Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL167C (NRP1)7.349ON71947823290.0
Skud_4.907.349ON70748019650.0
Smik_4.717.349ON75947819640.0
Suva_4.797.349ON70847918290.0
TDEL0C019907.349ON60639013441e-177
ZYRO0F11682g7.349ON59739113221e-174
SAKL0F11352g7.349ON58338612271e-160
Kwal_56.246387.349ON52738212211e-160
NCAS0A141507.349ON57039011871e-154
KLTH0H01276g7.349ON55742711621e-151
ACL149W7.349ON62838411351e-146
KAFR0B008707.349ON54239511171e-144
Kpol_530.327.349ON68441211271e-144
TBLA0E020607.349ON56438210821e-139
KLLA0D12364g7.349ON63140810661e-135
KNAG0C037807.349ON53839310171e-129
TPHA0F029607.349ON65440610201e-128
NDAI0A019007.349ON5653839061e-113
CAGL0I03344g7.349ON6034016734e-78
KLLA0B08976g3.379ON30591890.036
Kwal_56.234868.229ON587147790.67
TDEL0A009402.52ON68230790.73
Kpol_1039.503.379ON29636761.4
Kwal_23.45972.52ON66430761.5
KLTH0B07546g2.52ON63930761.6
TBLA0B006002.52ON73430761.7
SAKL0H17952g8.229ON58950752.0
Smik_4.162.52ON65035752.3
SAKL0G18700g4.375ON1642110752.3
Suva_4.202.52ON65235752.3
CAGL0D05236g7.188ON44335742.4
Kpol_400.12.52ON60030742.5
YDL224C (WHI4)2.52ON64935742.6
KAFR0A077002.52ON57130742.8
KNAG0A028708.349ON70487743.1
CAGL0G05511g2.52ON67435743.1
ABL158C2.52ON72930733.4
ZYRO0C10164g2.52ON74530733.5
Ecym_64412.52ON68930733.9
NDAI0H038502.52ON74230733.9
TBLA0F037808.229ON577149724.7
CAGL0J07898g1.105ON15541678.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL167C
         (719 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}  ...   901   0.0  
Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}...   761   0.0  
Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}...   761   0.0  
Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}...   709   0.0  
TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {O...   522   e-177
ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some s...   513   e-174
SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some s...   477   e-160
Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL1...   474   e-160
NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON} Anc_7...   461   e-154
KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {...   452   e-151
ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homo...   441   e-146
KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.3...   434   e-144
Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}...   438   e-144
TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.3...   421   e-139
KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]...   415   e-135
KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.3...   396   e-129
TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.3...   397   e-128
NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {O...   353   e-113
CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {...   263   4e-78
KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {O...    39   0.036
Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {...    35   0.67 
TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {O...    35   0.73 
Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [89...    34   1.4  
Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {O...    34   1.5  
KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some s...    34   1.6  
TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {O...    34   1.7  
SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]...    33   2.0  
Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON} Y...    33   2.3  
SAKL0G18700g Chr7 complement(1613786..1618714) [4929 bp, 1642 aa...    33   2.3  
Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON} Y...    33   2.3  
CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly...    33   2.4  
Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)...    33   2.5  
YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}  WH...    33   2.6  
KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2...    33   2.8  
KNAG0A02870 Chr1 complement(342659..344773) [2115 bp, 704 aa] {O...    33   3.1  
CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {...    33   3.1  
ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON} S...    33   3.4  
ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some s...    33   3.5  
Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar t...    33   3.9  
NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.5...    33   3.9  
TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.2...    32   4.7  
CAGL0J07898g Chr10 (770997..771464) [468 bp, 155 aa] {ON} highly...    30   8.4  

>YDL167C Chr4 complement(160995..163154) [2160 bp, 719 aa] {ON}
           NRP1Putative RNA binding protein of unknown function;
           localizes to stress granules induced by glucose
           deprivation; predicted to be involved in ribosome
           biogenesis
          Length = 719

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/478 (91%), Positives = 439/478 (91%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA
Sbjct: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD
Sbjct: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180
           RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY
Sbjct: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180

Query: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240
           SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS
Sbjct: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240

Query: 241 ELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEAT 300
           ELESWFTQYGVRPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEAT
Sbjct: 241 ELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEAT 300

Query: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360
           EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN
Sbjct: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360

Query: 361 CPSCGFSNFQRRTACFRCSFPAPSNSQIHTAXXXXXXXXXXXXXXXXXXXXXXXXXXXTA 420
           CPSCGFSNFQRRTACFRCSFPAPSNSQIHTA                           TA
Sbjct: 361 CPSCGFSNFQRRTACFRCSFPAPSNSQIHTANSNNNVNSSRNNLNNRVNSGSSSNISNTA 420

Query: 421 ANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS 478
           ANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS
Sbjct: 421 ANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS 478

 Score =  300 bits (767), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 142/142 (100%), Positives = 142/142 (100%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637
           MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN
Sbjct: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637

Query: 638 ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN 697
           ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN
Sbjct: 638 ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN 697

Query: 698 VNFSNVGDNSAFGNGFNSSIRW 719
           VNFSNVGDNSAFGNGFNSSIRW
Sbjct: 698 VNFSNVGDNSAFGNGFNSSIRW 719

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +C + NF +   C RC  P
Sbjct: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607

 Score = 38.5 bits (88), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381

>Skud_4.90 Chr4 complement(156704..158827) [2124 bp, 707 aa] {ON}
           YDL167C (REAL)
          Length = 707

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/480 (76%), Positives = 400/480 (83%), Gaps = 2/480 (0%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLELQVA+LPD+PKDQCRI +IA+QIV+AETL+CHY  +SLP IEV+G  KSLESA
Sbjct: 1   MHYVVLELQVAYLPDSPKDQCRIGSIAYQIVDAETLICHYDIDSLPKIEVDGEAKSLESA 60

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           M+QLDKDIHDVIGND+FVLVSL STWHIRVTL RQARDDGFILTSYLQHP++FDLWKEFD
Sbjct: 61  MIQLDKDIHDVIGNDEFVLVSLCSTWHIRVTLSRQARDDGFILTSYLQHPRLFDLWKEFD 120

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAA--KNTKDLDEIVRILEVSIPTEEAGSVPE 178
           RWCVNHPE+L Q+KA SNNN NTK+   N A  KNTKD +E++RILEVS P+E A  +PE
Sbjct: 121 RWCVNHPELLEQRKATSNNNSNTKAGGSNGALAKNTKDFNEMIRILEVSTPSEGADFIPE 180

Query: 179 IYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTT 238
             SLL+RTTDIL+QLHKKC+SPEDM+SVLT+PYDS+TDIR FLQE+SK+LYMNNLPPDTT
Sbjct: 181 EQSLLRRTTDILLQLHKKCSSPEDMKSVLTQPYDSYTDIRTFLQERSKVLYMNNLPPDTT 240

Query: 239 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 298
           QSELESWFTQYGVRPVGFWTVKNIVEDT            PYVE+QDSISGFVVFQTHEE
Sbjct: 241 QSELESWFTQYGVRPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEEQDSISGFVVFQTHEE 300

Query: 299 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 358
           ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD
Sbjct: 301 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 360

Query: 359 WNCPSCGFSNFQRRTACFRCSFPAPSNSQIHTAXXXXXXXXXXXXXXXXXXXXXXXXXXX 418
           WNCPSCGFSNFQRRTACFRCSFPAPSN Q+H                             
Sbjct: 361 WNCPSCGFSNFQRRTACFRCSFPAPSNIQMHNVISNNNANSNSNILNNRMSSGSSNNNNS 420

Query: 419 TAANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS 478
              NHPY   EFNM+ N TP AL YNRA F AITPLSRQNSLN+ PS+SGSPII+ADHF+
Sbjct: 421 AIVNHPYINTEFNMMGNTTPTALAYNRAQFSAITPLSRQNSLNLTPSSSGSPIIMADHFA 480

 Score =  201 bits (512), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (79%), Gaps = 14/142 (9%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637
           +PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS++ DA+ETNHYI+  T GP S   S+N 
Sbjct: 580 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADANETNHYIEGLTVGPGSHIHSDN- 638

Query: 638 ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN 697
                  GSN  RTDG DNKGRDISLME++SPPLS+    +KEGDGNGSSFNEFK DK N
Sbjct: 639 -------GSN--RTDGKDNKGRDISLMEYVSPPLSI----VKEGDGNGSSFNEFKGDKVN 685

Query: 698 VNFSNVGDNSAFGNGFNSSIRW 719
           +++SN  D+S+F NGFN S+RW
Sbjct: 686 IDYSNGNDSSSFTNGFNGSVRW 707

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNS 386
           R GDW C +C + NF +   C RC  P   N+
Sbjct: 583 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNA 614

 Score = 38.9 bits (89), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 357 RPGDWNCPSCGFSNFQRRTACFRCSFP 383

>Smik_4.71 Chr4 complement(137635..139914) [2280 bp, 759 aa] {ON}
           YDL167C (REAL)
          Length = 759

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/478 (76%), Positives = 395/478 (82%), Gaps = 2/478 (0%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLELQVAHLP++PKDQCRI NIA+Q V+AETL CHY  NSLP+IEV+  T+SLE+A
Sbjct: 1   MHYVVLELQVAHLPNSPKDQCRIVNIAYQFVDAETLACHYENNSLPNIEVDRETRSLETA 60

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           M+QLDK I D++GND+FVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPK+FDLWKEFD
Sbjct: 61  MIQLDKAIQDILGNDEFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKLFDLWKEFD 120

Query: 121 RWCVNHPEILGQKKAISNNN-CNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179
           RWCVNHPEIL Q K  SNNN   TK  S   AKN KDLDE++RILE+S  TEEA SVPE 
Sbjct: 121 RWCVNHPEILEQMKTASNNNNSGTKGNSGGLAKNAKDLDEMIRILEISSSTEEAVSVPEE 180

Query: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239
           YSLL+RTTDILI LH+KC S EDM+ VLT+PYDSHTDIR FLQE+SK+LYMNNLPPDTTQ
Sbjct: 181 YSLLRRTTDILIHLHRKCCSSEDMKFVLTQPYDSHTDIRTFLQERSKVLYMNNLPPDTTQ 240

Query: 240 SELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 299
           SELESWFTQYGVRPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEA
Sbjct: 241 SELESWFTQYGVRPVGFWTVKNIVEDTSNINNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359
           TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIHTAXXXXXXXXXXXXXXXXXXXXXXXXXXXT 419
           NCPSCGFSNFQRRTACFRCSFPAPSN Q H                             +
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPSNIQTHVTSSNNVNNSWNNLNNRMNSGSSNNNNNAS 420

Query: 420 AANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHF 477
              HPYG  E+NM+AN TP+A TYNRAH+ AITPLSRQNSLNM PSNSGSPIIIADHF
Sbjct: 421 VN-HPYGTSEYNMVANATPSAFTYNRAHYSAITPLSRQNSLNMVPSNSGSPIIIADHF 477

 Score =  197 bits (501), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 102/142 (71%), Positives = 115/142 (80%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637
           +PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS+S DA+ETNHYI++ST   AS TPSN N
Sbjct: 618 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVSTDANETNHYIEASTVVSASHTPSNKN 677

Query: 638 ISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNEFKSDKAN 697
             VN NGG+N   TDG DNK  DISLMEF+S PLSMA KS  EGDGN +SFNEFKS   N
Sbjct: 678 TVVNNNGGNNIDHTDGKDNKYHDISLMEFVSSPLSMAAKSTMEGDGNLTSFNEFKSGNVN 737

Query: 698 VNFSNVGDNSAFGNGFNSSIRW 719
           V+ SN  D++AFGNGF+ S+RW
Sbjct: 738 VSLSNGDDSNAFGNGFSRSVRW 759

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +C + NF +   C RC  P
Sbjct: 621 RAGDWKCSTCTYHNFAKNVVCLRCGGP 647

 Score = 38.5 bits (88), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>Suva_4.79 Chr4 complement(148569..150695) [2127 bp, 708 aa] {ON}
           YDL167C (REAL)
          Length = 708

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/479 (72%), Positives = 388/479 (81%), Gaps = 1/479 (0%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLELQVAHLPD+PKDQCRI N+A+QIV+AETL  HY   S PSI+V+G  KSLESA
Sbjct: 1   MHYVVLELQVAHLPDSPKDQCRIVNMAYQIVDAETLASHYENGSSPSIDVDGEKKSLESA 60

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           M QLDKDI  +IGNDDFVLVSL STWHIRVTLPRQARDDGFILTSYLQHP++FDLWKEF+
Sbjct: 61  MGQLDKDIQHIIGNDDFVLVSLCSTWHIRVTLPRQARDDGFILTSYLQHPRLFDLWKEFE 120

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAA-KNTKDLDEIVRILEVSIPTEEAGSVPEI 179
           RWC+NHPEI+G +K I NNN NTKS SI    KNTKDL+E++RILE+    EE     + 
Sbjct: 121 RWCINHPEIMGLRKNILNNNSNTKSSSIGTLIKNTKDLNEMMRILEIPNTVEEDDFALDN 180

Query: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239
           +SLL+RT D+L+QLHKKC+S EDM+SVLT+PYDSHTDIR+FLQE+SK+LYMNNLPPDTTQ
Sbjct: 181 HSLLQRTIDVLLQLHKKCSSAEDMKSVLTQPYDSHTDIRSFLQERSKVLYMNNLPPDTTQ 240

Query: 240 SELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 299
           SELESWFTQYG RPVGFWTVKNIVEDT            PYVEDQDSISGFVVFQTHEEA
Sbjct: 241 SELESWFTQYGARPVGFWTVKNIVEDTSNVNNNWSLNNSPYVEDQDSISGFVVFQTHEEA 300

Query: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359
           TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW
Sbjct: 301 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 360

Query: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIHTAXXXXXXXXXXXXXXXXXXXXXXXXXXXT 419
           NCPSCGFSNFQRRTACFRCSFPAPSNSQ+H A                            
Sbjct: 361 NCPSCGFSNFQRRTACFRCSFPAPSNSQMHNAITNNNANSNKSSLNNRANSGALNNNNNI 420

Query: 420 AANHPYGAPEFNMIANNTPAALTYNRAHFPAITPLSRQNSLNMAPSNSGSPIIIADHFS 478
             +HPYG PE NM+ + TP AL YNR+ F A+TPLSRQNSLN+ PS+SGSP+   + F+
Sbjct: 421 TVSHPYGTPELNMMGSITPTALAYNRSQFSAMTPLSRQNSLNLTPSSSGSPVNTPNSFA 479

 Score =  196 bits (497), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 111/149 (74%), Gaps = 7/149 (4%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPA-------S 630
           +PFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS++ D SETNHYID+ST  P        S
Sbjct: 560 IPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADVSETNHYIDTSTIAPGPHNHNNNS 619

Query: 631 RTPSNNNISVNTNGGSNAGRTDGNDNKGRDISLMEFMSPPLSMATKSMKEGDGNGSSFNE 690
              S    + N  G +     DG DNK  DISLMEF+S PLSMA KS+KEGDGN +SFNE
Sbjct: 620 NNNSTVTNTNNNGGNNGNNGVDGKDNKVHDISLMEFVSTPLSMAEKSIKEGDGNANSFNE 679

Query: 691 FKSDKANVNFSNVGDNSAFGNGFNSSIRW 719
           +KSDKANVNFSN  D++AFGNGFN S RW
Sbjct: 680 YKSDKANVNFSNGNDSTAFGNGFNGSARW 708

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 18/34 (52%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQI 388
           R GDW C +C + NF +   C RC  P   N+ +
Sbjct: 563 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSVNADV 596

 Score = 38.9 bits (89), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 356 RPGDWNCPSCGFSNFQRRTACFRCSFP 382

>TDEL0C01990 Chr3 complement(345897..347717) [1821 bp, 606 aa] {ON}
           Anc_7.349 YDL167C
          Length = 606

 Score =  522 bits (1344), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 243/390 (62%), Positives = 302/390 (77%), Gaps = 18/390 (4%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGT-TKSLES 59
           MHYVVLE++  H  + PKD  R+  +++Q ++AE++  +Y  + +P I ++   + S + 
Sbjct: 1   MHYVVLEVEATHRIEAPKDHGRVNKLSYQFIDAESMKAYYADDQIPLISLDQQGSISFQE 60

Query: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
           ++ + D+D+  ++G D+FVL SLYSTWHIRVT+PRQARD+GF+L SYLQHP+VFDLWKE+
Sbjct: 61  SIAKFDRDVMSIVGEDEFVLCSLYSTWHIRVTIPRQARDEGFLLPSYLQHPRVFDLWKEY 120

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179
           DRWC NHPE+L  +K+     C T        K  KD  EI+++LE+S  TEE    P  
Sbjct: 121 DRWCANHPEVLTLRKS-----CRT------GIKRVKDQTEILKVLEMS--TEEITEKP-- 165

Query: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239
             +L  T DIL+QL ++CT+ ED+  VL++PYDSH DIR FLQE+SK+LY+NNLPPDTTQ
Sbjct: 166 --VLGYTVDILLQLCERCTTKEDISDVLSRPYDSHLDIRNFLQEQSKVLYLNNLPPDTTQ 223

Query: 240 SELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 299
           SELESWFTQ+G RPVGFWTVKNIVE+T            PYVE+QDSISGFVVFQTHEEA
Sbjct: 224 SELESWFTQFGARPVGFWTVKNIVEETANINNKWSMNNSPYVEEQDSISGFVVFQTHEEA 283

Query: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359
           TEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGDW
Sbjct: 284 TEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDW 343

Query: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIH 389
           NCPSCGFSNFQRRTACFRCSFPA S  Q++
Sbjct: 344 NCPSCGFSNFQRRTACFRCSFPAASAVQVN 373

 Score = 68.6 bits (166), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)

Query: 579 PFRAGDWKCSTCTYHNFAKNVVCLRCGGPK-SISGDASETN 618
           PFRAGDWKC TCTYHNFAKN+VCLRCG  K SIS   ++ N
Sbjct: 476 PFRAGDWKCPTCTYHNFAKNLVCLRCGAAKVSISDSNNDDN 516

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 3/66 (4%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNNISV 640
           R GDW C +C + NF +   C RC  P   +  A + N+    +  G  + T    NI +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTACFRCSFP---AASAVQVNNKQYMNYNGNINSTNQGGNIYI 395

Query: 641 NTNGGS 646
              GGS
Sbjct: 396 TKVGGS 401

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 15/24 (62%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRC 378
           R GDW CP+C + NF +   C RC
Sbjct: 478 RAGDWKCPTCTYHNFAKNLVCLRC 501

>ZYRO0F11682g Chr6 (956534..958327) [1794 bp, 597 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 597

 Score =  513 bits (1322), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 296/391 (75%), Gaps = 20/391 (5%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLP-SIEVNGTTKSLES 59
           M+YVVLE++ AHL + PKDQCRIA I++Q VNAETL  HY  N  P  I     + +L  
Sbjct: 1   MYYVVLEVETAHLIEIPKDQCRIAKISYQFVNAETLQVHYQENQAPLHIISENDSTNLHE 60

Query: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
           A+  L+++I+ + G++ FVL SL STWH+RVTL RQARD  F L SYLQHPK+FDLWKE+
Sbjct: 61  AVANLNEEINRIAGDEPFVLCSLNSTWHLRVTLSRQARDQNFALPSYLQHPKIFDLWKEY 120

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179
           +RWCVNHPE++  +K              N  +  KD+ E+ R+L+++       S    
Sbjct: 121 ERWCVNHPEVMPLRK--------------NGGRRMKDVAELARVLDINGLNFNDSSFD-- 164

Query: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239
              L R+ +IL++LH++C++PEDM  VLT PYDSH D+R FLQE SK+LY+NNLPPDTTQ
Sbjct: 165 ---LSRSVEILLRLHQRCSTPEDMAMVLTHPYDSHMDVRNFLQECSKVLYLNNLPPDTTQ 221

Query: 240 SELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 299
           SELESWFTQ+G RPVGFWTVKNIVE+T            PYVE+QDSISGFVVFQTHEEA
Sbjct: 222 SELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSMNNSPYVEEQDSISGFVVFQTHEEA 281

Query: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359
           TEVL LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD+AQEILSPFPQSKNKPRPGDW
Sbjct: 282 TEVLTLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQSKNKPRPGDW 341

Query: 360 NCPSCGFSNFQRRTACFRCSFPAPSNSQIHT 390
           NCPSCGFSNFQRRTACFRCSFPA +  Q++T
Sbjct: 342 NCPSCGFSNFQRRTACFRCSFPATTAVQVNT 372

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 31/36 (86%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGD 613
           +PFRAGDWKC +C YHNFAKNVVCLRCGGPK  + D
Sbjct: 485 VPFRAGDWKCPSCIYHNFAKNVVCLRCGGPKITAVD 520

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW CPSC + NF +   C RC  P
Sbjct: 488 RAGDWKCPSCIYHNFAKNVVCLRCGGP 514

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 4/50 (8%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPAS 630
           R GDW C +C + NF +   C RC  P + +   + T  YI     GPA+
Sbjct: 337 RPGDWNCPSCGFSNFQRRTACFRCSFPATTAVQVN-TKQYISG---GPAA 382

>SAKL0F11352g Chr6 (883590..885341) [1752 bp, 583 aa] {ON} some
           similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 583

 Score =  477 bits (1227), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 238/386 (61%), Positives = 278/386 (72%), Gaps = 28/386 (7%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M+YVVLE +  H  + PKD  R++ I +Q ++++TL   +       I V      L   
Sbjct: 1   MYYVVLEAETVHGEEKPKDHTRVSRICYQFIHSDTLQSVFEQ----PIIVEVGPGQLREQ 56

Query: 61  MVQLDKDIHDVIGND--DFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKE 118
           + QLD+ +   I +D  +F LVSL STWHIRVT+PRQARD+GFIL  YLQHPKVFDLWKE
Sbjct: 57  VAQLDQLVTSKITSDNHEFALVSLSSTWHIRVTIPRQARDEGFILPPYLQHPKVFDLWKE 116

Query: 119 FDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPE 178
           +DRWCVNHPE L  +K            + N  K ++DL E+ R+LE  + T      P 
Sbjct: 117 YDRWCVNHPETLPLRK------------NSNLGKKSRDLPELSRVLEAPLQT-----FP- 158

Query: 179 IYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTT 238
               L +T  IL QLHKKC  PED   VLT PYDS+ D+R FLQE+SK+LYMNNLPPDTT
Sbjct: 159 ----LDQTIGILSQLHKKCLLPEDQSMVLTHPYDSYLDVRTFLQERSKVLYMNNLPPDTT 214

Query: 239 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 298
           QSELESWFTQ+G RPVGFWTVKN+VE+T             YVE+QDSISGFVVFQTHEE
Sbjct: 215 QSELESWFTQFGARPVGFWTVKNVVEETSNVNNNWSCNNSSYVEEQDSISGFVVFQTHEE 274

Query: 299 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 358
           ATE L+LNGRSILSN+ANTKQPRVVEHV+ELQPSST VLD+A E+LSPFPQSKNKPRPGD
Sbjct: 275 ATEALSLNGRSILSNMANTKQPRVVEHVVELQPSSTRVLDRAHELLSPFPQSKNKPRPGD 334

Query: 359 WNCPSCGFSNFQRRTACFRCSFPAPS 384
           WNCPSCGFSNFQRRTACFRCSFPA S
Sbjct: 335 WNCPSCGFSNFQRRTACFRCSFPATS 360

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 49/74 (66%), Gaps = 2/74 (2%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNN 637
           +PFRAGDWKC +CTYHNFAKNVVCLRCGGPK++ G        +D      + +  S + 
Sbjct: 497 VPFRAGDWKCVSCTYHNFAKNVVCLRCGGPKTVGGAGVANQANLDVLLLDGSCQNGSAST 556

Query: 638 ISVNT--NGGSNAG 649
           IS++   NGGS+ G
Sbjct: 557 ISLSEMHNGGSSFG 570

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C SC + NF +   C RC  P
Sbjct: 500 RAGDWKCVSCTYHNFAKNVVCLRCGGP 526

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           R GDW C +C + NF +   C RC  P +
Sbjct: 331 RPGDWNCPSCGFSNFQRRTACFRCSFPAT 359

>Kwal_56.24638 s56 (1083888..1085471) [1584 bp, 527 aa] {ON} YDL167C
           (NRP1) - Asparagine-rich protein [contig 161] FULL
          Length = 527

 Score =  474 bits (1221), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 233/382 (60%), Positives = 282/382 (73%), Gaps = 16/382 (4%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLE+ +AH  D+PKD  +IA   +Q ++ E L   +  N    +E NG   SL+ A
Sbjct: 1   MHYVVLEVDLAHREDSPKDWSQIAAFHYQFLDTEELKSVFQENKHIVLE-NGC--SLQEA 57

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           + QL+KDI + +  DDFVL SL STWH RVT+PRQARD+ FIL  +LQHP+VFDLWKE+D
Sbjct: 58  VSQLEKDIGEHL-KDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPRVFDLWKEYD 116

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180
           RWCVNHPE L  +++ S              K  KD+ E+  +LE+   T+++       
Sbjct: 117 RWCVNHPETLALRRSNS------------MGKKVKDVAELRSVLELDSATQDSTPGAAEP 164

Query: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240
             L++T  I+ QLHKKC + ED   VLT PYDS+ D+R FLQE+SK+LYMNNLPPDTTQS
Sbjct: 165 DALEQTIAIIRQLHKKCVTAEDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQS 224

Query: 241 ELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEAT 300
           ELESWFTQ+G RPVGFWTVKNIVE+T             YVE QDSISGFVVFQ+HEEAT
Sbjct: 225 ELESWFTQFGARPVGFWTVKNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEAT 284

Query: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360
           E L+LNGRSILSN+ANTKQPRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWN
Sbjct: 285 EALSLNGRSILSNIANTKQPRVIEHIVEVQPSSARVLDRAQEILSPFPQSKNKPRPGDWN 344

Query: 361 CPSCGFSNFQRRTACFRCSFPA 382
           CPSCGFSNFQRRT+CFRCSFP+
Sbjct: 345 CPSCGFSNFQRRTSCFRCSFPS 366

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 38/53 (71%), Gaps = 3/53 (5%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGD---ASETNHYIDSSTFG 627
           +PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS       ++  N Y +    G
Sbjct: 452 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKGSAAVNSYAEGQDIG 504

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 387
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 455 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 487

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 20/39 (51%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNH 619
           R GDW C +C + NF +   C RC  P + S   + T +
Sbjct: 339 RPGDWNCPSCGFSNFQRRTSCFRCSFPSTGSAPMNNTGY 377

>NCAS0A14150 Chr1 (2780086..2781798) [1713 bp, 570 aa] {ON}
           Anc_7.349 YDL167C
          Length = 570

 Score =  461 bits (1187), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 218/390 (55%), Positives = 287/390 (73%), Gaps = 14/390 (3%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M YVVLEL+ +H  +TPKD  RI   ++Q +N+ETL   +      SI++     + +  
Sbjct: 1   MFYVVLELETSHQVETPKDHSRITKCSYQFINSETLQATF--EEPKSIDIPDMANAFKDT 58

Query: 61  MVQLDKDIH-DVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
           + QL+ DI  +++   DFVL SL+S W IRVTLPRQA D GFIL SYL+HP+VF+LWKEF
Sbjct: 59  ISQLEADIKAEIVDFSDFVLCSLFSVWDIRVTLPRQAHDLGFILPSYLKHPRVFNLWKEF 118

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEV--SIPTEEAGSVP 177
           D+WC NHPE++  +K+         ++ + + K   D+ +IV ILE+  S+    + S P
Sbjct: 119 DKWCGNHPEVIPMRKS---------NLRVKSPKTAGDISDIVNILEIDTSLQVPLSTSNP 169

Query: 178 EIYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDT 237
           +    ++ +T+IL +L KKCT+ +D++ VLT+PYDS+ DI+ FLQE+S++LYMNNLP DT
Sbjct: 170 QTLLSIQDSTNILTKLRKKCTTLDDVQLVLTRPYDSYADIKTFLQERSRVLYMNNLPSDT 229

Query: 238 TQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHE 297
           TQSELESWFTQ+G RP+GFWT KN +E+T            P V++QD ++GFVVFQ+HE
Sbjct: 230 TQSELESWFTQFGARPIGFWTAKNTIEETSSINSNWSLNGNPLVDEQDCVAGFVVFQSHE 289

Query: 298 EATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPG 357
           EATE L LNGRSILSN+ANTKQPRVVEH++E+QPSST VLD  Q+ILS FPQSKNKPRPG
Sbjct: 290 EATEALVLNGRSILSNIANTKQPRVVEHIVEIQPSSTRVLDAGQDILSAFPQSKNKPRPG 349

Query: 358 DWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 387
           DW+CPSCGFSNFQRRTACFRCSFPAP+N++
Sbjct: 350 DWSCPSCGFSNFQRRTACFRCSFPAPNNNK 379

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 36/49 (73%), Gaps = 1/49 (2%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTF 626
           +PFRAGDWKC +CTYHNFAKNVVCLRC  PK IS  +   N    S+TF
Sbjct: 473 VPFRAGDWKCPSCTYHNFAKNVVCLRCRIPK-ISQQSHNGNEGNQSTTF 520

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 16/27 (59%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW CPSC + NF +   C RC  P
Sbjct: 476 RAGDWKCPSCTYHNFAKNVVCLRCRIP 502

 Score = 39.3 bits (90), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 347 RPGDWSCPSCGFSNFQRRTACFRCSFP 373

>KLTH0H01276g Chr8 complement(122337..124010) [1674 bp, 557 aa] {ON}
           some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 557

 Score =  452 bits (1162), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 239/427 (55%), Positives = 286/427 (66%), Gaps = 59/427 (13%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEV-NGTTKSLES 59
           MHYVVLE+++AH  D+PKD  +IA   +Q ++ ETL   +  N    +E+ NG T  L+ 
Sbjct: 1   MHYVVLEVELAHREDSPKDWSQIAKFNYQFLDTETLEPVFEENK--HVELGNGCT--LQD 56

Query: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
           A+ QL+KDI +    DDFVL SL STWH RVT+PRQARD+ FIL  +LQHPKVFDLWKE+
Sbjct: 57  AVAQLEKDISE-HAKDDFVLCSLNSTWHFRVTIPRQARDEVFILPPHLQHPKVFDLWKEY 115

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRIL------EVSIP---- 169
           DRWC+NHPE      A+  N            K TKDL E+  +L      E + P    
Sbjct: 116 DRWCMNHPET----SAMRQNPL---------GKRTKDLAEMRSVLGLDGTEEGAHPDANQ 162

Query: 170 -------TEEAG-----------------------SVPEIYSLLKRTTDILIQLHKKCTS 199
                   E++G                       S  E    + +   I+ QLHKKC +
Sbjct: 163 NGGEQSKAEQSGAEQLVAGQPDTKQPSTELSSSEQSPAEQPDTITQAVVIITQLHKKCVT 222

Query: 200 PEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTV 259
            +D   VLT PYDS+ D+R FLQE+SK+LYMNNLPPDTTQSELESWFTQ+G RPVGFWTV
Sbjct: 223 ADDKSLVLTHPYDSYLDVRNFLQERSKVLYMNNLPPDTTQSELESWFTQFGARPVGFWTV 282

Query: 260 KNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQ 319
           KNIVE+T             YVE QDSISGFVVFQ+HEEATE L+LNGRSILSN+ANTKQ
Sbjct: 283 KNIVEETSNVNNNWSSNNSTYVEAQDSISGFVVFQSHEEATEALSLNGRSILSNIANTKQ 342

Query: 320 PRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCS 379
           PRV+EH++E+QPSS  VLD+AQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRT+CFRCS
Sbjct: 343 PRVIEHIVEIQPSSARVLDRAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTSCFRCS 402

Query: 380 FPAPSNS 386
           FPA S +
Sbjct: 403 FPAASGA 409

 Score = 80.1 bits (196), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 37/53 (69%), Gaps = 3/53 (5%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASE---TNHYIDSSTFG 627
           +PFRAGDWKC+TCTYHNFAKNVVCLRCGGPKS      E    N Y D    G
Sbjct: 488 VPFRAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQQKELGTVNSYTDIQDIG 540

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 1/41 (2%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYI 621
           R GDW C +C + NF +   C RC  P + SG     N Y+
Sbjct: 378 RPGDWNCPSCGFSNFQRRTSCFRCSFP-AASGAGMNNNGYM 417

 Score = 39.7 bits (91), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQ 387
           R GDW C +C + NF +   C RC  P  +  Q
Sbjct: 491 RAGDWKCATCTYHNFAKNVVCLRCGGPKSTEHQ 523

>ACL149W Chr3 (88715..90601) [1887 bp, 628 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL167C (NRP1)
          Length = 628

 Score =  441 bits (1135), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 218/384 (56%), Positives = 270/384 (70%), Gaps = 28/384 (7%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M+YV+ E  VAH  DTPKD  R++ I +Q+++   L+  Y       IEV G    ++ A
Sbjct: 1   MYYVLFECDVAHKEDTPKDHARVSKIYYQLIHEPELLPLYA--DAREIEVGG--GGVQMA 56

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
             QL+  + +   ++ FVL SL+STWH+RVTLPRQA D+G +L  +L H KVFDLWKE D
Sbjct: 57  TGQLEAALQEATASEPFVLCSLHSTWHLRVTLPRQAHDEGSMLPMFLAHAKVFDLWKECD 116

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180
           RWC NH         +S   CN        A    D+ E+ R+L++    E+  S    +
Sbjct: 117 RWCANH---------VSERACN--------AGAKGDVAELFRVLDLD---EQLVS----H 152

Query: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240
           + +++ T +L+QLH KCT+ ED   VLT PYDS+ D+ +F+QE+S++LYMNNLPPDTTQS
Sbjct: 153 AYIQQATRVLLQLHNKCTTAEDQSLVLTHPYDSYADMTSFIQERSEVLYMNNLPPDTTQS 212

Query: 241 ELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEAT 300
           ELESWFTQ+G RPVGFWTVKN+VEDT             YVE+ DSISGFVVFQ+HE A+
Sbjct: 213 ELESWFTQFGARPVGFWTVKNVVEDTSNVNNNWSSNNSRYVEEHDSISGFVVFQSHEAAS 272

Query: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360
           E L LNGRSILSN+ANTKQPRVVEHV+EL+PSS+ VLD AQEILSPFPQSKNKPRPGDWN
Sbjct: 273 EALNLNGRSILSNMANTKQPRVVEHVVELKPSSSRVLDCAQEILSPFPQSKNKPRPGDWN 332

Query: 361 CPSCGFSNFQRRTACFRCSFPAPS 384
           CPSCGFSNFQRR ACFRCSFPA S
Sbjct: 333 CPSCGFSNFQRRIACFRCSFPATS 356

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/51 (56%), Positives = 38/51 (74%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGP 628
           +PFRAGDWKC  C+YHNFAKN+VCLRCG PK+ + D ++ +     S+ GP
Sbjct: 501 VPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTANEDETQASLQGLHSSSGP 551

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 350 SKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 385
           S N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 SSNVPFRAGDWKCLNCSYHNFAKNIVCLRCGNPKTAN 534

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 17/29 (58%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           R GDW C +C + NF + + C RC  P +
Sbjct: 327 RPGDWNCPSCGFSNFQRRIACFRCSFPAT 355

>KAFR0B00870 Chr2 (162698..164326) [1629 bp, 542 aa] {ON} Anc_7.349
           YDL167C
          Length = 542

 Score =  434 bits (1117), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 278/395 (70%), Gaps = 12/395 (3%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M YV+LEL   H  +TPKD  RI  + FQ+VNA  L        +  I ++   +S ++A
Sbjct: 1   MFYVILELDTLHQVETPKDHTRITKVTFQLVNANAL--GEVPTKVDQIVIDEQAESFKAA 58

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
             +L++ I  +  +  F+L SL+STW IRVTL RQARD G  +  +LQ+PK+FDL KE+ 
Sbjct: 59  FEKLNESITSITRDSSFILCSLFSTWDIRVTLNRQARDLGVSMPYFLQYPKIFDLMKEYQ 118

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILE--VSIPTEEAGSVPE 178
           RWC+NHPE++  K  + ++    K+I+++  K        V  LE   +   E  G++ +
Sbjct: 119 RWCLNHPEVMSWKPKLESD----KTINMDKKKLGLLELLTVLGLEDMYNFKEENDGAIDD 174

Query: 179 IYSLLKR----TTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLP 234
                +R    +T +L+QL  +CT+ +D ++VLT PYDS TD+R+FLQE+S++LYMNNLP
Sbjct: 175 KMFKNERDMTISTSVLLQLLIRCTTSDDTKNVLTCPYDSDTDVRSFLQERSRVLYMNNLP 234

Query: 235 PDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQ 294
            DTTQSELESWFTQ+G RPVGFWT KN+V DT            PYVE+ DSI GFVVFQ
Sbjct: 235 SDTTQSELESWFTQFGTRPVGFWTFKNVVGDTSSLANTWNSNNSPYVEELDSIPGFVVFQ 294

Query: 295 THEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKP 354
           THEEA EVLALNGR+ILSN+ANTKQPRVVEHV+E+QPSST VLDKA EILS FPQSKNKP
Sbjct: 295 THEEAIEVLALNGRAILSNVANTKQPRVVEHVVEIQPSSTSVLDKAHEILSSFPQSKNKP 354

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQIH 389
           RPGDW+CPSCGFSNFQRRTACFRCSFPAPSN  I+
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNGHIN 389

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 31/32 (96%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDW C++CTYHNFAKNV+CLRCGGPK+
Sbjct: 455 IPFRAGDWNCASCTYHNFAKNVLCLRCGGPKT 486

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384
           R GDWNC SC + NF +   C RC  P  S
Sbjct: 458 RAGDWNCASCTYHNFAKNVLCLRCGGPKTS 487

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISG 612
           R GDW C +C + NF +   C RC  P   +G
Sbjct: 355 RPGDWSCPSCGFSNFQRRTACFRCSFPAPSNG 386

>Kpol_530.32 s530 complement(78552..80606) [2055 bp, 684 aa] {ON}
           complement(78552..80606) [2055 nt, 685 aa]
          Length = 684

 Score =  438 bits (1127), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 215/412 (52%), Positives = 281/412 (68%), Gaps = 27/412 (6%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTK-SLES 59
           M+Y+V+E    H  +TPKD  RI+ +++Q V+AE+L C+YG + +  I ++  +  S + 
Sbjct: 1   MYYIVIETDTLHSVETPKDHTRISKLSYQFVDAESLECYYGKDEVKVISIDDESAISFKD 60

Query: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
            + QLD+DI  V+G+D+FV  SL S W +RVT+PRQARD+   L  YLQ  KVFDLWKEF
Sbjct: 61  MIKQLDEDIKTVVGDDEFVFCSLNSVWDLRVTIPRQARDEIVTLPDYLQEVKVFDLWKEF 120

Query: 120 DRWCVNHPEILGQKKA--ISNNNCNTKSISINAAKNTKDLDEIVR------ILEVSIPTE 171
           +RW  NH + +  KK+  + +     + + + A K T +  EI         +  +   E
Sbjct: 121 NRWAKNHSDTVTVKKSKNLRDLEELLRVLELTAEKTTVETKEIEENSDKEDEVHANTGAE 180

Query: 172 EAGS------------------VPEIYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDS 213
           E+G+                  + E    + R T+IL  +HKKCT+ ED+  VLTKPYDS
Sbjct: 181 ESGNATITTAADDDNNEDDSKEMKETPLEINRVTEILTTIHKKCTTEEDITLVLTKPYDS 240

Query: 214 HTDIRAFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXX 273
           ++D +AF +E SK+LYMNNLPPDTTQSELESWF Q+G +PV FWTVKNIVE+T       
Sbjct: 241 NSDFKAFKEEASKLLYMNNLPPDTTQSELESWFAQFGSKPVSFWTVKNIVEETSNVNNNW 300

Query: 274 XXXXXPYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSS 333
                PYVE+QDSISGFV FQ+H+EAT+ L LNGRSILSN+ANTKQPRVVEH++E+QPSS
Sbjct: 301 SMNNSPYVEEQDSISGFVSFQSHKEATDALLLNGRSILSNMANTKQPRVVEHIVEIQPSS 360

Query: 334 TGVLDKAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 385
             VL++ Q+I +PFPQSKNKPRPGDWNC SCGFSNFQRRTACFRCS+PA SN
Sbjct: 361 VTVLERVQDISAPFPQSKNKPRPGDWNCMSCGFSNFQRRTACFRCSYPAASN 412

 Score = 74.3 bits (181), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDWKC  C+YHNFAKNVVCLRCGGPKS
Sbjct: 540 VPFRAGDWKCIACSYHNFAKNVVCLRCGGPKS 571

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +C + NF +   C RC  P
Sbjct: 543 RAGDWKCIACSYHNFAKNVVCLRCGGP 569

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 382 RPGDWNCMSCGFSNFQRRTACFRCSYP 408

>TBLA0E02060 Chr5 (502492..504186) [1695 bp, 564 aa] {ON} Anc_7.349
           YDL167C
          Length = 564

 Score =  421 bits (1082), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 204/382 (53%), Positives = 266/382 (69%), Gaps = 27/382 (7%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M+Y ++ELQ AH  + PKD  +I NI++Q +N  TL   +  + +P+I+   TT  L  +
Sbjct: 1   MYYTLIELQTAHDAEAPKDHTKIINISYQFINQSTLQASFPDDKIPNIDC--TTLPLSES 58

Query: 61  MVQLDKDIHDVIGN-DDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
           +  L KD+   + N +DFVL SL STW +RVT+ RQA+D+ + L ++ ++P++FDLWKEF
Sbjct: 59  IALLQKDLELNLPNGEDFVLCSLNSTWDLRVTISRQAKDEQYTLPTFFKYPRIFDLWKEF 118

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEI 179
           DRWCVNH E++  +                  +  KDL ++  +L   IP+ E       
Sbjct: 119 DRWCVNHKELVQTRDP----------------RKLKDLKQLATLLH--IPSVET------ 154

Query: 180 YSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQ 239
            S +   + +L+QLH+KCT+ +D E VLT PYDS  D   F++  S +LYMNNLPPDTTQ
Sbjct: 155 LSSISLASKVLVQLHEKCTTEDDQEKVLTSPYDSKLDWDIFIETSSTVLYMNNLPPDTTQ 214

Query: 240 SELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEA 299
           SELE+WFTQ+GVRP+GFWTVKNI+EDT            PYVE+ DSISGF+VF TH+EA
Sbjct: 215 SELETWFTQFGVRPIGFWTVKNILEDTSIINNNWCVNNSPYVEEIDSISGFIVFSTHKEA 274

Query: 300 TEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDW 359
            +VL LNG SILSN+ANTKQPRVVEHV+E+QPSS  V+++ Q IL+PFPQSKNKPRPGDW
Sbjct: 275 IDVLTLNGHSILSNIANTKQPRVVEHVVEIQPSSPKVMERIQSILTPFPQSKNKPRPGDW 334

Query: 360 NCPSCGFSNFQRRTACFRCSFP 381
           NCPSCGFSNFQRRTACFRCSFP
Sbjct: 335 NCPSCGFSNFQRRTACFRCSFP 356

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 29/32 (90%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDWKC TC YHNFAKN+VCLRC GPKS
Sbjct: 477 VPFRAGDWKCLTCGYHNFAKNIVCLRCSGPKS 508

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 17/27 (62%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +CG+ NF +   C RCS P
Sbjct: 480 RAGDWKCLTCGYHNFAKNIVCLRCSGP 506

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 20/36 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASE 616
           R GDW C +C + NF +   C RC  P+  +  +S+
Sbjct: 330 RPGDWNCPSCGFSNFQRRTACFRCSFPQQQAVGSSQ 365

>KLLA0D12364g Chr4 complement(1051765..1053660) [1896 bp, 631 aa]
           {ON} some similarities with uniprot|P32770 Saccharomyces
           cerevisiae YDL167C NRP1
          Length = 631

 Score =  415 bits (1066), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 211/408 (51%), Positives = 270/408 (66%), Gaps = 30/408 (7%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           M YV+ E +  +  + PKD   I++IA+QI++ ETL   +      SI+    T SL++ 
Sbjct: 1   MFYVLFECETVYSEEAPKDHTMISSIAYQIISVETLKPIWEEARRHSIDA---THSLKNT 57

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           +  ++  + + +  ++FVL SL STW +RVTL RQARD+ ++L S+LQHPKVFDLW+E D
Sbjct: 58  IQSMENAVMENVAGEEFVLCSLNSTWDLRVTLSRQARDESWLLPSFLQHPKVFDLWREVD 117

Query: 121 RWCVNHPEIL--GQKKA---ISNNNCNTKSISINAAKNTKDLDEIV-------------- 161
           RW  NHPE    G  +    ++N N  T+    N  K  K +D ++              
Sbjct: 118 RWYRNHPEQYEKGTDRGGGNVANTNTTTQR---NKHKLVKSIDALLVFLNIDLDNKSTTD 174

Query: 162 -RILEVSIPTEEAGSVPEIYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAF 220
            R+ +V+I      ++P I    K    +L +LH+ CTS  D   VLT P+DS+ DI+ F
Sbjct: 175 QRMEQVNIDKNSFETLPSIQQCEK----VLFKLHRNCTSDNDQTLVLTHPFDSYLDIKNF 230

Query: 221 LQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPY 280
           L EKS +LYMNNLPPDTTQSELESWF Q+G RPVGFWTVKN+VEDT             Y
Sbjct: 231 LLEKSTVLYMNNLPPDTTQSELESWFAQFGSRPVGFWTVKNVVEDTSNVNNNWSTNNNLY 290

Query: 281 VEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKA 340
           V++QDSISGFVV+Q HEEA + L LNGRSILSN++NTKQPRVVEHV+E+QPSS  VLD+A
Sbjct: 291 VDEQDSISGFVVYQAHEEALDSLTLNGRSILSNMSNTKQPRVVEHVVEIQPSSNSVLDRA 350

Query: 341 QEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPSNSQI 388
           QEIL+ FPQSKNKPRPGDW CPSC FSNFQRRTACFRCSFP  S  Q+
Sbjct: 351 QEILTAFPQSKNKPRPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQM 398

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPAS 630
           +PFRAGDWKC+ CTYHNFAKNVVCLRCGGPK+ +  A+  N  + ++T   A+
Sbjct: 505 VPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTANVSANSNNATVTNATSNAAT 557

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 31/63 (49%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSISGDASETNHYIDSSTFGPASRTPSNNNISV 640
           R GDW C +C++ NF +   C RC  P S +   S  N+Y  +S  G  +RT +      
Sbjct: 365 RPGDWTCPSCSFSNFQRRTACFRCSFPMSSALQMSNGNNYNKNSVHGYKARTSTPQTADY 424

Query: 641 NTN 643
           N N
Sbjct: 425 NDN 427

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 20/41 (48%), Gaps = 1/41 (2%)

Query: 346 PFPQSKNKP-RPGDWNCPSCGFSNFQRRTACFRCSFPAPSN 385
           P     N P R GDW C +C + NF +   C RC  P  +N
Sbjct: 498 PMSNGSNVPFRAGDWKCANCTYHNFAKNVVCLRCGGPKTAN 538

>KNAG0C03780 Chr3 (743477..745093) [1617 bp, 538 aa] {ON} Anc_7.349
           YDL167C
          Length = 538

 Score =  396 bits (1017), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 198/393 (50%), Positives = 260/393 (66%), Gaps = 18/393 (4%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCH-YGTNSLPSIEVNGTTKSLES 59
           M YV++ELQ     D+ KDQ ++  + +QI++A++L       N +  + V G+  +L+ 
Sbjct: 1   MFYVLIELQSEQPRDSLKDQTKLKRLDYQIIDADSLEKRKINGNEIRQLAVEGS--NLQD 58

Query: 60  AMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEF 119
            ++  +K+I+ VI  ++FVL S++STW +RV LPR+A D+   L + L++P V DLWKEF
Sbjct: 59  TVLLFEKEINSVINGEEFVLCSMFSTWELRVVLPREANDEQVELPTILKYPIVLDLWKEF 118

Query: 120 DRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSV-PE 178
           DRWC NHP+ L   K   N  C             K+L  + ++L V     E+ +    
Sbjct: 119 DRWCTNHPDALQSVKGY-NRKC-------------KNLPMVHQVLGVEQRLNESVNANGY 164

Query: 179 IYSLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTT 238
               +  T+DIL+QLHKKC+S +D  +VLT+PY+S  D   F +E+S +LY+NNLPPDTT
Sbjct: 165 TRKEVGITSDILLQLHKKCSSDDDTNTVLTQPYNSKLDYETFTEEQSTVLYLNNLPPDTT 224

Query: 239 QSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEE 298
           Q ELE+WF Q+G RPV FWT KNIVEDT             YVE+QDS+SGF  FQT EE
Sbjct: 225 QGELETWFGQFGSRPVSFWTFKNIVEDTSNINNNWNLNNSYYVEEQDSVSGFATFQTFEE 284

Query: 299 ATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGD 358
           A   L L+GRSILSN+ANTKQPR+VEHV+E+ PSS  +L  ++EILS FPQSKNKPRPGD
Sbjct: 285 AFNALKLSGRSILSNVANTKQPRIVEHVVEIHPSSARILHSSEEILSAFPQSKNKPRPGD 344

Query: 359 WNCPSCGFSNFQRRTACFRCSFPAPSNSQIHTA 391
           WNCPSCGFSNFQRRTACFRCSFP PS  Q  T 
Sbjct: 345 WNCPSCGFSNFQRRTACFRCSFPVPSAVQNSTG 377

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (90%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDWKC+ C YHNFAKN++CLRC GPK+
Sbjct: 442 IPFRAGDWKCAACAYHNFAKNIICLRCSGPKT 473

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384
           R GDW C +C + NF +   C RCS P  S
Sbjct: 445 RAGDWKCAACAYHNFAKNIICLRCSGPKTS 474

 Score = 38.9 bits (89), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 341 RPGDWNCPSCGFSNFQRRTACFRCSFP 367

>TPHA0F02960 Chr6 (651108..653072) [1965 bp, 654 aa] {ON} Anc_7.349
           YDL167C
          Length = 654

 Score =  397 bits (1020), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 194/406 (47%), Positives = 261/406 (64%), Gaps = 38/406 (9%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAE---TLVCHYGTN-----SLPSIEVNG 52
           M+Y+ +E +  H  +TPKD  +I ++++Q++N E    L      N     SL     NG
Sbjct: 1   MYYIFVETETLHKIETPKDHTQIVSLSYQLINVEYKEDLSYDVKKNDVVILSLGDSMANG 60

Query: 53  TTKSLESAMVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKV 112
              + +  + Q  +++   IGN++ VL SL STW +RVT+PRQ+ D+G IL S+L+ P +
Sbjct: 61  DIMTFKDIIEQFSRNVEKTIGNEEKVLCSLNSTWDLRVTIPRQSNDEGIILPSFLKLPII 120

Query: 113 FDLWKEFDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEE 172
           FDLWKE+ RWC                N +   I+    K  KD  E+ +ILE++  ++ 
Sbjct: 121 FDLWKEYQRWC----------------NLHFSEINTMKTKKYKDSSELYKILEINQNSDA 164

Query: 173 AGSVPEIYSL--------------LKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIR 218
             +  ++                 ++ T D+ + +  KC++PED ESVLT PY+S+ D +
Sbjct: 165 KTNNEKLNDRSGNINMDRGYKKNDVRSTVDVFMAIVDKCSTPEDHESVLTHPYNSNVDFQ 224

Query: 219 AFLQEKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXX 278
            F+QE SKI+YMNNLPPDTTQSELESWF Q+G++P   WTV+NI+E T            
Sbjct: 225 TFIQETSKIIYMNNLPPDTTQSELESWFAQFGIKPARLWTVRNILESTSYTNSNGNSNNS 284

Query: 279 PYVEDQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLD 338
           PYVE+ DSISGF VFQTH+EAT+ L LNGRSILSN+ANTKQPRVVEH++ELQPSS  +L+
Sbjct: 285 PYVEEHDSISGFAVFQTHKEATDALLLNGRSILSNMANTKQPRVVEHIVELQPSSMVILE 344

Query: 339 KAQEILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384
           + QEI S FPQSKNKPRPGDWNC SCGFSNFQRRT+CFRCSFPA +
Sbjct: 345 RIQEISSQFPQSKNKPRPGDWNCMSCGFSNFQRRTSCFRCSFPAAT 390

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 31/32 (96%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDWKCS C+YHNFAKN+VCLRCGGPK+
Sbjct: 547 VPFRAGDWKCSACSYHNFAKNIVCLRCGGPKT 578

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW C +C + NF +   C RC  P
Sbjct: 550 RAGDWKCSACSYHNFAKNIVCLRCGGP 576

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGPKSIS 611
           R GDW C +C + NF +   C RC  P + S
Sbjct: 361 RPGDWNCMSCGFSNFQRRTSCFRCSFPAATS 391

>NDAI0A01900 Chr1 complement(426743..428440) [1698 bp, 565 aa] {ON}
           Anc_7.349 YDL167C
          Length = 565

 Score =  353 bits (906), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 249/383 (65%), Gaps = 29/383 (7%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVLE++  H   T KDQ RI N+++QIVN +       TN + SI ++  +++ + A
Sbjct: 1   MHYVVLEVESFHEEGTLKDQTRIINLSYQIVNIDDSTLLAQTNPVASIAISNDSENFQDA 60

Query: 61  MVQLDKDIHDVIGNDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFD 120
           +VQLD DI   IG ++FV+ +L S  ++RVTL RQA D G  L  YL++PK+FDLW EF 
Sbjct: 61  LVQLDSDIKTTIGQNEFVICTLNSLTNLRVTLRRQALDIGVNLPQYLRYPKLFDLWVEFK 120

Query: 121 RWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRILEVSIPTEEAGSVPEIY 180
           ++C NHPE+   ++ ++                +KD+  +  IL +     E  ++    
Sbjct: 121 KFCANHPELDLNEEMVT----------------SKDVAILTDILGLQSNNTENYTI---- 160

Query: 181 SLLKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQEKSKILYMNNLPPDTTQS 240
                +TD+L+ L+KKC+S ED++ VLT+PYD   DI+ F +E++++++++NLPPD TQ+
Sbjct: 161 ---DISTDVLLSLYKKCSSSEDIKFVLTQPYDLQMDIKTFYEEEARVIFISNLPPDITQN 217

Query: 241 ELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEAT 300
           ELE+WF  +  +P+ +WT K   E +             YV +Q SI GF++FQTHEEA 
Sbjct: 218 ELETWFANHNSKPICYWTSKTPDEYSRNFHNNT------YVMNQHSIIGFIIFQTHEEAK 271

Query: 301 EVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQEILSPFPQSKNKPRPGDWN 360
           + L LNG+SI S+  + KQ   VEH++E+ PSST VLD  Q+IL PFPQSKNKPR GDWN
Sbjct: 272 QSLLLNGKSISSSTLHMKQLYPVEHIIEVAPSSTKVLDHTQDILIPFPQSKNKPRLGDWN 331

Query: 361 CPSCGFSNFQRRTACFRCSFPAP 383
           CPSCGFSNFQRRTACFRCSFPAP
Sbjct: 332 CPSCGFSNFQRRTACFRCSFPAP 354

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 1/35 (2%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKSISG 612
           +PFRAGDWKC +CTYHNFAKN+ CLRCG PK +SG
Sbjct: 446 VPFRAGDWKCPSCTYHNFAKNIACLRCGDPK-LSG 479

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 18/30 (60%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFPAPS 384
           R GDW CPSC + NF +  AC RC  P  S
Sbjct: 449 RAGDWKCPSCTYHNFAKNIACLRCGDPKLS 478

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCGGP 607
           R GDW C +C + NF +   C RC  P
Sbjct: 326 RLGDWNCPSCGFSNFQRRTACFRCSFP 352

>CAGL0I03344g Chr9 complement(285637..287448) [1812 bp, 603 aa] {ON}
           similar to uniprot|P32770 Saccharomyces cerevisiae
           YDL167c ARP1
          Length = 603

 Score =  263 bits (673), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 149/401 (37%), Positives = 225/401 (56%), Gaps = 40/401 (9%)

Query: 1   MHYVVLELQVAHLPDTPKDQCRIANIAFQIVNAETLVCHYGTNSLPSIEVNGTTKSLESA 60
           MHYVVL++Q+    D+   +  +  + +Q+++  +L      N    ++V+G  +S++  
Sbjct: 1   MHYVVLDVQI----DSSAVKPVLLRLGYQVIDPVSLEAR---NEPYVVDVDG--ESIKEF 51

Query: 61  MVQLDKDI--HDVIGN---------------DDFVLVSLYSTWHIRVTLPRQARDDGFIL 103
           + +LD+D+  H  + N                +FV  +L  +W ++V L   A D G  L
Sbjct: 52  IAKLDEDLKSHATVANHQESQDGSQSGSDVEKEFVFCTLNPSWSVKVGLVSSANDLGVEL 111

Query: 104 TSYLQHPKVFDLWKEFDRWCVNHPEILGQKKAISNNNCNTKSISINAAKNTKDLDEIVRI 163
             YL++P  FD+WKE+  W  NH +             N +SI   A K    ++E+VR 
Sbjct: 112 PEYLRYPVFFDIWKEYSIWKKNHSD----SSESPQTQANGESIDSFAGK----IEELVRT 163

Query: 164 LEVSIPTEEAGSVPEIYSL-LKRTTDILIQLHKKCTSPEDMESVLTKPYDSHTDIRAFLQ 222
           L+VS   +E     +  +  ++  T +L  LHKKC +P D  +VLT PYD   D + F++
Sbjct: 164 LDVSTEYDELKQKNDDPTFDVRLATLVLTALHKKCVTPVDDTTVLTVPYDLGMDYKNFIE 223

Query: 223 EKSKILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNIVEDTXXXXXXXXXXXXPYVE 282
           E+SKILY++N+P +  Q++LE WF Q GV  VGFWT+KNI +D               + 
Sbjct: 224 EQSKILYISNIPSELNQTDLEGWFQQKGVASVGFWTLKNISDDATLASQRNHGKM---LS 280

Query: 283 DQDSISGFVVFQTHEEATEVLALNGRSILSNLANTKQPRVVEHVLELQPSSTGVLDKAQE 342
             DS+ GF +FQ+H +A   L L+G   +  +   K  + +E +L++QPSS  +L+K Q+
Sbjct: 281 IPDSMFGFAIFQSHNDAEYALNLHG--TVMKIVAPKGNKHIEQLLDIQPSSMRLLEKVQD 338

Query: 343 ILSPFPQSKNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAP 383
            L   PQ+KNKPRPGDWNCPSCGFSNFQRRTACFRC+FP P
Sbjct: 339 NLILLPQNKNKPRPGDWNCPSCGFSNFQRRTACFRCAFPVP 379

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 29/32 (90%)

Query: 578 MPFRAGDWKCSTCTYHNFAKNVVCLRCGGPKS 609
           +PFRAGDWKC  C YHNFAKN+VCLRCGGPK+
Sbjct: 532 VPFRAGDWKCPGCFYHNFAKNIVCLRCGGPKT 563

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 355 RPGDWNCPSCGFSNFQRRTACFRCSFP 381
           R GDW CP C + NF +   C RC  P
Sbjct: 535 RAGDWKCPGCFYHNFAKNIVCLRCGGP 561

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 581 RAGDWKCSTCTYHNFAKNVVCLRCG--GPKSISGDASE 616
           R GDW C +C + NF +   C RC    P  +SG+A +
Sbjct: 351 RPGDWNCPSCGFSNFQRRTACFRCAFPVPNGVSGNAGK 388

>KLLA0B08976g Chr2 complement(786122..787039) [918 bp, 305 aa] {ON}
           similar to uniprot|P32605 Saccharomyces cerevisiae
           YBR119W MUD1 U1 snRNP A protein homolog of human U1-A
           involved in nuclear mRNA splicing
          Length = 305

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 20/91 (21%)

Query: 192 QLHKKCTSPEDMESVLTKPYDSH---TDIRAFLQEKSKI-----------------LYMN 231
           +L KK    E ++ +L+KP  ++   T+  A  Q+  K+                 L + 
Sbjct: 179 KLRKKDLDEETIQKLLSKPRKTNPEGTNKTAMSQQSEKVSSTKKVFDIVGNPPHHVLLVQ 238

Query: 232 NLPPDTTQSELESWFTQYGVRPVGFWTVKNI 262
           NLP D TQ ELE  F   G + V   +V+N+
Sbjct: 239 NLPKDVTQQELEKLFVSDGFKEVRLVSVRNL 269

>Kwal_56.23486 s56 complement(561558..563321) [1764 bp, 587 aa] {ON}
           YER165W (PAB1) - Poly(A) binding protein, cytoplasmic
           and nuclear [contig 176] FULL
          Length = 587

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 55/147 (37%), Gaps = 29/147 (19%)

Query: 206 VLTKPYDSHTDIRAFLQE-KSKI--LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 262
           V   P+ S  D ++ L E KS    +Y+ N+ P+T Q E E  F+QYG          N 
Sbjct: 198 VYVAPHVSKKDRQSKLDEVKSNFTNVYVKNIDPETKQDEFEKLFSQYGAITSAVLETDN- 256

Query: 263 VEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATEVLA------LNGRSILSNLAN 316
                              E +    GFV F+ H  A + +        NG+ +    A 
Sbjct: 257 -------------------EGKLRGFGFVNFEDHNAAAKAVEELNDTDFNGQKLYVGRAQ 297

Query: 317 TKQPRVVEHVLELQPSSTGVLDKAQEI 343
            K  R+ E   + + S    L K Q +
Sbjct: 298 KKYERLQELKKQYESSRMEKLAKYQGV 324

>TDEL0A00940 Chr1 complement(156781..158829) [2049 bp, 682 aa] {ON}
           Anc_2.52 YNL197C
          Length = 682

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGF 256
           LY+ NLPPDTT+ EL   F+ Q G R + F
Sbjct: 555 LYVGNLPPDTTEQELRHLFSGQQGFRRLSF 584

>Kpol_1039.50 s1039 complement(146455..147322,147425..147447) [891
           bp, 296 aa] {ON}
           complement(146455..147322,147425..147447) [891 nt, 297
           aa]
          Length = 296

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 227 ILYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 262
           IL + NLP  TT+ +L+  F Q G++ V   +V+N+
Sbjct: 226 ILLVQNLPNGTTEVQLKELFAQTGLKEVRLVSVRNL 261

>Kwal_23.4597 s23 complement(781763..783757) [1995 bp, 664 aa] {ON}
           YNL197C (WHI3) - Putative RNA binding protein [contig 5]
           FULL
          Length = 664

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 547 LYVGNLPPDATEHELRQLFSTQKGFRRLSF 576

>KLTH0B07546g Chr2 (609954..611873) [1920 bp, 639 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 639

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 523 LYVGNLPPDATEHELRQLFSTQKGFRRLSF 552

>TBLA0B00600 Chr2 complement(123569..125773) [2205 bp, 734 aa] {ON}
           Anc_2.52 YNL197C
          Length = 734

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F TQ G R + F
Sbjct: 610 LYVGNLPPDATEQELRQLFSTQDGFRRLSF 639

>SAKL0H17952g Chr8 complement(1599134..1600903) [1770 bp, 589 aa]
           {ON} highly similar to uniprot|P04147 Saccharomyces
           cerevisiae YER165W PAB1 Poly(A) binding protein part of
           the 3'-end RNA-processing complex mediates interactions
           between the 5' cap structure and the 3' mRNA poly(A)
           tail involved in control of poly(A) tail length
           interacts with translation factor eIF-4G
          Length = 589

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 204 ESVLTKPYDSHTDIRAFLQE-KSKI--LYMNNLPPDTTQSELESWFTQYG 250
           + V   P+ S  D ++ L+E KS    +Y+ N+  +TTQ E E+ FTQ+G
Sbjct: 196 QEVYVAPHVSKKDRQSKLEEAKSNFTNIYVKNIDLETTQEEFEALFTQFG 245

>Smik_4.16 Chr4 complement(32368..34320) [1953 bp, 650 aa] {ON}
           YDL224C (REAL)
          Length = 650

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 261
           LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 536 LYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 570

>SAKL0G18700g Chr7 complement(1613786..1618714) [4929 bp, 1642 aa]
           {ON} similar to uniprot|P47171 Saccharomyces cerevisiae
           YJR140C HIR3 Transcriptional corepressor
          Length = 1642

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 46/110 (41%), Gaps = 18/110 (16%)

Query: 74  NDDFVLVSLYSTWHIRVTLPRQARDDGFILTSYLQHPKVFDLWKEFDRWCVNHPEILGQK 133
           ND + LV LY+ + I    P +   D  I T+      + DL+     W   H E L Q 
Sbjct: 382 NDAWKLVDLYTDFDINKMAPEELSQDSPIFTA------ITDLYDCLSSWTNRHSEFLNQN 435

Query: 134 KAISNNNCNTKSISINAAKNTKDLDEIVRILEV------SIPTEEAGSVP 177
              S NN    S    + KN +DL ++  +L        +IPT+    +P
Sbjct: 436 D--SRNNLRNNS----SGKNVEDLVQLNTLLRTNMFNDDNIPTKSLTDIP 479

>Suva_4.20 Chr4 complement(42670..44628) [1959 bp, 652 aa] {ON}
           YDL224C (REAL)
          Length = 652

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 261
           LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 538 LYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 572

>CAGL0D05236g Chr4 (499006..500337) [1332 bp, 443 aa] {ON} weakly
           similar to uniprot|P43607 Saccharomyces cerevisiae
           YFR032c
          Length = 443

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 22/35 (62%)

Query: 228 LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVKNI 262
           +Y   LP +TT ++L ++FT YG R +  +  KN+
Sbjct: 185 VYCAFLPKETTDNDLRNYFTDYGSREIWIFRTKNV 219

>Kpol_400.1 s400 (3149..4951) [1803 bp, 600 aa] {ON} (3149..4951)
           [1803 nt, 601 aa]
          Length = 600

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 461 LYVGNLPPDATEQELRQLFSSQQGFRRLSF 490

>YDL224C Chr4 complement(54397..56346) [1950 bp, 649 aa] {ON}
           WHI4Putative RNA binding protein and partially redundant
           Whi3p homolog that regulates the cell size requirement
           for passage through Start and commitment to cell
           division
          Length = 649

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 261
           LY+ NLPPD T+ EL   F+ Q G R + F    N
Sbjct: 535 LYVGNLPPDATEQELRQLFSNQQGFRRLSFRNKMN 569

>KAFR0A07700 Chr1 (1550013..1551728) [1716 bp, 571 aa] {ON} Anc_2.52
           YNL197C
          Length = 571

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGF 256
           LY+ NLPPD T+ EL   F+ Q G R + F
Sbjct: 444 LYVGNLPPDATEQELRQLFSKQQGFRRLSF 473

>KNAG0A02870 Chr1 complement(342659..344773) [2115 bp, 704 aa] {ON}
           Anc_8.349 YLR143W
          Length = 704

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 10/87 (11%)

Query: 103 LTSYLQHPKVFDLWKEFDRWC----VNHPEILGQKKAISNNNCNTKSISINAAKNTKDLD 158
           L S++     FD+ + ++R C      H   LG  K +S N   TK   I      +DL 
Sbjct: 42  LDSFMFQTIGFDIVQFYERCCGVPLFTHTISLGGSKNVSMNYIKTKDDEI------EDLY 95

Query: 159 EIVRILEVSIPTEEAGSVPEIYSLLKR 185
           +++  ++ +IPT EA SV  I S  +R
Sbjct: 96  QLLSKVKTAIPTLEAVSVGAILSSYQR 122

>CAGL0G05511g Chr7 complement(522026..524050) [2025 bp, 674 aa] {ON}
           similar to uniprot|P34761 Saccharomyces cerevisiae
           YNL197c WHI3 involved in regulation of cell size
          Length = 674

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 1/35 (2%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGFWTVKN 261
           LY+ NLPPDT++ EL   F+ Q G R + F    N
Sbjct: 560 LYVGNLPPDTSEQELRQLFSPQPGFRRLSFKNKNN 594

>ABL158C Chr2 complement(102437..104626) [2190 bp, 729 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL224C
           (WHI4) and YNL197C (WHI3)
          Length = 729

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 609 LYVGNLPPDATEQELRQLFSSQKGFRRLSF 638

>ZYRO0C10164g Chr3 (777453..779690) [2238 bp, 745 aa] {ON} some
           similarities with Saccharomyces cerevisiae YDL224C WHI4
           and to uniprot|P34761 Saccharomyces cerevisiae YNL197C
           WHI3
          Length = 745

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGF 256
           LY+ NLPPD T+ EL   F+ Q G R + F
Sbjct: 619 LYVGNLPPDATEQELRQLFSGQQGFRRLSF 648

>Ecym_6441 Chr6 (856251..858320) [2070 bp, 689 aa] {ON} similar to
           Ashbya gossypii ABL158C
          Length = 689

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWF-TQYGVRPVGF 256
           LY+ NLPPD T+ EL   F +Q G R + F
Sbjct: 569 LYVGNLPPDATEQELRQLFSSQKGFRRLSF 598

>NDAI0H03850 Chr8 (943316..945544) [2229 bp, 742 aa] {ON} Anc_2.52
           YDL224C
          Length = 742

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 228 LYMNNLPPDTTQSELESWFT-QYGVRPVGF 256
           LY+ NLPPD T++EL   F+ Q G R + F
Sbjct: 628 LYVGNLPPDATENELRQLFSCQNGFRRLSF 657

>TBLA0F03780 Chr6 (933778..935511) [1734 bp, 577 aa] {ON} Anc_8.229
           YER165W
          Length = 577

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 61/149 (40%), Gaps = 29/149 (19%)

Query: 204 ESVLTKPYDSHTDIRAFLQEKSKI---LYMNNLPPDTTQSELESWFTQYGVRPVGFWTVK 260
           + V   P+ S  D ++ L E       +Y+ NL  + T+ + E+ F  YG       T+ 
Sbjct: 199 QEVYVAPHVSKKDRQSKLDEARANFTNVYVKNLDLEATEEDFENLFKPYG-------TIT 251

Query: 261 NIVEDTXXXXXXXXXXXXPYVEDQDSISGFVVFQTHEEATE-VLALN-----GRSILSNL 314
           ++  +                E +    GFV F+ HE+A + V ALN     G+++    
Sbjct: 252 SVALEKD-------------AEGKSRGFGFVDFENHEDAVKAVEALNDTEYKGQTLYVGR 298

Query: 315 ANTKQPRVVEHVLELQPSSTGVLDKAQEI 343
           A  K  R+ E   + Q S    L K Q I
Sbjct: 299 AQKKYERLQELKKQYQASKLEKLAKYQGI 327

>CAGL0J07898g Chr10 (770997..771464) [468 bp, 155 aa] {ON} highly
           similar to uniprot|P53849 Saccharomyces cerevisiae
           YNL255c GIS2
          Length = 155

 Score = 30.4 bits (67), Expect = 8.4,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%)

Query: 596 AKNVVCLRCGGPKSISGDASETNHYIDS-STFGPASRTPSN 635
           +KNV C +CGGP  ++ D  +T+    S   FG  SR   N
Sbjct: 92  SKNVSCYKCGGPNHVARDCMQTDTKCYSCGRFGHVSRDCPN 132

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,407,471
Number of extensions: 2970964
Number of successful extensions: 17018
Number of sequences better than 10.0: 161
Number of HSP's gapped: 16983
Number of HSP's successfully gapped: 239
Length of query: 719
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 602
Effective length of database: 40,065,477
Effective search space: 24119417154
Effective search space used: 24119417154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)