354

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 102/249 (40%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGAGIVESVGD 82
           L   +I V  PK++E+ I ++Y+ VCHTD +   G  P  +  P V GHEGAG+V  +G+
Sbjct: 51  LKYTDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGE 110

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C+ C +G    C                      +  D
Sbjct: 111 NVKGWKLGDLAGIKWLNGSCMSCELCETGHEANC----------------------EHAD 148

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
           +  +    +F +Y     V    I   + L     + C   T +  ALKTAN++ G+ VA
Sbjct: 149 LSGYTHDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVA 207

Query: 202 VFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVE 260
           + G  G +G   +Q AK  G               + S  G   FV    D  K + IV 
Sbjct: 208 ISGAAGGLGSLAVQYAKAMGYRVVGIDGGEEKEKLFRS-LGGEVFV----DFTKSKDIVA 262

Query: 261 KLIEMTDGG 269
            +   T GG
Sbjct: 263 DIQNATKGG 271

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 111/258 (43%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+    L  +++ V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 38  IFYENGGKLEYKDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           GIV + G++V   + GD+  I      C  C+ C  G  + C          +  D +  
Sbjct: 98  GIVVAKGENVKNFEIGDYAGIKWLNGSCMSCELCEQGYESNC----------LQADLSGY 147

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
            H+             +F +Y     V    I     L + A +L  GVT     ALKTA
Sbjct: 148 THDG------------SFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTV--YKALKTA 193

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ G  VA+ G  G +G   +Q AK  G               +  Q G   F+    D
Sbjct: 194 DLKPGQWVAISGAAGGLGSLAVQYAKAMGLRVLGIDGGDGKEELF-KQCGGEVFI----D 248

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + +V  + E T+GG
Sbjct: 249 FRKSKDMVADIQEATNGG 266

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 114/271 (42%), Gaps = 35/271 (12%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TV  P      + Y+   PL  ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  
Sbjct: 24  STVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLA 83

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
              P V GHEG+G V ++G++V   K GD   I      C  C+ C SG  + C      
Sbjct: 84  TKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNC------ 137

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP--LDAACLLGC 179
                           +  D+  +    +F +Y   AD    A  PK     + A +L  
Sbjct: 138 ----------------EHADLSGYTHDGSFQQYA-TADAVQAARIPKGTNMAEVAPILCA 180

Query: 180 GVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCS 238
           G+T     ALK A+++ G  V + G  G +G   +Q AK  G               + S
Sbjct: 181 GITV--YKALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMGYRVIGIDGGPGKEELFKS 238

Query: 239 QFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
             G   FV    D  K + IV ++ E T GG
Sbjct: 239 -LGGEIFV----DFTKTKDIVAEIQEATRGG 264

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 121/296 (40%), Gaps = 57/296 (19%)

Query: 13  IAAVAYDAKKPL----SVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSGS-------- 59
           + A+AY  K+ +     +EE  ++      + I++ +  +C +D +  L G         
Sbjct: 1   MRALAYFGKQDIRYTKDLEEPVIETDDG--IEIEVSWCGICGSDLHEYLDGPIFFPEDGK 58

Query: 60  --DPEGL-FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAEC--------------G 102
             D  GL  P  +GHE +GIV  VG  V  +K GDHV+   T  C               
Sbjct: 59  VHDVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDA 118

Query: 103 KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
           +C  C  G  N C  +    G GV   G                    F+E  VV++  V
Sbjct: 119 ECAACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHV 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
           V I    PLD A L+   ++  +  A++ + +QKG +  V G G +GL+ I   +  GAS
Sbjct: 158 VKIPNTLPLDVAALVEP-ISVSW-HAVRISKLQKGQSALVLGAGPIGLATILALQGHGAS 215

Query: 223 XXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTG 278
                          ++ G   F +P E       I++KL    + G DF +DC+G
Sbjct: 216 KIVVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 108/258 (41%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y++   L  ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P V GHEGA
Sbjct: 40  IFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 99

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V + G++V+  + GD   I      C  C+ C  G  + C                  
Sbjct: 100 GVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC------------------ 141

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
            H     D+  +    +F +Y     V    I     L + A +L  GVT     ALKTA
Sbjct: 142 LH----ADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTV--YKALKTA 195

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           +++ G  VA+ G  G +G   +Q AK  G               + S  G   F+    D
Sbjct: 196 DLKPGQWVAISGAAGGLGSLAVQYAKAMGLRILGIDGGPGKEELFKS-LGGEVFI----D 250

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + IV  + E T GG
Sbjct: 251 FTKTKDIVSAIQEATKGG 268

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 106/260 (40%), Gaps = 33/260 (12%)

Query: 14  AAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           A +  +   PL  ++I V  PK +E+ I + Y+ VCHTD +   G  P     P V GHE
Sbjct: 9   AVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           GAG V ++G DV   K GD   I      C  C+ C     + C            PD  
Sbjct: 69  GAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA- 115

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALK 190
                    D+  +    +F +Y     V    I     L + A +L  G+T     ALK
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITV--YKALK 164

Query: 191 TANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPK 249
           +AN++ G  VA+ G  G +G   +Q A+  G               +    G   F+   
Sbjct: 165 SANLKAGQWVAISGAAGGLGSLAVQYARAMGLRVLGIDGGPGKEELF-KTLGGECFI--- 220

Query: 250 EDLAKDQTIVEKLIEMTDGG 269
            D  K+  I E +I+ T+GG
Sbjct: 221 -DFTKEHDIAEAVIKATNGG 239

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 119/308 (38%), Gaps = 59/308 (19%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKAH-----EVRIKIEYTAVCHTDAYT-LSG-----SDP 61
           + A+AY  K  +     T D P+       EV I + +  +C +D +  L G      D 
Sbjct: 1   MRALAYFKKGDI---HFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDG 57

Query: 62  E------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------- 102
           E         P  +GHE +GIV  VG  V  VK GDHV+    + C              
Sbjct: 58  ECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNS 117

Query: 103 -KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVS 161
             C  C  G  NLC       G GV+  G                    F+E  VV+   
Sbjct: 118 KPCDACQRGSENLCTHA-GFVGLGVISGG--------------------FAEQVVVSQHH 156

Query: 162 VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
           ++ +  + PLD A L+     T    A+K +  +KG +  V G G +GL  I   K  GA
Sbjct: 157 IIPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGA 214

Query: 222 SXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTK 281
           S            +   + G   F NP +   K   I+  L +  D G D+++DC+G   
Sbjct: 215 SKIVVSEIAERRIEMAKKLGVEVF-NPSKHGHKSIEILRGLTKSHD-GFDYSYDCSGIQV 272

Query: 282 IMRDALEA 289
               +L+A
Sbjct: 273 TFETSLKA 280

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 89/208 (42%), Gaps = 26/208 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+    L  +++ V  PK +E+ I ++Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 52  IFYEHGGELHYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGA 111

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V + G++V   + GD+  I      C  C+ C  G    C                  
Sbjct: 112 GVVVAKGENVTNFEIGDYAGIKWLNGSCMSCELCEQGNEPNC------------------ 153

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
               +  D+  +    +F +Y     V    I     L     + C   T +  ALKTA+
Sbjct: 154 ----EHADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTAD 208

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           V+ G  VA+ G  G +G   +Q AK  G
Sbjct: 209 VRPGQWVAISGAAGGLGSLAVQYAKAMG 236

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 101/385 (26%), Positives = 153/385 (39%), Gaps = 52/385 (13%)

Query: 15  AVAYDAKKPLSVEEITV-DAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF----PCV 68
           AV    +  ++ E+I V      H V++ I+ T +C +D  Y  +G+   G F    P V
Sbjct: 7   AVVLQKQGLITFEDIPVPQIEDPHYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMV 64

Query: 69  LGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMP 128
           LGHE +G+V  VG  V +VK GD V           K   SG  NLC ++       +  
Sbjct: 65  LGHESSGVVVEVGSKVTSVKVGDRVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI-- 122

Query: 129 DGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFG 186
           DGT   +    ED    +  S   E                  + AC+  L  GV     
Sbjct: 123 DGTLLKYYLSPEDFLVKLPDSVSFE------------------EGACVEPLSVGV----- 159

Query: 187 AALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFV 246
            A K A+V+ G  V VFG G VGL     ++  GA+            +  ++FGAT  V
Sbjct: 160 HANKLADVRFGSKVVVFGAGPVGLLAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTV 219

Query: 247 NPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKG-----WGQSXXXX 301
           N  +  ++D  + E    ++    +  F+C+G    +R  ++AC  G      G      
Sbjct: 220 NSSKFKSEDDLVKEIQRVLSGEQPEVVFECSGAEVCIRAGIKACKAGGRYVQVGMGKDNV 279

Query: 302 XXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFK 361
                   S     L T R   G     +K  SE          G + V+  ITHR  F+
Sbjct: 280 NFPISEVVSKELQVLGTFRYCFGDYNDSVKLISE----------GKVNVKPLITHRFKFQ 329

Query: 362 EINQAFE--DLHNGDCLRTVLKSDE 384
           +  +A+E    H  D ++T++   E
Sbjct: 330 DAIKAYEFNIEHGEDVVKTIIDGPE 354

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 71/250 (28%), Positives = 106/250 (42%), Gaps = 33/250 (13%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGAGIVESVGD 82
           L  ++I V  P A+E+ I ++Y+ VCHTD +   G  P     P V GHEGAG+V  +G+
Sbjct: 19  LEYKDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGE 78

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C+ C     + C            P            D
Sbjct: 79  NVKGWKLGDLAGIKWLNGSCMACESCELSNESNC------------PHA----------D 116

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTANVQKGDTV 200
           +  +    +F +Y     V    I     L + A +L  G+T     ALK+AN++ G+ V
Sbjct: 117 LSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITV--YKALKSANLRAGNWV 174

Query: 201 AVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIV 259
           A+ G  G +G   +Q AK  G              Q   + G   FV    D  K + +V
Sbjct: 175 AISGAAGGLGSLAVQYAKAMGYR-VIGIDGGDEKEQLFKKLGGEYFV----DFRKSKDVV 229

Query: 260 EKLIEMTDGG 269
            +++E+T GG
Sbjct: 230 AEILEVTGGG 239

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 159/383 (41%), Gaps = 58/383 (15%)

Query: 21  KKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCVLGHEGA 74
           ++P  +    V+ PK   A++V ++I+ T +C +D +  +           P VLGHE +
Sbjct: 13  EQPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESS 72

Query: 75  GIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT-TR 133
           G+V  +GD+V T+K GD V                G+ NL   ++         DGT T+
Sbjct: 73  GVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DGTLTK 130

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
           ++ A  + +Y      +F E  ++  +SV                         A + A 
Sbjct: 131 YYRAPKDFVYKIPDHVSFEEGALMEPLSVAV----------------------HANRLAK 168

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLA 253
           ++ G    VFG G VGL   + A + GA+            +   QFGAT  VN   DL 
Sbjct: 169 MRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN-SGDLP 227

Query: 254 KD---QTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEAC-------HKGWGQSXXXXXX 303
           +    +T++ K I     G D  F+C+G    +R  +E C         G GQ       
Sbjct: 228 QGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQEEIQFPI 285

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363
                 S  P + +T   ++GS F   +G  +    I+    G L ++  IT R  FKE 
Sbjct: 286 ------SKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEA 333

Query: 364 NQAFEDL--HNGDCLRTVLKSDE 384
            +AF++   H  D ++T+++  E
Sbjct: 334 IEAFDENRDHPLDNVKTIIEGPE 356

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/308 (25%), Positives = 117/308 (37%), Gaps = 59/308 (19%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKA-----HEVRIKIEYTAVC------HTDAYTLSGSDP 61
           + A+AY  K  +     T D PK       EV I + +  +C      +TD       D 
Sbjct: 1   MRALAYFKKGDI---HFTNDIPKPAIQADDEVIIDVSWCGICGSDLHEYTDGPIFMPKDG 57

Query: 62  E------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------- 102
           E         P  +GHE +GI+  VG  V  VK GDHV+    + C              
Sbjct: 58  ECHALSNAALPLAMGHEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNS 117

Query: 103 -KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVS 161
             C+ C  G  NLC A     G GV+  G                    F+E  VV++  
Sbjct: 118 KPCEACKKGSENLC-AHSGFVGLGVISGG--------------------FAEQVVVSEHH 156

Query: 162 VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
           ++ +  + PLD A L+     T    A+K +  +KG +  V G G +GL  I   K  GA
Sbjct: 157 IIPVPKEIPLDVAALVEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGA 214

Query: 222 SXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTK 281
                        +         F NP +   K   ++  L E  D G D+++DC+G   
Sbjct: 215 GKIVVSEVAERRLKMAKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQA 272

Query: 282 IMRDALEA 289
               +L+A
Sbjct: 273 TFETSLKA 280

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 92/209 (44%), Gaps = 28/209 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+   PL  ++I V  P  +E+ I + Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD+  I      C  C+ C     + C            P+    
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------------PEA--- 117

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I   A L + A +L  GVT     A+K+A
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAGVTV--YKAIKSA 168

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           N++ GD +A+ G CG +G   IQ  K  G
Sbjct: 169 NLKAGDWLAISGACGGLGSLAIQYGKAMG 197

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 116/289 (40%), Gaps = 31/289 (10%)

Query: 3   AATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP- 61
           ++T+  P      + Y++   L  +++ V  P+ +E+ + ++Y+ VCHTD +   G  P 
Sbjct: 20  SSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPL 79

Query: 62  EGLFPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRA 120
           +   P V GHEGAG+V + G++V   + GD   I      C  C+ C  G  + C     
Sbjct: 80  DTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA-- 137

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180
                               D+  +    TF +Y     +    I     L     + C 
Sbjct: 138 --------------------DLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILCA 177

Query: 181 VTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQ 239
             T +  AL+++  + G+ VA+ G  G +G    Q A+  G               + S 
Sbjct: 178 GVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGLRVVGIDGGEDKAKLFKS- 235

Query: 240 FGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALE 288
            G   F+    D  K++ I   ++E T GG     + + + K M  ++E
Sbjct: 236 LGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 93/366 (25%), Positives = 141/366 (38%), Gaps = 39/366 (10%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGAGIVESVGD 82
           L  E++ V  P ++EV I ++Y+ VCHTD +T  G  P +   P V GHEGAG+V + G 
Sbjct: 42  LYREDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGK 101

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
           DV T + GD   +    + C  C+ C  G    C      +  G   DG           
Sbjct: 102 DVKTFEIGDLAGVKQLVSSCMGCESCEIGHEFGC---EQAEMSGSSHDG----------- 147

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
                   TF +Y  +  +    +     L A   + C   + +  ALK  N+Q    VA
Sbjct: 148 --------TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVA 198

Query: 202 VFGC-GTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVE 260
           +FG  G +G   +Q AK  G              Q     G   F+    D  +   I  
Sbjct: 199 IFGATGGLGSIAVQYAKAMGYRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIPA 254

Query: 261 KLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT-G 319
            + + T GG     + T +       ++ C +  G               T  F +V  G
Sbjct: 255 AVKQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHG 313

Query: 320 RVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHNGDCL-RT 378
              KGSA G    R++    +  + +G +K    I       E+ +AFE L +G    R 
Sbjct: 314 FSIKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQTTGRL 367

Query: 379 VLKSDE 384
           VL + +
Sbjct: 368 VLDTSK 373

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 71.6 bits (174), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 86/200 (43%), Gaps = 26/200 (13%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGAGIVESVGD 82
           L  ++I V  P + E+ I ++Y+ VCHTD +   G  P     P V GHEGAG+V ++G+
Sbjct: 19  LEYKDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVALGE 78

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   I      C  C++C  G  + C                         D
Sbjct: 79  NVKGWKVGDLAGIKWLNGSCMACEYCELGNESNC----------------------PHAD 116

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
           +  +    +F +Y     V    I     L     + C   T +  ALK+A+++ G  VA
Sbjct: 117 LSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVA 175

Query: 202 VFG-CGTVGLSVIQGAKLRG 220
           + G CG +G   +Q A+  G
Sbjct: 176 ISGACGGLGSLAVQYARAMG 195

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 95/383 (24%), Positives = 153/383 (39%), Gaps = 58/383 (15%)

Query: 21  KKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCVLGHEGA 74
           ++P  +    V  PK    +EV I+I+ T +C +D +  +           P VLGHE +
Sbjct: 13  ERPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESS 72

Query: 75  GIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT-TR 133
           GIV  +G++V T+K GD V                G+ NL   ++         DGT T+
Sbjct: 73  GIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--DGTLTK 130

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
           ++    + +Y      +F E  ++  +SV                         A K A 
Sbjct: 131 YYKTMKDFVYKLPDDVSFEEGALIEPLSVAI----------------------HANKLAK 168

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLA 253
           ++ G    VFG G +GL   + A + GA+            +   QFGAT  VN   DL 
Sbjct: 169 IKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLP 227

Query: 254 KDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALEAC-------HKGWGQSXXXXXXX 304
              T V+ +I+   G  G D  F+C+G    +R  +E C         G GQ        
Sbjct: 228 HGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQF--- 283

Query: 305 XXXXXSTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEI 363
                   P  ++ T  +     F   +G  +    I+      L ++ FITHR  FK+ 
Sbjct: 284 --------PISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDA 333

Query: 364 NQAFEDL--HNGDCLRTVLKSDE 384
            +AFE+   H  + ++T+++  E
Sbjct: 334 VEAFEETSHHPLNNIKTIIEGPE 356

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 105/258 (40%), Gaps = 33/258 (12%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCVLGHEGA 74
           + Y+    L  ++I V  PK +E+ I I+Y+ VCHTD +   G  P  +  P V GHEGA
Sbjct: 36  IFYENGGELHYKDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 95

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V + G DV   + GD   +    + C  C++C  G  + C                  
Sbjct: 96  GVVVAKGKDVTNFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA--------------- 140

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     +    I     L + A +L  GVT     ALKT+
Sbjct: 141 -------DLSGYTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTV--YKALKTS 191

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
             + G  VA+ G  G +G   +Q A   G               + S  G   FV    D
Sbjct: 192 GAKPGQWVAISGAAGGLGSLAVQYATAMGLRVLGIDGGEGKEELFKS-LGGEVFV----D 246

Query: 252 LAKDQTIVEKLIEMTDGG 269
             K + +V  + E T+GG
Sbjct: 247 FTKTKDMVSAIQEATNGG 264

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 99/276 (35%), Gaps = 52/276 (18%)

Query: 38  EVRIKIEYTAVCHTDAYTLS----------GSDPEG--LFPCVLGHEGAGIVESVGDDVI 85
           EV I++ +  +C TD +  S          GS P      P  +GHE +GIV  +G  V 
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 86  TVKPGDHVIALYTAEC-------------GK-CKFCTSGKTNLCGAVRATQGKGVMPDGT 131
            VK GDHV+      C             GK C  C  G  N+C     T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                              F+E   V+    + I    PLD A L+     T   A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 192 ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           A  QKG T  V G G +GL+ I   K  GAS               +  G   F NP E 
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NPAEH 243

Query: 252 LAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDAL 287
             KD     + I     G D  FDC+G       AL
Sbjct: 244 --KDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 120/309 (38%), Gaps = 61/309 (19%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKAH-----EVRIKIEYTAVCHTDAYT-LSG-----SDP 61
           + A+AY  K  +     T D PK       EV I + +  +C +D +  L G      D 
Sbjct: 1   MRALAYFKKGDI---HFTNDIPKPEIQTDDEVLIDVSWCGICGSDLHEYLDGPIFMPKDG 57

Query: 62  E-------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------ 102
           E       GL P  +GHE +GIV  VG  V  VK GDHV+    + C             
Sbjct: 58  ECHALSNAGL-PLAMGHEMSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYS 116

Query: 103 --KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADV 160
              C+ C  G  NLC       G GV+  G                    F+E   V++ 
Sbjct: 117 SKPCEACKKGSENLC-THGGFIGLGVISGG--------------------FAEQVAVSEH 155

Query: 161 SVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRG 220
            ++ +  + PLD A L+     T    A+K +  +KG +  V G G +GL  I   K  G
Sbjct: 156 HIIPVPKEIPLDVAALVEPLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMG 213

Query: 221 ASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNT 280
           A             +     G   F NP +   K   ++  L +  D G D+++DC+G  
Sbjct: 214 AGKIVVSEVAERRIEMAKNLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQ 271

Query: 281 KIMRDALEA 289
                +L+A
Sbjct: 272 VTFETSLKA 280

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 106/261 (40%), Gaps = 29/261 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V+++I+ T +C +D +  +           P VLGHE +GIV  VG +V  V  GD V
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED-IYHFMGCSTFS 152
                      +   SG  NLC  ++      V  DGT   +    ED +Y      TF 
Sbjct: 91  AIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVTFE 148

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSV 212
           E  +V  ++V                         A+K A V+ GD V VFG G VGL V
Sbjct: 149 EGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGPVGLLV 186

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDF 272
               K  GA+                + G+T  +N K D+A++   +E   ++     + 
Sbjct: 187 GSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSK-DMAEEALALEIQNDLNGQHPNK 245

Query: 273 TFDCTGNTKIMRDALEACHKG 293
             DCTG    +R ++ AC  G
Sbjct: 246 VIDCTGAEPCLRSSILACKPG 266

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 95/222 (42%), Gaps = 30/222 (13%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           A+   P      + Y+    L  +++ V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 38  ASTNIPTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLD 97

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
           +  P V GHEGAG+V + G++V   + GD   I      C  C+ C  G    C      
Sbjct: 98  VKLPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNC------ 151

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKA--PLDAACLLGC 179
                           +  D+  +    +F +Y   AD    A  PK     + A +L  
Sbjct: 152 ----------------EHADLSGYTHDGSFQQYA-TADAVQAAQLPKGINLAEVAPILCA 194

Query: 180 GVTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           GVT     ALKTA++  G  VA+ G  G +G   +Q AK  G
Sbjct: 195 GVTV--YKALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMG 234

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 99/249 (39%), Gaps = 31/249 (12%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGAGIVESVGD 82
           L   +I V   KA+E+ I ++Y+ VCH+D Y      P     P V GHEGAG+V  +G 
Sbjct: 32  LEYRDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHEGAGVVVGMGS 91

Query: 83  DVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGED 141
           +V   K GD   +    + C  C+ C  G    C     ++  G   +G           
Sbjct: 92  NVKNWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG----------- 137

Query: 142 IYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVA 201
                   +F +Y  V  +    +     L       C   T +  A+K+AN++ G  +A
Sbjct: 138 --------SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKSANIRAGQWMA 188

Query: 202 VFG-CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVE 260
           + G CG +G   IQ  K  G               +  + G   F+    D  K + +V 
Sbjct: 189 ITGACGGLGSVAIQYCKAMGYRVVGIDAGEAKANLF-KELGGEVFI----DFTKSKDLVA 243

Query: 261 KLIEMTDGG 269
            ++  T+GG
Sbjct: 244 DVVSATNGG 252

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 111/262 (42%), Gaps = 37/262 (14%)

Query: 15  AVAYDAKK-PLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHE 72
           AV +D     L  ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P V GHE
Sbjct: 11  AVVFDTNGGELQYKDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 70

Query: 73  GAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDG 130
           GAGIV + G  V    + GD   I      C  C++C     + C            P  
Sbjct: 71  GAGIVVAKGSMVXXGWEIGDLAGIKWLNGSCMSCEYCEKANESNC------------PQA 118

Query: 131 TTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP--LDAACLLGCGVTTGFGAA 188
                     D+  +    +F +Y   AD    A  PK     + A +L  G+T     A
Sbjct: 119 ----------DLSGYTHDGSFQQYA-TADAVQAARVPKGTDLAEVAPILCAGITV--YKA 165

Query: 189 LKTANVQKGDTVAVFGC-GTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN 247
           LK+AN++ G+ VA+ G  G +G   +Q AK  G               +  Q G   F+ 
Sbjct: 166 LKSANLRAGEWVAISGASGGLGSLAVQYAKAMGYRVLGIDGGDEKAKLF-KQLGGEYFI- 223

Query: 248 PKEDLAKDQTIVEKLIEMTDGG 269
              D  K + ++ ++I+ TDGG
Sbjct: 224 ---DFTKSKDVIAEVIKATDGG 242

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 101/242 (41%), Gaps = 42/242 (17%)

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAEC--------------GKCKFCTSG 110
            P  +GHE +GI+ SVG      K GDHV+   TA C                C+ C +G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 111 KTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             N+C  +  T G GV   G                    F+E  V+ +     I    P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 171 LDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXX 230
           LD A L+     +    A+K ++ ++G +V + G G +GL  I   K  G          
Sbjct: 166 LDVASLI--QPISVCWHAVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 231 XXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALE 288
               +   + GA  F +P  +++ D +I + L EM  G  G D+TFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVF-DPS-NMSLDNSI-KTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 289 AC 290
            C
Sbjct: 281 CC 282

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 110/295 (37%), Gaps = 63/295 (21%)

Query: 26  VEEITVDAPKAHEVRIKIEYTAVCHTD----------------AYTLSGSDPEGLFPCVL 69
           ++E T++A    E+ I I +  +C TD                 + +SG       P  +
Sbjct: 18  LKEPTIEADD--ELMIDISWCGICGTDLKEYTEGAIFFPNDGECHQISGEP----LPQAM 71

Query: 70  GHEGAGIVESVGDDVITVKPGDHVIALYTAECGK--------------CKFCTSGKTNLC 115
           GHE AG+V  VG  V   K GDHV+   T  C                C  C  G  N+C
Sbjct: 72  GHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPSKNDDMCNACKKGYYNIC 131

Query: 116 GAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAAC 175
             +    G GV   G                    F+E  V+ +     +    PLD A 
Sbjct: 132 SKL-GLCGAGVQSGG--------------------FAERVVMNESHCHKVPDDLPLDIAA 170

Query: 176 LLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQ 235
           L+          AL+  N +KG +  V G G +GL +I      G +             
Sbjct: 171 LIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHGHGCTDIVVSEPAKIRRD 228

Query: 236 YCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALE 288
           +  + GAT F +P   L   +  ++ L  +  G  G D+TFDC+GN      ++E
Sbjct: 229 FAKELGATVF-DPSS-LPTHEESIKYLRSIAPGGDGFDYTFDCSGNQYTFNASIE 281

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 117/308 (37%), Gaps = 59/308 (19%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPKAH-----EVRIKIEYTAVCHTDAYTLSG--------- 58
           + A+AY  K  +     T D PK       EV + + +  +C +D +  S          
Sbjct: 1   MRALAYFKKGDI---HFTNDIPKPEIQADDEVILDVSWCGICGSDLHEYSDGPIFMPKDG 57

Query: 59  ---SDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------- 102
              S      P  +GHE +GI+  VG  V  VK GDHV+    + C              
Sbjct: 58  ECHSLSNAGLPQAMGHEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNS 117

Query: 103 -KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVS 161
             C  C  G  NLC       G GV+  G                    F+E  VV++  
Sbjct: 118 KPCDACKKGCENLCTHA-GFIGLGVISGG--------------------FAEQVVVSEHH 156

Query: 162 VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
           ++ +  + PLD A L+     T    A++ +  +KG +  V G G +GL  I   K  GA
Sbjct: 157 IIPVPKEIPLDVAALVEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGA 214

Query: 222 SXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTK 281
                        +   + G   F +P++   K    +  L +  D G D+++DC+G   
Sbjct: 215 GQIVVSEVAERRMELARRLGVEIF-DPRKHGEKSVESLRALTKSHD-GFDYSYDCSGIQA 272

Query: 282 IMRDALEA 289
               +L+A
Sbjct: 273 TFDASLKA 280

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 92/221 (41%), Gaps = 28/221 (12%)

Query: 4   ATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TV  P      + Y+    L  ++I V  PK +E+ + ++Y+ VCHTD +   G  P  
Sbjct: 22  STVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLS 81

Query: 64  L-FPCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRAT 121
           +  P V GHEGAG+V + G +V   + GD   I      C  C+ C SG  + C      
Sbjct: 82  VKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC------ 135

Query: 122 QGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCG 180
                           +  D+  +    +F +Y     V    I     L + A +L  G
Sbjct: 136 ----------------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAG 179

Query: 181 VTTGFGAALKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
           +T     ALK A++  G  V + G  G +G   +Q  K  G
Sbjct: 180 ITV--YKALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMG 218

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 144/369 (39%), Gaps = 69/369 (18%)

Query: 40  RIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVKPGDHVIAL 96
           ++ ++ T +C +D  Y  SG   + +   P VLGHE +G+V  VG  V  +K GD V   
Sbjct: 33  KVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRVAIE 92

Query: 97  YTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                       +GK NLC  +       +  DGT                      Y  
Sbjct: 93  PGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTL------------------VKYYLS 132

Query: 157 VADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQ 214
            AD  V   D  +  + AC+  L  GV +      K A V+ G TV VFG G VGL    
Sbjct: 133 PADFLVKLPDHVSFEEGACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTGA 187

Query: 215 GAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN----PKEDLAKDQTIVEKLIEMTDGGL 270
            AK  GAS            +    FGAT  +N    PK D    Q + +++ ++  G L
Sbjct: 188 VAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKND---PQALADEVEKLLGGAL 244

Query: 271 -DFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGG 329
            D  F+C+G    +   ++A   G                     Q+  G+ +       
Sbjct: 245 ADVVFECSGAESCIDAGVKATKNGGTM-----------------VQIGMGKNYVNFPIAE 287

Query: 330 IKGRS-EMGGLIK----DYQK-------GALKVEEFITHRRPFKEINQA--FEDLHNGDC 375
           + G+   + G  +    DY+        G + V++ ITHR  F++  +A  F   H G+ 
Sbjct: 288 VSGKEMTLVGCFRYSYGDYKDAVNLVSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEV 347

Query: 376 LRTVLKSDE 384
           ++T++   E
Sbjct: 348 VKTIIAGPE 356

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 89/360 (24%), Positives = 126/360 (35%), Gaps = 45/360 (12%)

Query: 15  AVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF----PCVL 69
           A+ Y+  +P+ V E        H V++KIE T +C +D  Y L GS   G F    P VL
Sbjct: 16  AIVYE-HRPVPVIE------DPHYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 70  GHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPD 129
           GHE +G V  VG DV  V+ GD V           +   SG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 130 GTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAAL 189
           GT   +    ED    +  S   E   + +   VA+                      A 
Sbjct: 125 GTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVH---------------------AN 163

Query: 190 KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPK 249
           + A  Q    V VFG G VGL     AK  GA+                  G T  V+  
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 250 EDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXX 309
            D +  + +  KL       +D  FDC+G    +  A+  C  G                
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVS-- 280

Query: 310 STRPFQLVTGRVWKGSAFGGIK-GRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFE 368
               F L    V +    G  +    +    ++      +     +THR PF    +A++
Sbjct: 281 ----FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 89/209 (42%), Gaps = 28/209 (13%)

Query: 16  VAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCVLGHEGA 74
           + Y+    L  +++ V  PK  E+ I + Y+ VCHTD +   G  P +   P V GHEGA
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 75  GIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+ C     + C            P+    
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC------------PEA--- 120

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DAACLLGCGVTTGFGAALKTA 192
                  D+  +    +F +Y     V    I   A + + A +L  GVT     ALK+A
Sbjct: 121 -------DLSGYTHDGSFQQYATADAVQAAHIPQGADMAEVAPILCAGVTV--YKALKSA 171

Query: 193 NVQKGDTVAVFG-CGTVGLSVIQGAKLRG 220
            ++ GD VA+ G  G +G   +Q AK  G
Sbjct: 172 ELKAGDWVAISGAAGGLGSLAVQYAKAMG 200

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 123/288 (42%), Gaps = 41/288 (14%)

Query: 13  IAAVAYDAKKPL----SVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSG-----SDPE 62
           + A+AY  +K +     + E T+ A  + +V+I I +  VC +D +  L G      D E
Sbjct: 1   MRALAYFGQKDIRFTNDLPEPTIQA--SDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGE 58

Query: 63  -------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG---KCKFCTSGKT 112
                  GL P  +GHE +G+V  +G  V  +K GDHV+   T  C    +         
Sbjct: 59  KHAMSGVGL-PQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASD 117

Query: 113 NLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCST--FSEYTVVADVSVVAIDPKAP 170
             C A +              F+N   E  +  +GC +  F+E  V+++  VV +    P
Sbjct: 118 EECAACKKD------------FYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIP 165

Query: 171 LDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXX 230
           LD A L+     +    A++ + ++ G +  + G G +GL+ +   +  GA         
Sbjct: 166 LDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPS 223

Query: 231 XXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTG 278
               +     GA  F NP +   K    + K+   +D G DF++DC+G
Sbjct: 224 ASRRKQAEALGALTF-NPFDHGDKAVDELRKIPPGSD-GFDFSYDCSG 269

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 82/198 (41%), Gaps = 29/198 (14%)

Query: 9   PIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS---DPEGLF 65
           P    A V Y+    L   +I V  PK +E+ + I+Y+ VCHTD +   G     P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 66  PCVLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
           P V GHEGAG+V + G +V   + GD+  +      C +C+FC                K
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQ---------------K 131

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
           G  P+  T   +    D        TF +Y     +    I P   L     + C   T 
Sbjct: 132 GFEPNCETPTLSGYTHD-------GTFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 185 FGAALKTANVQKGDTVAV 202
           +  ALKTA +  G  VA+
Sbjct: 185 Y-KALKTAALIPGQWVAI 201

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 106/263 (40%), Gaps = 30/263 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTL---SGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V+++I+ T +C +D +     S  D     P VLGHE +GI+  VG  V T+K GD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT-TRFHNAKGEDIYHFMGCSTFS 152
                      +   SG  NLC  +          DGT T+++    + +Y      ++ 
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPDNVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSV 212
           E  ++  +SV                 GV      A K A  + GD V VFG G VGL  
Sbjct: 149 EGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGPVGLLN 186

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGL-- 270
              AK+ GA             +    FGAT  +N  +    D+  +   I+   GG+  
Sbjct: 187 GAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGVDP 246

Query: 271 DFTFDCTGNTKIMRDALEACHKG 293
           D   +CTG    +R  + A   G
Sbjct: 247 DIVLECTGAEPCIRAGIRALKTG 269

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 124/312 (39%), Gaps = 66/312 (21%)

Query: 13  IAAVAYDAKKPLSVE------EITVDAPKAHEVRIKIEYTAVCHTDAYT-LSGSD--PE- 62
           + A+AY  KK +         EI  D    +E+ I I +  +C +D +  L G    PE 
Sbjct: 1   MRALAYFGKKDIHFSADIAKPEIGAD----NELEIDISWCGICGSDLHEYLDGPIFFPEE 56

Query: 63  -------GL-FPCVLGHEGAGIVESVGDDVI-TVKPGDHVIALYTAEC------------ 101
                  G+  P  +GHE +GIV  VG  V    K GDHV+   T  C            
Sbjct: 57  GKTHGVSGIGLPQPMGHEMSGIVSKVGPGVKGDYKVGDHVVVEATCTCLDRYRWPKIESS 116

Query: 102 --GKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVAD 159
               C  C  G  N C  +    G G    G                    FSE  V+++
Sbjct: 117 KLPPCSACKRGIYNCCTHL-GFCGLGAHGGG--------------------FSEKVVISE 155

Query: 160 VSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLR 219
             V+ I  + PLD A L+   ++  +  A+K +N++ G +  V G G +GL+ I   +  
Sbjct: 156 QHVIKIPKEIPLDIAALVE-PISVSW-HAVKISNLKPGQSALVLGAGPIGLATILALQGH 213

Query: 220 GASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCT 277
           GA             +  ++ G   F NP E     +  VE+L ++  G  G DF+FDC+
Sbjct: 214 GAGKIVVSEPAQIRREQAAKLGVETF-NPFE---HGEKAVEELRKIPPGGDGFDFSFDCS 269

Query: 278 GNTKIMRDALEA 289
           G        L A
Sbjct: 270 GMKATFDTGLHA 281

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 93/241 (38%), Gaps = 42/241 (17%)

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAEC--------------GKCKFCTSG 110
            P  +GHE AG+V  +G  V   + GDHV+   T+ C                C  C  G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 111 KTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             N+C  +    G GV   G                    FSE  V+    V+ I    P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 171 LDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXX 230
           LD A L+     +    A++ + +  G +  V G G +GL  I   +  GAS        
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 231 XXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALE 288
               +     GA  F +P E   ++   VE L ++  G  G D++FDC+G     R ++ 
Sbjct: 224 KNRRELAKLMGAEVF-DPTE--WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVH 280

Query: 289 A 289
           A
Sbjct: 281 A 281

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 115/309 (37%), Gaps = 62/309 (20%)

Query: 13  IAAVAYDAKKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYT-------------- 55
           + A+AY AK  +   +  V+ PK     E+ ++I Y  +C TD +               
Sbjct: 1   MRALAYFAKGDIHFTKDLVE-PKISTPDELILEINYCGICGTDLHEYIDGPIFFPEDGET 59

Query: 56  --LSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGK---------- 103
             LSGS      P  +GHE AG V  +G  V   K GDHV+      C            
Sbjct: 60  NELSGSG----LPQAMGHEIAGTVVKIGPKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHV 115

Query: 104 ----CKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVAD 159
               C  C  G  N+C  +    G GV   G                     +E   + +
Sbjct: 116 NKPWCSACKKGHYNVCSNL-GLIGNGVQSGGC--------------------AERMCINE 154

Query: 160 VSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLR 219
                +    P+D A L+     +    A+K A  ++G +V V G G +GL  +   +  
Sbjct: 155 SHCFKVPKDMPMDIAALIQPIAVSWH--AIKVARFKRGGSVLVIGGGPIGLCTLLALQGH 212

Query: 220 GASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGN 279
           G S            +   + GAT +   + +  K+   + K+I   D G D+ FD +G 
Sbjct: 213 GCSDIVVSEPAKVRRELAERMGATTYDPSQHNTEKNIQNLRKMILGGD-GFDYVFDNSGT 271

Query: 280 TKIMRDALE 288
            + +  A+E
Sbjct: 272 PETLETAIE 280

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 74/304 (24%), Positives = 121/304 (39%), Gaps = 48/304 (15%)

Query: 13  IAAVAYDAKKPL----SVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSG---------- 58
           + AVAY  K  +    ++ E  +++P   EV I++ Y  +C TD +  +           
Sbjct: 1   MRAVAYYKKGDIHFSSTLPEPKINSPD--EVLIEVSYCGICGTDLHEYTDGPIFFPKDGE 58

Query: 59  SDPEGLFPCV--LGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCG 116
           ++P    P    +GHE +G V+++G +V  V+ GD V+    A CG            C 
Sbjct: 59  TNPLSNIPLPQPMGHEFSGFVKAIGSNVTKVEVGDKVVV--EAGCG------------CK 104

Query: 117 AVRATQGKGVMPDGTTRFHNAKGEDI------YHFMGCST----FSEYTVVADVSVVAID 166
            V       +       F +A    I      Y F G       F+E  VV +  +V + 
Sbjct: 105 DVHRWPDSKLYEKRKDTFCSACENGIDNCCENYDFTGLGVVGGAFAERVVVGERHIVKLP 164

Query: 167 PKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXX 226
            + P D   L+   ++  +  A++ +  +KG +  + G G +GL+ I   K  GAS    
Sbjct: 165 EEVPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVV 222

Query: 227 XXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVE-KLIEMTDGGLDFTFDCTGNTKIMRD 285
                      S+ G   F   K     D  + E + I     G D+ FDC+G       
Sbjct: 223 SELAERRRILASKMGVEVFDPSKHG---DNAVTELRNIPRGQHGFDYAFDCSGVKATFNT 279

Query: 286 ALEA 289
           AL+A
Sbjct: 280 ALKA 283

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 71/308 (23%), Positives = 110/308 (35%), Gaps = 60/308 (19%)

Query: 13  IAAVAYDAK------KPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSG------SD 60
           + A+AY  K      K L    IT D     E+ I I +  +C TD +  +       SD
Sbjct: 1   MRALAYFGKGDIHFTKDLEEPRITTDD----ELLIDIIFCGICGTDLHEYTDGPIFFPSD 56

Query: 61  ------PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------ 102
                      P  +GHE AGIV  VG  V   K GDHV    T  C             
Sbjct: 57  GHKHEISNNELPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVN 116

Query: 103 --KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADV 160
             KC  C  G  N+C  +    G GV   G                    F+E  V+ + 
Sbjct: 117 KEKCAACKRGMYNVCSHL-GLIGNGVQSGG--------------------FAERVVINES 155

Query: 161 SVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRG 220
               +    P++   L+     +    A++ +  + G +V + G G +GLS I      G
Sbjct: 156 HCYKLPNHIPMEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHG 213

Query: 221 ASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNT 280
            +                + GA  + +P +   ++     + +     G D+ FDC+G  
Sbjct: 214 CTEIVVSEPAKIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTP 272

Query: 281 KIMRDALE 288
             +R ++E
Sbjct: 273 ATLRSSIE 280

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 94/369 (25%), Positives = 140/369 (37%), Gaps = 63/369 (17%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V+I I+ T +C +D  Y  SG   + +   P VLGHE +G V  VG  V  VK GD V
Sbjct: 31  HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGSAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                           G+ NLC  +       +  DGT   +    ED    +      E
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 154 YTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLS 211
                             + AC+  L  GV +      K A V+ G  V VFG G VGL 
Sbjct: 149 ------------------EGACVEPLSVGVHSN-----KLAGVRFGSRVVVFGAGPVGLL 185

Query: 212 VIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLA-KDQTIVEKLIEMTDG-G 269
               A+  GAS                +FGAT   N  +  A K Q + +++ ++  G  
Sbjct: 186 TGAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEVEKLLSGHH 245

Query: 270 LDFTFDCTG-------NTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
            D  F+C+G         KI +        G G++            +  P   V+G+  
Sbjct: 246 ADIVFECSGADACIDAGVKITKVGGTMVQIGMGKN-----------YTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA--FEDLHNGDC 375
           K       +FG  +        +K    G + V+  ITHR  F++  +A  F   H G+ 
Sbjct: 295 KLIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKFEDAAKAYDFNIAHGGEV 348

Query: 376 LRTVLKSDE 384
           ++T++   E
Sbjct: 349 VKTIIAGPE 357

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 96/380 (25%), Positives = 145/380 (38%), Gaps = 73/380 (19%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVIT 86
           T++ P  H V++ I+ T +C +D  Y  SG   + +   P VLGHE +G V  VG+ V  
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFM 146
           VK GD V                G+ NLC  +       +  DGT   +    ED    +
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKL 141

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFG 204
                 E                  + AC+  L  GV +      K A V+    V VFG
Sbjct: 142 PEGVSYE------------------EGACVEPLSVGVHSN-----KLAGVRFSTRVVVFG 178

Query: 205 CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN----PKEDLAKDQTIVE 260
            G VGL     A+  GAS            Q    FGAT+  N    P +   +  + VE
Sbjct: 179 AGPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVE 238

Query: 261 KLIEMTDGG--LDFTFDCTG-------NTKIMRDALEACHKGWGQSXXXXXXXXXXXXST 311
           KL+    GG   D  F+C+G         K+ +        G G++            + 
Sbjct: 239 KLL----GGNHADVVFECSGADVCIDAGVKVTKVGGTMVQVGMGKN-----------YTN 283

Query: 312 RPFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQA 366
            P   V+G+  K       +FG  +    +         G + V+  ITHR  F++  +A
Sbjct: 284 FPIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKA 337

Query: 367 FED--LHNGDCLRTVLKSDE 384
           ++    H GD ++T++   E
Sbjct: 338 YDYNISHGGDVVKTIIAGPE 357

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 150/369 (40%), Gaps = 51/369 (13%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVIT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P VLGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCGAVRATQGKGVMPDGT-TRFHNAKGEDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +  + +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGAT-DFVNPKEDLAKDQTIVEKLI 263
            G VGL     A   GAS            Q    FGA+  F + K  + + Q + +++ 
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 264 EMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
           ++  G   D  F+C+G    +   ++    G                +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSGADVCIDAGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFED--LHNGDC 375
           +       +FG  +    +         G + V+  ITHR  F++  +A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVLKSDE 384
           ++T++   E
Sbjct: 349 VKTIIAGPE 357

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 150/369 (40%), Gaps = 51/369 (13%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVIT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P VLGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCGAVRATQGKGVMPDGT-TRFHNAKGEDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +  + +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGAT-DFVNPKEDLAKDQTIVEKLI 263
            G VGL     A   GAS            Q    FGA+  F + K  + + Q + +++ 
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 264 EMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
           ++  G   D  F+C+G    +   ++    G                +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSGADVCIDAGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFED--LHNGDC 375
           +       +FG  +    +         G + V+  ITHR  F++  +A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVLKSDE 384
           ++T++   E
Sbjct: 349 VKTIIAGPE 357

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 107/262 (40%), Gaps = 32/262 (12%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V++ I+ T +C +D  Y   G+  + +   P VLGHE +GIV  VG  V  VK GD V
Sbjct: 29  HYVKLHIKATGICGSDVHYYTQGAIGQFVVKSPMVLGHESSGIVAEVGSAVTNVKVGDRV 88

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGT-TRFHNAKGEDIYHFMGCSTFS 152
                          SG  NLC  +          DGT T+++ A  + +Y      +F 
Sbjct: 89  AIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTKYYLAPEDFVYKMPDHLSFE 146

Query: 153 EYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSV 212
           E  +   +SV                 GV      A K A  + G  V V G G VGL  
Sbjct: 147 EGALAEPMSV-----------------GVH-----ANKLAGTRFGSKVLVSGAGPVGLLA 184

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGL-D 271
              A+  GA+            +   QFGAT  V+   D   ++  V ++ ++  G L +
Sbjct: 185 GAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD---EERFVSEVSKVLGGDLPN 241

Query: 272 FTFDCTGNTKIMRDALEACHKG 293
              +C+G    +R  ++AC  G
Sbjct: 242 IVLECSGAQPAIRCGVKACKAG 263

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 72/296 (24%), Positives = 104/296 (35%), Gaps = 56/296 (18%)

Query: 13  IAAVAY----DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +    +EE  + AP   E+ + I +  +C TD +  +      PE   
Sbjct: 1   MRALAYFGKGDIRFTNHLEEPRIVAPD--ELVLDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG  V   K GD V+   T  C               
Sbjct: 59  TNEISHNPLPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKE 118

Query: 104 -CKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+C  +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKRGLYNICSYL-GLCGAGVQSGG--------------------FAERVVINESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD A L+          A+   + + G T  + G G +GL  I      G S
Sbjct: 158 YKVPEFVPLDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCS 215

Query: 223 XXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTG 278
                       +   + GA  F +P    AKD     + +     G D+TFDC+G
Sbjct: 216 DIAVSEPAKVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 70/291 (24%), Positives = 106/291 (36%), Gaps = 56/291 (19%)

Query: 26  VEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE---------GLFPCVLGHEG 73
           ++E  + AP   E+ I IE+  +C TD +  +      PE            P  +GHE 
Sbjct: 18  LKEPHIVAPD--ELVIDIEWCGICGTDLHEYTDGPIFFPEDGHTHEISHNPLPQAMGHEM 75

Query: 74  AGIVESVGDDVITVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCGAVR 119
           AG V  VG  V  +K GD V+   T  C                C  C  G  N+C  + 
Sbjct: 76  AGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKEWCAACKKGYYNICSYL- 134

Query: 120 ATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGC 179
              G GV   G                    F+E  V+ +     +    PLD A L+  
Sbjct: 135 GLCGAGVQSGG--------------------FAERVVMNESHCYKVPDFVPLDVAALIQP 174

Query: 180 GVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQ 239
                   A++    + G T  + G G +GL  I      G              +   +
Sbjct: 175 LAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCKDIVVSEPAKVRRELAEK 232

Query: 240 FGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALE 288
            GA  + +P    AK+   ++ L  + DG  G D+TFDC+G    +  A++
Sbjct: 233 MGARVY-DPTAHAAKES--IDYLRSIADGGDGFDYTFDCSGLEVTLNAAIQ 280

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 58.5 bits (140), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 138/362 (38%), Gaps = 49/362 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P VLGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                           G+ NLC  +       +  DGT   +    ED    +      E
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 154 YTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLS 211
                             + AC+  L  GV +      K A V+ G  V VFG G VGL 
Sbjct: 149 ------------------EGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLL 185

Query: 212 VIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE-DLAKDQTIVEKLIEMTDGG- 269
               A+  GA+            Q    FGAT+  N  +    K Q + + + ++  G  
Sbjct: 186 TGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNH 245

Query: 270 LDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-----G 324
            D  F+C+G    +  A++    G                +  P   V+G+  K      
Sbjct: 246 ADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFR 301

Query: 325 SAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFED--LHNGDCLRTVLKS 382
            +FG  +    +         G + V+  ITH+  F++  +A++    H G+ ++T++  
Sbjct: 302 YSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTIIFG 355

Query: 383 DE 384
            E
Sbjct: 356 PE 357

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 58.5 bits (140), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 85/342 (24%), Positives = 130/342 (38%), Gaps = 37/342 (10%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-IA 95
           ++ +KIE   VC +D +  SG   +   P ++GHE  G V  VG +  + VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 96  LYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYT 155
                C KCK C +G  + C            P+    + +   ED Y   G   +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYC------------PNAIQTY-STPYEDGYVSKG--GYADYV 139

Query: 156 VVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQG 215
            V +   V I    P   A  L CG  T F   L+      G  VA+ G G +G   +  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 216 AKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFD 275
           AK  GA                 + GA  F+  KE+    +   ++        LD    
Sbjct: 199 AKAMGAEVYAISRTSSKKED-AMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 276 CTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRS 334
           C G+ T I  + L       G+               +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSME--- 305

Query: 335 EMGGLIKDYQKGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
           E+  L+K   +  +K+        P  E  +++ FE +  GD
Sbjct: 306 ELKQLLKLVSEKDIKI---WVETVPISEKGVHEVFERMDKGD 344

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/309 (23%), Positives = 114/309 (36%), Gaps = 62/309 (20%)

Query: 13  IAAVAY----DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS--------- 59
           + A+AY    D K    + E T+ AP   E+ I + +  +C TD +              
Sbjct: 40  MRALAYFGKNDIKFTNDLPEPTISAPD--EMIIDVSWCGICGTDLHEFQDGPIFFPHDGC 97

Query: 60  ----DPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------- 102
                 EGL P  +GHE AG +   G  V   K GD V+   T  C              
Sbjct: 98  CHEISGEGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDK 156

Query: 103 -KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVS 161
             C  C  G  N+C  +    G GV   G                    F+E  V+ +  
Sbjct: 157 EPCAACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQ 195

Query: 162 VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
              +     +D A L+     +    A++ +  +KG +V + G G +GL  I      G 
Sbjct: 196 CYKVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGV 253

Query: 222 SXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTGN 279
           S             +  + GA  +    +D   D++I + L  +  G  G D+ FDC+GN
Sbjct: 254 SEVVVSEPAKIRRDFAEKMGAIVYDPSAKD--HDESI-KYLRSIAPGGDGFDYAFDCSGN 310

Query: 280 TKIMRDALE 288
              ++ A+E
Sbjct: 311 PATLKAAIE 319

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 93/375 (24%), Positives = 142/375 (37%), Gaps = 65/375 (17%)

Query: 32  DAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVK 88
           + P  H V++ I+ T +C +D  Y  SGS  + +   P VLGHE +G V  VG  V ++K
Sbjct: 25  ELPNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIK 84

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
            GD V                G+ NLC  +       +  DGT                 
Sbjct: 85  VGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTL---------------- 126

Query: 149 STFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFGCG 206
                Y   AD  V   D  +  + AC+  L  GV      A K A V  G  V VFG G
Sbjct: 127 --VKYYVSPADFLVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVVVVFGAG 179

Query: 207 TVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMT 266
            VGL     AK  GAS            +    FGAT  +N K     +   V   +   
Sbjct: 180 PVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNY 239

Query: 267 DGG--LDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKG 324
            GG   D  F+C+G    +   + +   G                     Q+  G+ +  
Sbjct: 240 LGGALADVVFECSGAEPCINSGVLSTKNGGTM-----------------VQIGMGKNYIN 282

Query: 325 SAFGGIKGRSEMGGL------IKDYQK-------GALKVEEFITHRRPFKEINQAFE-DL 370
                + G+ EM  +        DY+        G ++V++ IT+R  F++   A++ ++
Sbjct: 283 FPLAEVSGK-EMSVIGCFRYSFGDYRDAVRLVATGQVEVKKMITNRFKFEDAAAAYDYNI 341

Query: 371 HN-GDCLRTVLKSDE 384
            N G+ ++T++   E
Sbjct: 342 ANGGEVVKTIIAGPE 356

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 109/306 (35%), Gaps = 56/306 (18%)

Query: 13  IAAVAY----DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +   S++E  + AP   E+ I I +  +C TD +  +      PE   
Sbjct: 1   MKALAYFGKGDIRFTNSLKEPRIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG  V  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKE 118

Query: 104 -CKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+C  +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD A L+          A+     + G T  + G G +GL  I      G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCR 215

Query: 223 XXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKI 282
                       +   + GA  + +P E  A++     + +     G D+TFDC+G    
Sbjct: 216 DIVVSEPAKLRRELAEKMGARVY-DPTEHAARESIDYLRSVAEGGDGFDYTFDCSGLEVT 274

Query: 283 MRDALE 288
           +  A++
Sbjct: 275 LNAAIQ 280

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 137/362 (37%), Gaps = 49/362 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCVLGHEGAGIVESVGDDVITVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P VLGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                           G  NLC  +       +  DGT   +    ED    +      E
Sbjct: 91  AIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 154 YTVVADVSVVAIDPKAPLDAACL--LGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLS 211
                             + AC+  L  GV +      K A V+ G  V VFG G VGL 
Sbjct: 149 ------------------EGACVEPLSVGVHSN-----KLAGVRFGTKVVVFGAGPVGLL 185

Query: 212 VIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE-DLAKDQTIVEKLIEMTDGG- 269
               A+  GA+            Q    FGAT+  N  +    K Q + + + ++  G  
Sbjct: 186 TGAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNH 245

Query: 270 LDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-----G 324
            D  F+C+G    +  A++    G                +  P   V+G+  K      
Sbjct: 246 ADVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFR 301

Query: 325 SAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKEINQAFED--LHNGDCLRTVLKS 382
            +FG  +    +         G + V+  ITH+  F++  +A++    H G+ ++T++  
Sbjct: 302 YSFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTIIFG 355

Query: 383 DE 384
            E
Sbjct: 356 PE 357

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 72/306 (23%), Positives = 108/306 (35%), Gaps = 56/306 (18%)

Query: 13  IAAVAY----DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +    ++E  + AP   E+ I I +  +C TD +  +      PE   
Sbjct: 1   MRALAYFGKGDVRFTGHLKEPQIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG  V  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKE 118

Query: 104 -CKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+C  +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD A L+          A+     + G T  + G G +GL  I      G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCK 215

Query: 223 XXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKI 282
                       +   + GA  + +P E  AK+     + I     G D+TFDC+G    
Sbjct: 216 DIVVSEPAKLRRELAEKMGARVY-DPTEHAAKESIDYLRSIAEGGDGFDYTFDCSGLEIT 274

Query: 283 MRDALE 288
           +  A++
Sbjct: 275 LNAAIQ 280

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 111/294 (37%), Gaps = 55/294 (18%)

Query: 22  KPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSG-----SDPEG------LFPCVL 69
           K L   +I VD     E+ I + Y  +C +D +  L G      D E         P  +
Sbjct: 16  KDLPEPKINVD----DEIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAM 71

Query: 70  GHEGAGIVESVGDDVITVKPGDHVIALYTAECG--------------KCKFCTSGKTNLC 115
           GHE +GIV  VG +V  VK GD V+   ++ C               KC  C  G  N C
Sbjct: 72  GHEMSGIVREVGKNVTKVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARGYDNCC 131

Query: 116 GAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAAC 175
            A     G G +  G                    F+E  +V +  +V I  + PLD A 
Sbjct: 132 -AYAGFTGLGFIGGG--------------------FAEQILVGEQHIVRIPDEIPLDVAA 170

Query: 176 LLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQ 235
           L+     T   A  K     KG T  + G G +GL++I   K  GAS            +
Sbjct: 171 LVEPLSVTWHAA--KVGKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRK 228

Query: 236 YCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEA 289
              +     F +P     K+ +   +L+     G DF FDC+G    M  A+ A
Sbjct: 229 LAEKMKVEVF-DPSVH-GKNTSNELRLLTENKDGFDFAFDCSGLEVTMNTAIHA 280

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 90/231 (38%), Gaps = 21/231 (9%)

Query: 66  PCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKG 125
           P  +GHE +G V  VG  V  VK GD V+   T  C         K     A  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 126 VMPDGTTRFHNAKGEDIYHFMGCST----FSEYTVVADVSVVAIDPKAPLDAACLLGCGV 181
              D    +          FMG       F+E  V  +  VV +    P+D A L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 182 TTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFG 241
           +  + AA + +    G +  V G G +GL++I   K +GAS            +   +  
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 242 ATDFVNPKEDLAKDQTIVEKLIEMTDG-GLDFTFDCTGNTKIMRDALEACH 291
              F +P      D+++     +  DG G DF FDC+G        L+A H
Sbjct: 235 VETF-DPSTH--GDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 147/384 (38%), Gaps = 50/384 (13%)

Query: 15  AVAYDAKKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCV 68
           AV    K  ++ E+I   AP+   +H V+I ++ T +C +D  Y   GS  E +   P V
Sbjct: 7   AVVLQKKGEITFEDIP--APEITDSHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMV 64

Query: 69  LGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCG--AVRATQGKGV 126
           LGHE +G+V  VG DV  V+ GD V               SG  NLC   A  AT     
Sbjct: 65  LGHESSGVVVEVGKDVTLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY-- 122

Query: 127 MPDGT-TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACL--LGCGVTT 183
             DGT  +++ A  + +       +F E                    AC   L  GV  
Sbjct: 123 --DGTLVKYYLAPEDFLVKLPDHVSFEE-------------------GACAEPLAVGV-- 159

Query: 184 GFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGAT 243
               A + A    G  V VFG G VGL     A   GAS            +    FGAT
Sbjct: 160 ---HANRLAETSFGKNVVVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGAT 216

Query: 244 DFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXX 303
           + +N  +  ++D+       E+     +   DC+G    +R A++    G          
Sbjct: 217 NTINSTKYKSEDELTEVIKSELKGEQPEIAIDCSGAEICIRTAIKVLKAGGSYVQVGMGK 276

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGR-SEMGGLIKDYQKGALKVEEFITHRRPFKE 362
                    P  ++  +  +    G  +   ++    +K   +G + V++ ITH   F+E
Sbjct: 277 DNI----NFPIAMIGAKELR--VLGSFRYYFNDYKIAVKLISEGKVNVKKMITHTFKFEE 330

Query: 363 INQA--FEDLHNGDCLRTVLKSDE 384
              A  F   H  + ++T++   E
Sbjct: 331 AIDAYNFNLEHGSEVVKTMIDGPE 354

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 95/245 (38%), Gaps = 47/245 (19%)

Query: 65  FPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG----------------KCKFCT 108
            P  +GHE  G V+++G+ V  V  GD V+    A CG                +C  C 
Sbjct: 67  LPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYGKEQCTACR 124

Query: 109 SGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPK 168
            G  N C     T G GV+                       F+E  VV +  VV +  +
Sbjct: 125 KGFDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGERHVVKLPEE 163

Query: 169 APLDAACLLGCGVTTGFGAALKTANVQKGD--TVAVFGCGTVGLSVIQGAKLRGASXXXX 226
            P D   L+   ++  +  A+K A  +KG      V G G +GL+ I   K  GAS    
Sbjct: 164 VPTDVGALVE-PLSVAW-HAVKVAGFEKGSGKNALVLGAGPIGLATILALKAHGASKIVV 221

Query: 227 XXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTD--GGLDFTFDCTGNTKIMR 284
                   +   + G   F +P +   + Q I +KL E+ +   G DF FDC+G      
Sbjct: 222 SELAAIRRELALKMGVEVF-DPSKHGDEKQGI-KKLREIPEDHDGFDFAFDCSGVETTFN 279

Query: 285 DALEA 289
            AL +
Sbjct: 280 TALHS 284

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 107/268 (39%), Gaps = 77/268 (28%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----VLGHEGAGIVES 79
           +  E+  V +    ++ IK +YT V + ++Y       +GL+PC    +LG E AG + +
Sbjct: 23  IKYEDYPVPSISGKDLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVA 77

Query: 80  VGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKG 139
            G DV   + GD V                                              
Sbjct: 78  KGKDVTNFEIGDKV---------------------------------------------- 91

Query: 140 EDIYHFMGCSTFSEYT------VVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
                ++  STF++YT       V  +S    D +  L AA LL     T      +  +
Sbjct: 92  ----AYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQA--LTALSFTNEAYH 145

Query: 194 VQKGDTVAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN-PKED 251
           V+KGD + +F   G VGL + Q  +++GA             +   ++GA   +N  KED
Sbjct: 146 VRKGDYILLFAAAGGVGLILNQLLRMKGAH-AIAVASTDEKLEIAKEYGAEYLINSSKED 204

Query: 252 LAKDQTIVEKLIEMTDG-GLDFTFDCTG 278
                 I++K++E+T+G G+D +FD  G
Sbjct: 205 ------ILKKVLEITNGEGVDASFDSVG 226

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 110/281 (39%), Gaps = 54/281 (19%)

Query: 38  EVRIKIEYTAVCHTD--AYTLSGS--DPEGL--------FPCVLGHEGAGIVESVGDDVI 85
           E+ I + Y  +C TD   YT       P+G          P  +GHE +G+VE VG    
Sbjct: 28  ELIIAVSYCGICGTDLKEYTEGAIFFPPDGGHNEISGNGLPQAMGHEISGVVEKVGKGCK 87

Query: 86  TVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCGAVRATQGKGVMPDGT 131
           T K GDHV+   T  C                C  C+ G TN+C  + A  G G+   G 
Sbjct: 88  TFKVGDHVVVEPTGTCKDRYRWPESQNANKPMCSACSIGMTNICAHL-ALCGAGLESGG- 145

Query: 132 TRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                              F+E  V+ +  V  I    PLD   L+     +    A+K 
Sbjct: 146 -------------------FAERLVINEAHVHKIPDHMPLDIGALI--QPISVCWHAVKV 184

Query: 192 ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKED 251
           A+ +KG +  + G G +GL  I   K  G              +Y  + GA   V     
Sbjct: 185 AHYKKGGSALIIGGGPIGLGTILALKGFGCEYIVLSEPATIRREYAGKMGAK--VYDPTG 242

Query: 252 LAKDQTIVEKLIEM--TDGGLDFTFDCTGNTKIMRDALEAC 290
           +  D++ V+ L EM     G D+TFDC+G    +  A+E C
Sbjct: 243 VPFDES-VKTLREMGPNGDGFDYTFDCSGLPITLNAAIECC 282

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/174 (29%), Positives = 71/174 (40%), Gaps = 17/174 (9%)

Query: 19  DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVE 78
           D K P  VE  + +    ++V +KIE   VC +D +T SG   E   P V+GHE  G V 
Sbjct: 21  DWKNPKKVEFESKNL-YDYDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVT 79

Query: 79  SVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNA 137
            +G     +K GD V I      C +C  C S     C     T  K    DG    +N+
Sbjct: 80  QIGSQCNELKVGDRVGIGAQVFSCLECDRCKSDNEPYCPKTVNTYRKDYT-DG----YNS 134

Query: 138 KGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
           KG           +++Y  + +   V I    P   A  L CG  T F   L+ 
Sbjct: 135 KG----------GYADYIRLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRN 178

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 67/157 (42%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H+++IK+E   VC +D +  SG       P V+GHE  G V  VGD     +K GD V +
Sbjct: 34  HDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVVKVGDRCDNGLKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C +   + C    AT G G  PDG              ++    ++++
Sbjct: 94  GAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG--------------YISKGGYADF 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +  VV I    P + A  L CG  T F   L+ 
Sbjct: 139 VRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRN 175

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/261 (24%), Positives = 103/261 (39%), Gaps = 63/261 (24%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----VLGHEGAGIVES 79
           +  E+  V +    E+ IK +YT V + ++Y       +G++PC    VLG E +G V +
Sbjct: 23  IKYEDYPVPSISEEELLIKNKYTGVNYIESYFR-----KGIYPCEKPYVLGREASGTVVA 77

Query: 80  VGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKG 139
            G  V   + GD V     A      F    K +  G V        +P GT+       
Sbjct: 78  KGKGVTNFEVGDQV-----AYISNSTFAQYSKISSQGPVMK------LPKGTS------- 119

Query: 140 EDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDT 199
                                     D +  L AA LL   V T      +  +V+KGD 
Sbjct: 120 --------------------------DEELKLYAAGLL--QVLTALSFTNEAYHVKKGDY 151

Query: 200 VAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTI 258
           V +F   G VGL + Q  K++GA             +   ++GA   +N     A  + I
Sbjct: 152 VLLFAAAGGVGLILNQLLKMKGAH-TIAVASTDEKLKIAKEYGAEYLIN-----ASKEDI 205

Query: 259 VEKLIEMTDG-GLDFTFDCTG 278
           + ++++ T+G G+D +FD  G
Sbjct: 206 LRQVLKFTNGKGVDASFDSVG 226

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/219 (24%), Positives = 83/219 (37%), Gaps = 29/219 (13%)

Query: 17  AYDAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC------ 67
           A +  K  +  ++T   PKA   H+V I++E   +C ++ + L          C      
Sbjct: 11  AINDPKDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYG 70

Query: 68  ----VLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQ 122
               V+GHE  G V +VG  V     GD V +    + C +C  C SG    C    +T 
Sbjct: 71  PKTQVVGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTY 130

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
            K   PDG              ++    ++ +    +     I P+ P +    L CG  
Sbjct: 131 CK-PYPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGL 175

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
           T F    +    +    VAV G G +G   I  A+  GA
Sbjct: 176 TVFSPIKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA 214

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 74/297 (24%), Positives = 111/297 (37%), Gaps = 61/297 (20%)

Query: 13  IAAVAYDAKKPLSVEEITVDAP-----KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP- 66
           + A+AY   + +     T D P     K  +V I I +  +C TD + L   D    FP 
Sbjct: 1   MRALAYFGTRDI---RFTTDLPEPVIEKPDDVLIDIVWCGICGTDLHELL--DGPNFFPK 55

Query: 67  -------------CVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGK---------- 103
                          +GHE AG+V  VG  V   +PGDHV+   T  C            
Sbjct: 56  DGETHEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGET 115

Query: 104 CKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVV 163
           CK C  G  N+C  +    G GV   G                    F+E  V+ +    
Sbjct: 116 CKACKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCF 154

Query: 164 AIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASX 223
            +    PLD A L+          A+K   V++G +  + G G +GL +I   +  G + 
Sbjct: 155 KVPSWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTD 212

Query: 224 XXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG--GLDFTFDCTG 278
                          + GA   V+   D   ++  ++ L  ++    G DFTFDC+G
Sbjct: 213 IVVSEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 62/247 (25%), Positives = 93/247 (37%), Gaps = 63/247 (25%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALY 97
           EV IK  YT V + ++Y   G  P  L P VLG E  G V ++G  V  +K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 98  TAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVV 157
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 158 ADVS-VVAIDPKAPLDAACLLGCGVTTGFGAAL---KTANVQKGDTVAVF-GCGTVGLSV 212
            + + V  +      +   L   G+  G  A     +  +V+KGD V ++   G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG-GLD 271
            Q  ++RGA                 + GA   +N KED      I+EK+ ++T G G+D
Sbjct: 166 NQLLRMRGAH-TIAVASTNEKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 272 FTFDCTG 278
             FD  G
Sbjct: 220 VAFDSVG 226

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 136/369 (36%), Gaps = 54/369 (14%)

Query: 19  DAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAG 75
           D K P  VE      PK    H++ IKIE   VC +D +T SG   +   P V+GHE  G
Sbjct: 18  DWKNPKKVEY----EPKKFLDHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIG 73

Query: 76  IVESVGDDVIT-VKPGDHV----IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDG 130
            V  +GD   + +K GD V     A    ECG+CK   S     C     T         
Sbjct: 74  TVVRLGDKCTSGLKLGDRVGVGAQAFSCLECGRCK---SDNEPYCTKSVWT--------- 121

Query: 131 TTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALK 190
               ++   ED Y+  G   +++Y  + +   + I    P   A  L CG  T F   L+
Sbjct: 122 ----YSTNYEDGYNSKG--GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLR 175

Query: 191 TANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKE 250
                +G  V + G G +G   +  AK  GA                 + GA  F+  KE
Sbjct: 176 NG-CGRGKKVGIMGIGGIGHMALIFAKAMGAEVYAISRTSAKKDDSI-KMGADHFIATKE 233

Query: 251 --DLAKDQTIVEKLIEMTDGGL-DFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXX 307
             D A        LI +    L D  FD    T           K  G+           
Sbjct: 234 EPDWATKYFDTFDLIVVCSNSLTDINFDVVPRTM----------KVGGKIVSICAPEQNE 283

Query: 308 XXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE--INQ 365
             + +PF L+ G     SA GGI    +M  L+    K  LK+        P  E  + +
Sbjct: 284 VINLKPFGLL-GVSISNSALGGINEIKQMLDLV---SKKDLKI---WVETVPISEKGVKE 336

Query: 366 AFEDLHNGD 374
            FE +  GD
Sbjct: 337 VFERMDMGD 345

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 90/373 (24%), Positives = 137/373 (36%), Gaps = 38/373 (10%)

Query: 9   PIKCIAAVAYDAKKPLSVEEITVDAPKA--HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           P K       D K  L  ++ + D   A   +V IK+    VC +D +  +G        
Sbjct: 4   PAKVEGIAITDKKDWLHPKKASYDLKTAGDRDVDIKVIACGVCGSDVHCAAGRHLPLFED 63

Query: 67  CVLGHEGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
           CV+GHE  G V  VG      VK GD V +   +  C +C+ C +G    C         
Sbjct: 64  CVVGHEIIGEVVKVGPKCTAGVKVGDRVGVGAQSLSCLECESCIAGNEQYCKKNTVYTIA 123

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
            + PDG+     A+G           F  +    +  V  I  +     A  L CG  T 
Sbjct: 124 SIYPDGS----KAQG----------GFGSHVRTHEYFVHPIPKELDTVNAAPLLCGGITA 169

Query: 185 FGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATD 244
           F   L+   V  G TV + G G +G   I  AK  GA             + C + GA +
Sbjct: 170 FSPLLR-GQVGPGKTVGIVGIGGIGHIAILFAKAMGAK-VIAISRSASKKEDCLKLGADE 227

Query: 245 FVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGN-TKIMRDALEACHKGWGQSXXXXXX 303
           ++   E     Q           G +DF   C  + +K   D+L +  K  G+       
Sbjct: 228 YIASAEGDDWKQKFA--------GSIDFMLLCNSSFSKSNFDSLFSLIKLGGEVCSIGIP 279

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPFKE- 362
                 S  P  L+  +      F  +  R+E   + +  +K  +K+        P  E 
Sbjct: 280 DMSYRLSISPLSLLGIKF----GFSALGSRNEFQKMFELVKKNNIKL---WVETLPIGEK 332

Query: 363 -INQAFEDLHNGD 374
            +++AFE + NGD
Sbjct: 333 GLHEAFERVENGD 345

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 97/248 (39%), Gaps = 65/248 (26%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----VLGHEGAGIVESVGDDVITVKPGDHV 93
           ++ IK +YT V + ++Y       +GL+PC    VLG E  G++ + G DV   + GD V
Sbjct: 37  DILIKNKYTGVNYIESYFR-----KGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 94  IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
                A      F    K    G +        +P GT+                     
Sbjct: 92  -----AYISNSTFAQYTKFPSEGTIMK------LPSGTS--------------------- 119

Query: 154 YTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVF-GCGTVGLSV 212
                       D K  L AA LL       F    +  +V+KGD + V+   G VGL +
Sbjct: 120 ------------DEKMKLYAAGLLQALTALSFTN--EAYHVKKGDYILVYAAAGGVGLIL 165

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN-PKEDLAKDQTIVEKLIEMTDG-GL 270
            Q  +++ A             +    +GA   ++  KED      I+ +++E+TDG G+
Sbjct: 166 NQLLRMKDAH-AIAVASTYEKLETAKDYGAEFLIDSSKED------ILTRVLEITDGKGV 218

Query: 271 DFTFDCTG 278
           D +FD  G
Sbjct: 219 DASFDSVG 226

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 126/350 (36%), Gaps = 80/350 (22%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIAL 96
           +E+ IK +YT +   ++Y   G  P    P VLG E +G V + G  V            
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAV------------ 93

Query: 97  YTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                         K NL   V                          ++   TF++YT 
Sbjct: 94  -------------SKFNLADKV-------------------------AYLSAGTFAQYTK 115

Query: 157 VADVSVVAIDPKAPLDAACLLGCG----VTTGFGAALKTANVQKGDTVAVF-GCGTVGLS 211
           +A+   ++  P+   D    L       V T    A +   V+KGD V ++   G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 212 VIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN-PKEDLAKDQTIVEKLIEMTDG-G 269
             Q  K  GA             Q   +FGA   VN  KED      ++ +++E+T G G
Sbjct: 176 FNQILKRLGAH-TIAVASTDEKLQLAKEFGAEYLVNSSKED------VLARVLEITQGQG 228

Query: 270 LDFTFDCTGNTKIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKG 324
           +D  +D  G        L A  +      +G +            S +       ++ + 
Sbjct: 229 VDVAYDSIGK-DTFETTLSALRRKGTFVSFGNASGPVPPIAISRLSPKNI-----KILRP 282

Query: 325 SAFGGIKGRSEMGGLIKDYQKGALKVEEF---ITHRRPFKEINQAFEDLH 371
           + FG I  + E     ++  K  L  EEF   IT   P +E  +A E+L 
Sbjct: 283 TLFGYIASQEEWAYYSEELIK-LLHSEEFKVLITKIYPLEEYRKATEELE 331

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 87/369 (23%), Positives = 142/369 (38%), Gaps = 82/369 (22%)

Query: 18  YDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVL----GHEG 73
           YD  K  +++  TV+   ++E+ IK  Y+ +   +AY       +G++PC L    G E 
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYF-----RKGIYPCELPYLPGREA 88

Query: 74  AGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
           +GIV  VG DV   + GD V  L+                                    
Sbjct: 89  SGIVAEVGKDVKNFQIGDKVAYLH------------------------------------ 112

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN 193
                GE +  F   +   E   +  +S  A D    L AA LL     T      +   
Sbjct: 113 -----GETMAEF---TKIKETDPIIKLSKDASDENLKLYAAGLLQS--LTAITLINEAHE 162

Query: 194 VQKGDTVAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDL 252
           V+KG+ V V+   G VGL + Q  K++GA             +     GA   +N KE  
Sbjct: 163 VKKGEYVLVYAAAGGVGLLLDQLLKMKGAH-TIAVCSTKEKLELAKANGAEFSINSKE-- 219

Query: 253 AKDQTIVEKLIEMTDG-GLDFTFDCTGNTKIMRDALEACH-KG----WGQSXXXXXXXXX 306
              + +V++++E+T+  G+D  +D  G      D L A   KG    +G +         
Sbjct: 220 ---ENVVQRVMEITNNKGVDVAYDSIGKA-TFEDTLAALKLKGSLVSFGNASGPVPPLLI 275

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ----KGALKVEEFITHRRPFKE 362
              S +  +LV  +++     G I    +     K++Q     G L ++ F T+  P K+
Sbjct: 276 NRLSPKNLKLVRPQLY-----GYITNPEDWEKYSKEFQSLVDSGKLNIKIFKTY--PLKD 328

Query: 363 INQAFEDLH 371
              A ++L 
Sbjct: 329 YKIAVQELE 337

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 64/157 (40%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           +++ IKIE   VC +D +  SG+  +   P V+GHE  G V  VG    + +K GD V +
Sbjct: 34  NDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVGTVVKVGSKCTSGMKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C  C  C +     C  V  T G    PDG    +N KG           ++ Y
Sbjct: 94  GAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG----YNGKG----------GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +   V I    P   A  L CG  T +   L+ 
Sbjct: 139 IRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRN 175

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 96/378 (25%), Positives = 141/378 (37%), Gaps = 47/378 (12%)

Query: 9   PIKCIAAVAYDAKKPLSVEEITVDAPKA--HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           P K       D K   + +++  D  K   H++ IK+E   VC +D +  SG+  +   P
Sbjct: 6   PEKFQGIAVLDHKDWKNPKKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKP 65

Query: 67  CVLGHEGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
            V+GHE  G V  +G++  + +K GD V +      C  C+ C +     C     T G+
Sbjct: 66  LVVGHEIIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQ 125

Query: 125 GVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTG 184
              PDG    +++KG           +++Y  V +   V I    P   A  L CG  T 
Sbjct: 126 D-YPDG----YSSKG----------GYADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTV 170

Query: 185 FGAALKT--ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGA 242
           +   ++      +K   V + G G  GL     AK  GA                 + GA
Sbjct: 171 YSPLVRNGCGPNKKVGIVGIGGIGHQGLLF---AKAMGAEVYAISRTSAKKED-AMKLGA 226

Query: 243 TDFVNPKE--DLAKDQTIVEKLIEMTDGGL-DFTFDCTGNTKIMRDALEACHKGWGQSXX 299
             F+  KE  D          LI +    L D  F+   NT           K  G    
Sbjct: 227 DHFIATKEEPDWGTKYFDTFDLIVVCASSLTDVDFNTVPNTM----------KIGGSIVS 276

Query: 300 XXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRP 359
                     S +PF L  G     SA G I   SEM  L+K   +  +K+        P
Sbjct: 277 ISVPEQNETLSLKPFGL-KGVSISNSALGSI---SEMRDLLKLVSENNIKL---WVETIP 329

Query: 360 FKE--INQAFEDLHNGDC 375
             E  + +AFE +  GDC
Sbjct: 330 IGEKGVKEAFERMDKGDC 347

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 62/252 (24%), Positives = 93/252 (36%), Gaps = 71/252 (28%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIAL 96
           +E+ IK +Y  +   +AY   G  P  L P +LG E  G+V + G  V     GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 97  YTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                                                           +M  STF++YT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 157 VADVSVVAIDPKAPLD-------AACLLGCGVTTGFGAALKTANVQKGDTVAVF-GCGTV 208
            +   +++  P    D       AA + G    T    A K   V++GD + ++   G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 209 GLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN-PKEDLAKDQTIVEKLIEMT- 266
           GL + Q  K RGA             +   +FGA   +N  KED      I+++ +E+T 
Sbjct: 163 GLLMDQLLKERGAH-AIAVVSTEEKEELAKKFGAEYVINSSKED------ILKRALEITN 215

Query: 267 DGGLDFTFDCTG 278
           D G+D  FD  G
Sbjct: 216 DKGVDAVFDSVG 227

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 46.6 bits (109), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 80/219 (36%), Gaps = 29/219 (13%)

Query: 17  AYDAKKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC------ 67
           A    K  +  ++T   PK     +V I++E   +C ++ + L          C      
Sbjct: 11  AISDPKDWATPKLTSFQPKNFGPRDVDIEVECCGICASELFALKNDWTHEPLACLSSKYG 70

Query: 68  ----VLGHEGAGIVESVGDDVITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQ 122
               V+GHE  G V +VG +V   K GD V +    + C +C  C S     C     T 
Sbjct: 71  PKTQVVGHEVVGKVVAVGPEVSLCKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTY 130

Query: 123 GKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVT 182
                PDG              ++    ++ +    +     I P+ P +    L CG  
Sbjct: 131 CNP-YPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGL 175

Query: 183 TGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
           T F    +    +K   VA+ G G +G   I  +K  GA
Sbjct: 176 TVFSPIKRNIQGKKNPRVAIIGIGGLGHMAIMISKALGA 214

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 53/120 (44%), Gaps = 4/120 (3%)

Query: 15  AVAYDAKKPLSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHE 72
           AV    KK LS E++   A +    +V I+IE   VC +D +   G+  E   P V+GHE
Sbjct: 11  AVVDSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHE 70

Query: 73  GAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDG 130
             G V  +GD   T +K GD V +    + C  C  C +     C     T  +    DG
Sbjct: 71  IIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 97/389 (24%), Positives = 147/389 (37%), Gaps = 57/389 (14%)

Query: 1   MSAATVGKPIKCIAAVAY-DAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTL 56
           M+++T     + IA + + D K P  VE      PK    +++ IKIE   VC +D +  
Sbjct: 1   MTSSTSPAKFQGIAVLDHKDWKNPKKVEF----EPKPFYPNDIDIKIECCGVCGSDIHAA 56

Query: 57  SGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNL 114
           +G   +   P V+GHE  G V  +G++  + +K GD V +      C  C+ C S     
Sbjct: 57  AGHWGDLEKPLVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPY 116

Query: 115 CGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAA 174
           C +   T G+    DG    +++KG           +++Y  V +   V I    P   A
Sbjct: 117 CPSFVTTYGQSYK-DG----YSSKG----------GYADYIRVHEHFAVPIPENIPSHLA 161

Query: 175 CLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXX 234
             L CG  T F   L+           V   G   + +I  AK  GA             
Sbjct: 162 APLMCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMGLIF-AKAMGAEVYAISRTSAKKE 220

Query: 235 QYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDF--TFD----CTGN-TKIMRDAL 287
               + GA  F+  KE+               D G  +  TFD    C  + T +  + +
Sbjct: 221 D-AMKLGADHFIATKEE--------------PDWGTKYFDTFDLIVVCANSLTDVDFNVV 265

Query: 288 EACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGA 347
               K  G              + +PF L+ G     SA GG+K   E+  L+    K  
Sbjct: 266 PKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISNSALGGVKEIKELLDLV---SKNN 321

Query: 348 LKVEEFITHRRPFKE--INQAFEDLHNGD 374
           LK+        P  E  + QAFE +  GD
Sbjct: 322 LKI---WVETLPIGEEGVKQAFERMDKGD 347

>Suva_4.279 Chr4 complement(495380..496384) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 63/263 (23%), Positives = 102/263 (38%), Gaps = 67/263 (25%)

Query: 24  LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----VLGHEGAGIVES 79
           +  E+  V      ++ IK +Y  V + ++Y       +GL+PC    VLG E  G V +
Sbjct: 23  IKYEDYPVPLISDEDLLIKNKYAGVNYIESYF-----RKGLYPCEKPYVLGREATGTVVA 77

Query: 80  VGDDVITVKPGDHVIAL-YTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAK 138
            G DV   + GD V  + ++      KF + G                            
Sbjct: 78  KGKDVNNFQIGDQVAYISHSTFAQYTKFSSKG---------------------------- 109

Query: 139 GEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGD 198
             ++     C++               D K  L AA LL       F    +  +V+KGD
Sbjct: 110 --NVMRLPKCTS---------------DEKMKLYAAGLLQALTALSFTN--EAYHVKKGD 150

Query: 199 TVAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVN-PKEDLAKDQ 256
            + V+   G VGL + Q  K++GA                 + GA   +N  KED     
Sbjct: 151 YILVYAAAGGVGLILNQLLKMKGAH-AIAVASTDEKLDIAKKNGAEYLINSSKED----- 204

Query: 257 TIVEKLIEMTDG-GLDFTFDCTG 278
            ++E+++E+T+G G+D +FD  G
Sbjct: 205 -VLERVLEITNGEGVDSSFDSIG 226

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 73/198 (36%), Gaps = 26/198 (13%)

Query: 35  KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------VLGHEGAGIVESVGDDV 84
           +AH+V I++E   +C ++ ++L          C          V+GHE  G V +VG +V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 85  ITVKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIY 143
                GD V +      C KC  C SG    C     T          +R+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 144 HFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVF 203
            ++    ++ +    +     I    P +    L CG  T +    +     K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 204 GCGTVGLSVIQGAKLRGA 221
           G G +G   I  +K  GA
Sbjct: 199 GIGGLGHMAIMISKALGA 216

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 70/178 (39%), Gaps = 24/178 (13%)

Query: 19  DAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAG 75
           D K P  VE      PK     +V IKIE   VC +D +  SG   +   P ++GHE  G
Sbjct: 18  DWKNPQRVEF----PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIG 73

Query: 76  IVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
            V  +G      +K GD V +      C KC  C +   + C     T G    PDG   
Sbjct: 74  TVVKLGSKCENGLKLGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG--- 129

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
            + +KG           ++E+  V +  V+ I    P   A  L CG  T F    + 
Sbjct: 130 -YASKG----------GYAEFVRVHEHFVIPIPENIPSHLAAPLMCGGNTIFSPLTRN 176

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 68/354 (19%), Positives = 120/354 (33%), Gaps = 86/354 (24%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIAL 96
           +E+ IK +Y  + + ++Y   G  P    P VLG E +G+V + GD V      D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKV--- 114

Query: 97  YTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTV 156
                                                           ++  +TF++YT 
Sbjct: 115 -----------------------------------------------AYLSSNTFAQYTK 127

Query: 157 VADVSVVAIDPKAPLDAACLLGCG----VTTGFGAALKTANVQKGDTVAVFGCGTVGLSV 212
           +++   V+  P+   D    L  G      T      +   V+KGD + ++         
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG-GLD 271
                 +  +            Q   ++GA   +N  +D      ++ +++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 272 FTFDCTGNTKIMRDALEACHKG---------WGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
             FD  G     +D  E   K          +G +            + +  +L+     
Sbjct: 243 AAFDSVG-----KDTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLL----- 292

Query: 323 KGSAFGGIKGRSEM----GGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHN 372
           + S FG I    E       L      GALK+   I+   P +E NQA E L +
Sbjct: 293 RPSLFGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 90/247 (36%), Gaps = 50/247 (20%)

Query: 35  KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVI 94
           K +E+ IK +Y  + H D  +         FP V G E +GIV   G+ V          
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIVVRRGEKV---------- 121

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                   + KF   G+  +                            Y  +  STF EY
Sbjct: 122 -------DEEKFPLGGEVFIASTT------------------------YRDLRTSTFQEY 150

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANV----QKGDTVAVFGCGT-VG 209
           TV     V  +  +  LD A  +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 210 LSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGG 269
           + V+Q AK  G +            QY    GAT  ++ +E   K + IV ++ ++   G
Sbjct: 211 IFVVQLAKSLGFT-KIITITSKKHEQYLLSLGATHIIHREE---KTEDIVNEIKKICPNG 266

Query: 270 LDFTFDC 276
           +    D 
Sbjct: 267 VSHGVDL 273

>KLLA0A10549g Chr1 (921022..922083) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 353

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 84/349 (24%), Positives = 122/349 (34%), Gaps = 74/349 (21%)

Query: 36  AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIA 95
           A ++ IK +Y  +   + Y   G  P    P VLG E  G V + GD V     GD V  
Sbjct: 54  ATDLLIKNKYAGINFIEVYFRKGIYPSEK-PYVLGREAVGEVVAKGDQVDKYNVGDKVAY 112

Query: 96  LYTAECGK-CKFCTSGK-TNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSE 153
           L  +   +  K+  +G    L   + A + K                             
Sbjct: 113 LSASTFAQFTKYPQNGHLIKLPKDISAEKEK----------------------------- 143

Query: 154 YTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVF-GCGTVGLSV 212
             ++A   V  + P   +D A                  NVQKGD + V+   G VGL  
Sbjct: 144 --IIAGSLVQGLTPLTFIDEAY-----------------NVQKGDFILVYAAAGGVGLIF 184

Query: 213 IQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG-GLD 271
            Q  K RGA             Q   ++GA   +N  +D      IVEK+ E T+G G+ 
Sbjct: 185 DQLLKARGAR-TIAVASTDEKLQLAKEYGAEFLINSTKD-----DIVEKVKEFTNGEGVA 238

Query: 272 FTFDCTGNTKIMRDALEACHKG----WGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAF 327
             FD  G             KG    +G +            S +  +LV  ++     F
Sbjct: 239 AAFDSIGKDTFETTLQVVKRKGTIVSFGNASGAVPPFSINRLSPKNLKLVRPQL-----F 293

Query: 328 GGIKGRSEM----GGLIKDYQKGALKVEEFITHRRPFKEINQAFEDLHN 372
             +   SE       LI+    G LK+   I+   P K+  +A EDL +
Sbjct: 294 AYVADPSEWEHYSSELIRLIDSGELKIT--ISKVYPLKDYKEATEDLES 340

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 116/323 (35%), Gaps = 90/323 (27%)

Query: 13  IAAVAY----DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS--------- 59
           + A+AY    D K    + E  + AP   E+ I I +  +C TD +              
Sbjct: 1   MRALAYFGKNDIKFTNDLPEPKITAPD--ELIIDISWCGICGTDLHEFQDGPIFFPENGC 58

Query: 60  ----DPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECG------------- 102
                 EGL P  +GHE AGIV  +G  V   + GD V+   T  C              
Sbjct: 59  CHEISGEGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQ 117

Query: 103 -KCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVS 161
            +C  C  G  N+C  +    G GV   G                    F+E  V+ +  
Sbjct: 118 EECAACKKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAK 156

Query: 162 VVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTV--------------AVFGCGT 207
              I     +D A L+     +    A++ +  + G +V              A+ G G 
Sbjct: 157 CYKIPEHLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGV 214

Query: 208 VGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTD 267
             + V + AK+R                   + GA  +     D   D++I + L  +  
Sbjct: 215 TEVVVSEPAKIR--------------RDLAEKMGAVVYDPMTRD--HDESI-KYLRSIAP 257

Query: 268 G--GLDFTFDCTGNTKIMRDALE 288
           G  G D+TFDC+GN   ++ A+E
Sbjct: 258 GGDGFDYTFDCSGNPATLKAAIE 280

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 95/263 (36%), Gaps = 58/263 (22%)

Query: 18  YDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIV 77
           YD  K   +   T+  P  +++ IK +Y  V + ++Y   G  P  L P +LG E +G+V
Sbjct: 35  YDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYPCAL-PAILGREASGVV 91

Query: 78  ESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNA 137
              G ++   + GD V   Y   C   +F                         T+  N+
Sbjct: 92  VDKGTNIKNFEIGDKV--AYIGNCSMAQF-------------------------TKIDNS 124

Query: 138 KGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKG 197
               I      ST  +  + A              A  L G    T      +   V+KG
Sbjct: 125 M---IMKLSSDSTNEDLKLYA--------------AGILQGL---TALSFVTEAYEVKKG 164

Query: 198 DTVAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQ 256
           D + V+   G  GL   Q  K RGA             Q   + GA   +N K D     
Sbjct: 165 DYILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD----- 218

Query: 257 TIVEKLIEMTDG-GLDFTFDCTG 278
            I+ K++E+TD  G+   FD  G
Sbjct: 219 DILTKVMEITDNKGVQAAFDSVG 241

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 83/360 (23%), Positives = 124/360 (34%), Gaps = 80/360 (22%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT 86
           E+  V    A EV IK +++ +   ++Y   G  P    P VLG E AG V + GD V  
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFM 146
              GD V                                                   ++
Sbjct: 99  FNIGDKV--------------------------------------------------AYL 108

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTAN----VQKGDTVAV 202
              TF++YT   +   +   PK   D       G       AL   N    V+KGD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 203 F-GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEK 261
           +   G  GL   Q  KL+GA             +   ++GA   +N     +KD T+  K
Sbjct: 169 YAAAGGAGLIFNQLLKLKGAH-TIAVASTDEKLKLAREYGAEYVINS----SKDDTL-SK 222

Query: 262 LIEMTDG-GLDFTFDCTGNTKIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQ 315
           ++E+T+G G+   FD  G       +L+A  +      +G +            S++   
Sbjct: 223 VLEITNGEGVAAAFDSIGK-DTFEISLQAIKRKGTLVSFGNASGPVPPFSINRLSSKNL- 280

Query: 316 LVTGRVWKGSAFGGIKGRSEMG----GLIKDYQKGALKVEEFITHRRPFKEINQAFEDLH 371
               +V +   FG I    E       LI+    G LKV  FI+   P  E   A E L 
Sbjct: 281 ----KVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           ++V ++IE   +C +D +  SG+      P V+GHE  G V  VG    T VK GD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
               + C  C  C S     C     T  +   PDG    + ++G    H      F   
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG----YVSQGGYASHIRAHEHF--- 145

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                  V+ I  K P   A  L CG  T F   +  
Sbjct: 146 -------VIPIPEKIPTHLAAPLLCGGITVFSPLINN 175

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/185 (28%), Positives = 74/185 (40%), Gaps = 19/185 (10%)

Query: 10  IKCIAAVAY-DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCV 68
            K IA V + D K P  VE         ++V IKIE   VC +D +  +G+  +   P V
Sbjct: 6   FKGIAVVDHKDWKNPKKVE-FPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLV 64

Query: 69  LGHEGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGV 126
           +GHE  G V  VG    T +K GD V +      C +C+ C +     C     T     
Sbjct: 65  VGHEIIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT----- 119

Query: 127 MPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFG 186
                   ++   ED Y   G   ++ Y  V +   V I    P + A  L CG  T + 
Sbjct: 120 --------YSQPYEDGYVSQG--GYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYS 169

Query: 187 AALKT 191
             L+ 
Sbjct: 170 PLLRN 174

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 63/157 (40%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G+  +   P V+GHE  G V  +G    + ++ G  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C S     C     T G+               ED Y   G   +++Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQPY-------------EDGYVSQG--GYADY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +  VV I    P   A  L CG  T +   ++ 
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRN 175

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 12  CIAAVAYDA-KKPLSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCV 68
            I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + ++G       P  
Sbjct: 9   AIGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFA 65

Query: 69  LGHEGAGIVESVGDDVITVK--PGDHV-IALYTAECGKCKFCTSGKTNLC 115
           +GHE  G + ++G+ V   K   GD V +      CGKC  C+ G+   C
Sbjct: 66  VGHEIVGKISAMGEQVNKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G       P V+GHE  G V  +GD   + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C S     C     T             ++   ED Y   G   ++ Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTT-------------YSQPYEDGYISQG--GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +  +V I    P   A  L CG  T +   ++ 
Sbjct: 139 VRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRN 175

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 58/151 (38%), Gaps = 17/151 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H++ IKIE   VC +D +  SG+  +   P V+GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C +     C  V  T                  ED Y   G   ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPY-------------EDGYSSRG--GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGF 185
             V +   V I    P   A  L CG  T F
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF 169

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 101/281 (35%), Gaps = 58/281 (20%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC--------------VLGHEGAGIVESVGDD 83
           E+ + I Y  +C TD + L+  D    FP                +GHE AGIV +VG  
Sbjct: 28  ELLVDIVYCGICGTDLHELT--DGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSG 85

Query: 84  VITVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCGAVRATQGKGVMPD 129
           V   + GDHV    T  C                C  C  G  N C  +    G GV   
Sbjct: 86  VKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSG 144

Query: 130 GTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAAL 189
           G                    F+E  VV +          P + A L+          A+
Sbjct: 145 G--------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AI 182

Query: 190 KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPK 249
             A  + G +V + G G +GL  I      G +             Y  + GA  + +P 
Sbjct: 183 NIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPL 241

Query: 250 EDLAKDQTIVEKLIEMTDG--GLDFTFDCTGNTKIMRDALE 288
           +  + +Q+I   L +M  G  G D+ FDC+G    ++ ++E
Sbjct: 242 Q-CSHEQSI-PNLRKMAPGADGFDYCFDCSGTPATLKASIE 280

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 75/192 (39%), Gaps = 21/192 (10%)

Query: 10  IKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVL 69
           I  +    + + K +S +  TV    A ++ +K+E   VC +D +  +G       P V+
Sbjct: 33  IAVVEGTEWTSPKKVSFKPKTV---YARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVV 89

Query: 70  GHEGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVM 127
           GHE  G V  VG      +K GD V +      C +C  C S     C  +  T      
Sbjct: 90  GHEIIGRVIEVGSGCKEGLKVGDRVGVGAQALSCLECSRCESENEQYCSNMTGTYNFP-Y 148

Query: 128 PDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGA 187
           PDG              ++    ++ + +V +   + I    P   A  L CG  T F  
Sbjct: 149 PDG--------------YISQGGYASHVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSP 194

Query: 188 ALKTANVQKGDT 199
            L++ NV  G +
Sbjct: 195 LLRS-NVGPGTS 205

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G       P V+GHE  G V  +G    + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C S     C     T             ++   ED Y   G   ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTT-------------YSQPYEDGYVSQG--GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +  VV +    P   A  L CG  T +   ++ 
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRN 175

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 67/175 (38%), Gaps = 18/175 (10%)

Query: 19  DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVE 78
           D K P  VE         H++ IKI+   VC +D +  +G+  +   P V+GHE  G V 
Sbjct: 17  DWKNPKKVE-FPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVV 75

Query: 79  SVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHN 136
            +G    T +K GD V +      C +C  C +     C     T             ++
Sbjct: 76  KIGPKCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTT-------------YS 122

Query: 137 AKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
              ED Y   G   ++ Y  V +   V I    P   A  L CG  T +   L+ 
Sbjct: 123 QPYEDGYVSQG--GYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRN 175

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 44/97 (45%), Gaps = 11/97 (11%)

Query: 26  VEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAG-IVESVGDDV 84
           +E   V + K H+  +KI+   +CH+D   L G  P       +GHE  G +V++  D+ 
Sbjct: 100 LENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELVQTYADE- 157

Query: 85  ITVKPGDHVIALYT----AECGKCKFCTSGKTNLCGA 117
               P   V  LYT    A CG C  C  G  + C A
Sbjct: 158 ----PKYAVGELYTVVGNAPCGGCDSCKKGWESCCTA 190

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 62/155 (40%), Gaps = 17/155 (10%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-IA 95
           +V I+IE   VC +D +  SG   E     V+GHE  G V  +G +  T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRVGVG 94

Query: 96  LYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYT 155
              A C  C+ C       C     T  +   PDG              ++    ++ + 
Sbjct: 95  AQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYASHI 139

Query: 156 VVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALK 190
            V +  V+ +  K P   A  L CG  T +   ++
Sbjct: 140 RVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVR 174

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 72/178 (40%), Gaps = 21/178 (11%)

Query: 19  DAKKPLSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAG 75
           DAK     +++T D PK   +H+V I+IE   VC +D +  +    E     V+GHE  G
Sbjct: 14  DAKDWTHPKKVTYD-PKPFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIG 72

Query: 76  IVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTR 133
            V  VG +  T +K GD V +      C +C  C       C     T  +         
Sbjct: 73  RVVKVGPECNTGLKLGDRVGVGAQVFSCLECDRCKEDNEPYCQKFVTTYNQPY------- 125

Query: 134 FHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
              A G     ++    ++ +  V +  VV I  + P + A  L CG  T F   L+ 
Sbjct: 126 ---ANG-----YISQGGYASHIRVHEHFVVPIPDEIPSELAAPLMCGGITVFSPLLRN 175

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 38.1 bits (87), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 10/93 (10%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----VLGHEGAGIVESVGD 82
           E+  V   +  ++ IK  Y  V   + Y  +G     L+PC    VLG E  G+V ++G 
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTG-----LYPCEKPYVLGREAVGVVAAIGA 80

Query: 83  DVITVKPGDHVIALYTAECGKCKFCTSGKTNLC 115
           DV   K GD V  L +    +     S K+N+ 
Sbjct: 81  DVRRFKVGDRVACLSSGTFAQYT-AVSEKSNVL 112

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 38.1 bits (87), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 38/92 (41%), Gaps = 11/92 (11%)

Query: 36  AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------VLGHEGAGIVESVGDDVI 85
           AH+V I++E   +C ++ ++L          C          V+GHE  G V +VGD V 
Sbjct: 35  AHDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQVVGHEVVGKVVAVGDKVS 94

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCG 116
             K GD + +    + C  C  C       C 
Sbjct: 95  LCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 13  IAAVAYDA-KKPLSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVL 69
           I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + +SG       P  +
Sbjct: 25  IGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAV 81

Query: 70  GHEGAGIVESVGDDVITVK--PGDHV-IALYTAECGKCKFCTSGKTNLC 115
           GHE  G + ++G  V   K   GD V +   T  CG C  C+  +   C
Sbjct: 82  GHEIIGKISAMGAQVNKEKFHLGDRVGVGAQTNSCGDCTRCSRDRQQNC 130

>TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3N
           and 2N to fix a STOP codon and a frameshift that cannot
           be fixed with the contigs.
          Length = 362

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 49/111 (44%), Gaps = 7/111 (6%)

Query: 19  DAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC---VLGHEGAG 75
           D K P  +E         ++V ++IE   VC +D +  SG D  G +PC   V+GHE  G
Sbjct: 17  DWKHPKKIEFAPKPFXXDYDVDVQIEACGVCGSDVHRASG-DWMG-YPCQXLVVGHEIIG 74

Query: 76  IVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGK 124
            +  +G    + VK GD V I      C  C+ C +G    C     T  +
Sbjct: 75  RIVKLGPKYHSGVKIGDRVGIGAQVFSCLNCRRCNNGDEPYCSKFVTTYSQ 125

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 13  IAAVAYDA-KKPLSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVL 69
           I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + +SG       P  +
Sbjct: 10  IGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAV 66

Query: 70  GHEGAGIVESVGDDVITVK--PGDHV-IALYTAECGKCKFCTSGKTNLC 115
           GHE  G + ++G  V   K   GD V +   T  CG C  C+  +   C
Sbjct: 67  GHEIIGKISAMGAQVNKEKFHLGDRVGVGAQTNSCGGCTRCSRDRQQNC 115

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 35.4 bits (80), Expect = 0.056,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIAL- 96
           +V IK+E   VC +D +  +G       P V GHE  G +  +G    +    D  + + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 97  -YTAECGKCKFCTSGKTNLC 115
             T  C KC  C  G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 108/322 (33%), Gaps = 50/322 (15%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------VLGHEGAGIVESVGDDVITV 87
           +V I+IE   +C ++ + L  +  +    C          V+GHE  G V +VG+ V   
Sbjct: 39  DVDIEIECCGICGSELHALQNNWSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGNKVTKF 98

Query: 88  KPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFM 146
             G+ V +      C KC  C +G    C     T      PDG              ++
Sbjct: 99  HKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE-YPDG--------------YV 143

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG---VTTGFGAALKTANVQKGDTVAVF 203
               ++ +    +  +V + P+        L CG   V +    ALK     K   VA+ 
Sbjct: 144 SQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVYSPIKRALKDVT-DKKPRVAII 202

Query: 204 GCGTVGLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLI 263
           G G +G   I  +K                     + GA  FVN  E   KD        
Sbjct: 203 GIGGLGHMAIMISKALDCEVWALSTSDSKKED-AKKMGADHFVNTTE---KD-------- 250

Query: 264 EMTDGGLDFTF----DCT-GNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT 318
               GGL  TF     CT   TK+  ++L       G+                P QL  
Sbjct: 251 --VWGGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFISVGLPSKDQPLEIHPMQLAA 308

Query: 319 -GRVWKGSAFGGIKGRSEMGGL 339
            G  +  S  G IK   E+  L
Sbjct: 309 HGVSFSASHLGSIKELEELLAL 330

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 36.6 bits (83), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 120/343 (34%), Gaps = 37/343 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H++ I++    VC +D +  SG   E   P V+GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C  C  CT      C    +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQ 214
             V +   V I    P   A  L CG  T F   L+      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 215 GAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTF 274
            AK  GA                 + G   F+  KE+    +   +         LD   
Sbjct: 198 LAKAMGAEVYAISRTSSKKAD-AVKLGTDHFIATKEEPDWHEKYFDT--------LDLLV 248

Query: 275 DCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGR 333
            C G+ T +  D L       G+               +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMK-- 305

Query: 334 SEMGGLIKDYQKGALKVEEFITHRRPFKE--INQAFEDLHNGD 374
            E+  L++   K  +K+        P  E  +N+AF  +  GD
Sbjct: 306 -ELKELLELVAKNNIKI---WVETIPIGEKGVNEAFTRMEKGD 344

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%), Gaps = 11/90 (12%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------VLGHEGAGIVESVGDDVIT 86
           H++ I++E   +C ++ ++L          C          V+GHE  G V  VG+ V  
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 87  VKPGDHV-IALYTAECGKCKFCTSGKTNLC 115
            K G  V +    + C +C  C+S     C
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYC 127

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 36.6 bits (83), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDHV-I 94
           H++ IKIE   VC +D +  +G       P V+GHE  G V  +G    + +K G  V +
Sbjct: 34  HDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEY 154
                 C +C  C +     C     T             ++   ED Y   G   ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCTKFVTT-------------YSQPYEDGYVSQG--GYANY 138

Query: 155 TVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             V +  VV I    P   A  L CG  T +   ++ 
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRN 175

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 67/163 (41%), Gaps = 20/163 (12%)

Query: 34  PKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVIT-VKP 89
           PKA   H+V I+IE   VC +D +T +    E     V+GHE  G +  +G +  + +K 
Sbjct: 34  PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVGRIVKLGPECDSGLKI 93

Query: 90  GDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
           GD V +   +  C +C  C       C    +T             +N   +D Y   G 
Sbjct: 94  GDRVGVGAQSFSCLECDRCKENNEPYCPKFVST-------------YNRPYDDGYISQG- 139

Query: 149 STFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
             ++ +  + +   + +  + P + A  L CG  T F   L+ 
Sbjct: 140 -GYASHVRLHEHFAIPVPDEIPSELAAPLMCGGITVFSPLLRN 181

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 45/102 (44%), Gaps = 9/102 (8%)

Query: 19  DAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAG 75
           D K P  +E      PK    ++V I+I+   VC +D +  +G   +   P V+GHE  G
Sbjct: 17  DWKDPKKIEY----DPKPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIG 72

Query: 76  IVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLC 115
            V  VG    T VK GD V +      C KC  C S     C
Sbjct: 73  RVVRVGPKCHTGVKIGDRVGVGAQVYSCLKCDRCKSDNEPYC 114

>Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W
           (REAL)
          Length = 361

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 69/182 (37%), Gaps = 27/182 (14%)

Query: 17  AYDAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP--CVLGH 71
           A D K P  V   T D PK    H+V I+IE   +C +D +  +G+   G  P   VLGH
Sbjct: 15  AEDWKHPTLV---TFD-PKPFCDHDVDIEIEACGICGSDFHIAAGN--WGPVPKNQVLGH 68

Query: 72  EGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPD 129
           E  G V  VG    T +K GD V +      C +C+ C S     C             D
Sbjct: 69  EIIGRVVKVGPKCHTGIKLGDRVGVGAQALACLECERCKSDNEQYCTIDHVLTMWTPYKD 128

Query: 130 GTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAAL 189
           G              ++    F+ +  + +   + I    P   A  L CG  T F   L
Sbjct: 129 G--------------YIAQGGFASHVRLHEHFAIPIPENIPSPLAAPLLCGGITVFSPLL 174

Query: 190 KT 191
           + 
Sbjct: 175 RN 176

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa]
          {ON} similar to uniprot|P38230 Saccharomyces cerevisiae
          YBR046c ZTA1
          Length = 333

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 24 LSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDD 83
          +  ++  V +  + +V +K +Y  V   +AY   G  P  L P VLG E +G V  VG +
Sbjct: 22 IKYQDFAVPSIGSTDVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSE 80

Query: 84 VITVKPGDHVIAL 96
          V   K GD V  L
Sbjct: 81 VKDFKIGDKVAYL 93

>Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]
           {ON} YCR105W (REAL)
          Length = 120

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 49/106 (46%), Gaps = 13/106 (12%)

Query: 17  AYDAKKPLSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP--CVLGH 71
           A D K P  V   T D PK    H++ I+IE   +C +D +  +G+   G  P   VLGH
Sbjct: 14  AEDWKHPTLV---TFD-PKPFADHDIDIEIEDCGICGSDFHIAAGN--WGPVPKNQVLGH 67

Query: 72  EGAGIVESVGDDVIT-VKPGDHV-IALYTAECGKCKFCTSGKTNLC 115
           E  G V  VG    T +K GD V +      C +C+ C S     C
Sbjct: 68  EIIGRVVKVGPKCHTGIKIGDRVGVGAQALACLECERCKSDNEQYC 113

>YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}
           ATG4Conserved cysteine protease required for autophagy;
           cleaves Atg8p to a form required for autophagosome and
           Cvt vesicle generation
          Length = 494

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 38/89 (42%), Gaps = 4/89 (4%)

Query: 61  PE-GLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVR 119
           PE G+  C++      I E+  + V    P   ++ L   + G      S + ++CG + 
Sbjct: 233 PECGIDDCIVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILS 292

Query: 120 ATQGKGV---MPDGTTRFHNAKGEDIYHF 145
           +TQ  G+    P  +  F   +G +  HF
Sbjct: 293 STQSVGIAGGRPSSSLYFFGYQGNEFLHF 321

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 63/146 (43%), Gaps = 24/146 (16%)

Query: 152 SEYTVVADVSVVAIDPKAPL--DAACLLGCGVTTGFGAALKTANVQKGDTVAVFGC-GTV 208
           +EY VV++   VA+ PK      AAC LG  +TT    AL+ A V+  D V+V G  G+V
Sbjct: 51  AEYCVVSE-DAVALKPKNVTFAQAAC-LGVPLTTA-SLALQRAAVEPSDCVSVIGASGSV 107

Query: 209 GLSVIQGAKLRGASXXXXXXXXXXXXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG 268
           G  V+Q A+  G                C    A         +A+D+     L  +T G
Sbjct: 108 GSYVVQLAQSMG----------------CRVLRAARQSPTDVCIAEDEEF-SALTSLTQG 150

Query: 269 -GLDFTFDCTGNTKIMRDALEACHKG 293
            G+D   D  G   +M+ A E    G
Sbjct: 151 RGVDVVIDTVGMPALMKAAAEKLAHG 176

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 63/287 (21%), Positives = 104/287 (36%), Gaps = 69/287 (24%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           M+  T+ K  K I      +   L  ++  V +   +E+ +K +Y+ +   ++Y   G  
Sbjct: 16  MATTTIPKTQKVILINDTGSYDVLKYQDHPVPSITDNELLVKNKYSGINFIESYFRKGIY 75

Query: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120
           P    P +LG E +G V + G+ V     GD V                           
Sbjct: 76  PSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--------------------------- 107

Query: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAAC-LLGC 179
                                   ++  S F++YT V     V   PK   D    L   
Sbjct: 108 -----------------------AYLSGSAFAQYTKVDAAGKVVKLPKDANDETLKLYAA 144

Query: 180 GVTTGFGAAL---KTANVQKGDTVAVF-GCGTVGLSVIQGAKLRGA---SXXXXXXXXXX 232
           G+     A     +  NV+KGD +  +   G VGL + Q  K RGA   +          
Sbjct: 145 GLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLILDQLLKERGAHTIAVVSTEEKLEL 204

Query: 233 XXQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDG-GLDFTFDCTG 278
             ++ +++G    ++ KED      IV ++ E+T+  G+D  FD  G
Sbjct: 205 AKKHGAEYG---IISSKED------IVTRVKEITNNQGVDAAFDSIG 242

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 57/163 (34%), Gaps = 27/163 (16%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDV-ITVKPGDHV-I 94
           ++V IKIE   VC +D +  S +        V+GHE  G V  +G    + +K GD V +
Sbjct: 34  YDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKCKLGLKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLC------GAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
                 C  CK C S     C      G    T   G +  G    H    E   HF   
Sbjct: 94  GAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDGYVSQGGYASHVRTHE---HF--- 147

Query: 149 STFSEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
                        V  I    P + A  L CG  T F   L+ 
Sbjct: 148 -------------VFKIPDNIPTELAAPLLCGGVTVFSPLLRN 177

>YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}
           ADH7NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 361

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 59/160 (36%), Gaps = 22/160 (13%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSD---PEGLFPCVLGHEGAGIVESVGDDVIT-VKPGDH 92
           H+V ++IE   +C +D +   G+    PE     +LGHE  G V  VG    T VK GD 
Sbjct: 34  HDVDVEIEACGICGSDFHIAVGNWGPVPENQ---ILGHEIIGRVVKVGSKCHTGVKIGDR 90

Query: 93  V-IALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGCSTF 151
           V +      C +C+ C S     C             DG              ++    F
Sbjct: 91  VGVGAQALACFECERCKSDNEQYCTNDHVLTMWTPYKDG--------------YISQGGF 136

Query: 152 SEYTVVADVSVVAIDPKAPLDAACLLGCGVTTGFGAALKT 191
           + +  + +   + I    P   A  L CG  T F   L+ 
Sbjct: 137 ASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRN 176

>TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {ON}
           Anc_1.400 YLR176C
          Length = 862

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/87 (24%), Positives = 37/87 (42%), Gaps = 5/87 (5%)

Query: 76  IVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFH 135
           ++++   D  +  P   + A Y + C         + +L   +RA     V PD TTR  
Sbjct: 318 LLQNCRSDSDSYVPRGRIFAQYASSCASNSLKPLSQASLGKLIRA-----VFPDLTTRRL 372

Query: 136 NAKGEDIYHFMGCSTFSEYTVVADVSV 162
             +G+  YH+ G    S+  V  + S+
Sbjct: 373 GIRGQSKYHYCGLKLLSDEPVPPEESL 399

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 48  VCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFC 107
           V  T  +TL G+     F         G+++  G  V+  K  D +++LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
           {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 75  GIVESVGDDVITVKPGDHVIALYTAECGKCKFC 107
           G+++  G  V+  K  D +I+LY A  GK ++C
Sbjct: 894 GLIDITGHRVVPAKEDDKLISLYAASTGKGRYC 926

>CAGL0G03509g Chr7 complement(340079..342835) [2757 bp, 918 aa] {ON}
           similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114c BOI2 BEM1 or uniprot|P38041 Saccharomyces
           cerevisiae YBL085w
          Length = 918

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%)

Query: 47  AVCHTDAYTLSGSDPEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKF 106
           +V  T  +TL G+     F         G+++     VI  K  D +++LY A  GK +F
Sbjct: 666 SVWKTRFFTLHGTR-LSYFANTTDTRERGLIDITAHRVIPAKEDDKLVSLYAASTGKGRF 724

Query: 107 C 107
           C
Sbjct: 725 C 725

>KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.400
           YLR176C
          Length = 806

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 5/74 (6%)

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCGAVRATQGKGVMPDGTTRFHNAKGEDIYHFMGC 148
           P   + A Y + C + +     + +L   +R      V PD TTR    +G+  YH+ G 
Sbjct: 333 PRGRIFAQYASSCSQNELKPLSQASLGKLIRT-----VFPDLTTRRLGTRGQSKYHYCGL 387

Query: 149 STFSEYTVVADVSV 162
              ++    AD SV
Sbjct: 388 KLITDEGEDADDSV 401

>SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} similar
           to gnl|GLV|KLLA0F00638g Kluyveromyces lactis
           KLLA0F00638g and weakly similar to uniprot|P53912
           Saccharomyces cerevisiae YNL134C
          Length = 409

 Score = 30.4 bits (67), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 62/162 (38%), Gaps = 34/162 (20%)

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPK------AP-----LDAACLLGCGVTTGFGAALKT 191
           Y  +  STF EYTVV D  +    P+      AP     LD A  +G G+ T  G AL  
Sbjct: 138 YRDLRTSTFQEYTVV-DSRLAWRVPRTKAGSSAPGRQFGLDFAAGIGVGLVTA-GCALSN 195

Query: 192 -----------------ANVQKGDTVAVF-GCGTVGLSVIQGAKLRGASXXXXXXXXXXX 233
                               +K  ++ ++ G  +VG+ VIQ A+  G             
Sbjct: 196 LVAFEPEDHGSGCGSSGGGAEKLGSLVIWGGSSSVGIFVIQLARASGKFDKIVAISSKKN 255

Query: 234 XQYCSQFGATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFD 275
             Y  + G T  +   + L  +  IVE++ E    G+ +  D
Sbjct: 256 ASYLKELGTTHVI---DRLQPEDRIVEQVSESCPEGVRYGID 294

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,289,428
Number of extensions: 1383260
Number of successful extensions: 3095
Number of sequences better than 10.0: 199
Number of HSP's gapped: 2935
Number of HSP's successfully gapped: 210
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)