Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
YDL166C (FAP7)7.348ON1971879251e-128
Suva_4.807.348ON2061878731e-120
Smik_4.727.348ON1971878681e-120
Skud_4.917.348ON1941868671e-119
NDAI0A019107.348ON2141837205e-97
NCAS0A141407.348ON2241837191e-96
SAKL0F11330g7.348ON2081847102e-95
KAFR0B008607.348ON2281847112e-95
Ecym_47257.348ON2341847034e-94
Kpol_530.337.348ON1951846943e-93
TDEL0C020007.348ON2131826893e-92
TPHA0F029507.348ON2161806772e-90
KLLA0D12386g7.348ON2111826591e-87
Kwal_56.246357.348ON2261866601e-87
KLTH0H01298g7.348ON2141826572e-87
TBLA0E005207.348ON2091826563e-87
KNAG0C037707.348ON2231816522e-86
ACL150W7.348ON2191846485e-86
CAGL0I03366g7.348ON2121846225e-82
ZYRO0F11660g7.348ON1981826181e-81
NDAI0E025908.590ON685101740.49
NCAS0C018708.590ON60092701.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= YDL166C
         (197 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   360   e-128
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   340   e-120
Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   338   e-120
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   338   e-119
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   281   5e-97
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   281   1e-96
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   278   2e-95
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   278   2e-95
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   275   4e-94
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   271   3e-93
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   270   3e-92
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   265   2e-90
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   258   1e-87
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   258   1e-87
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   257   2e-87
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   257   3e-87
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   255   2e-86
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   254   5e-86
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   244   5e-82
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   242   1e-81
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    33   0.49 
NCAS0C01870 Chr3 complement(344877..346679) [1803 bp, 600 aa] {O...    32   1.4  

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  360 bits (925), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/187 (93%), Positives = 175/187 (93%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           MEARRYGPNIIVTGTPGCGKSSTCEF            ISDFAKDNDCFEGYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NEYQGPR 187
           NEYQGPR
Sbjct: 181 NEYQGPR 187

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  340 bits (873), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/187 (86%), Positives = 171/187 (91%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME+RRYGPNIIVTGTPGCGKSSTCE             ISDFAKDNDCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+RQGNSI+DWHVNDVFPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQSDTK+D+VSNV+RI+AWEKMWLEQHP+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NEYQGPR 187
           NEYQG R
Sbjct: 181 NEYQGGR 187

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  338 bits (868), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 169/187 (90%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME+RRYGPNIIVTGTPGCGKSS CE             ISDFAKD+DCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD+LEPLLRQGNSIVDWHVND+FPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDM SNVSRI+ WEKMWLEQHP+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NEYQGPR 187
           NEYQG R
Sbjct: 181 NEYQGSR 187

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  338 bits (867), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/186 (87%), Positives = 167/186 (89%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME RR+GPNIIVTGTPGCGKSSTCE             ISDFAKDNDCFE YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLRQGNSI+DWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQ DTKEDMVSNV+RIVAWEKMWLEQH DGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NEYQGP 186
           NEYQGP
Sbjct: 181 NEYQGP 186

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  281 bits (720), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 151/183 (82%)

Query: 3   ARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHIVD 62
           +RRY PN+++TGTPG GKS+TCE             ISDFAK+NDC+EGYD+GRKSHIVD
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  EDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIE 122
           EDKLLD LEPLLR+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTNE 182
           ENLDAEIMGVV QDAVESY+  IVVELQSD  E M +NV RIV W KMW++QH +GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 YQG 185
            QG
Sbjct: 186 LQG 188

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  281 bits (719), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 133/183 (72%), Positives = 151/183 (82%)

Query: 2   EARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHIV 61
           ++RRY PN+++TGTPGCGKS+TCE             ISDFAK++DC++GYD+GRKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121
           DEDKLLD LEPLLRQG SI+DWHVNDVFPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181
           EEN+DAEIMGVV QDA+ESY   IVVELQSDT E M +NV RIV W+KMWLEQH DGVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 EYQ 184
           E +
Sbjct: 183 ELE 185

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  278 bits (710), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 149/184 (80%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME +R  PNI+VTGTPGCGKS+TCE             ISDFA+++ C++GYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G SIVDWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVV QDA ESY   IVVELQSDT E M +NV RIV W++MWL QHP+GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEYQ 184
           NE +
Sbjct: 181 NELE 184

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  278 bits (711), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 130/184 (70%), Positives = 154/184 (83%)

Query: 2   EARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHIV 61
           E+RRY PN++VTGTPGCGKS+TCE             IS+FA+ + C++GYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121
           D+DKLLD LEPLLR+G SI+DWHVNDVFPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181
           +ENLDAEIMGVV QDA++SYE  IVVELQS++ E+M +NV RIVAW++MWL QH +GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 EYQG 185
           EYQG
Sbjct: 187 EYQG 190

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  275 bits (703), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 148/184 (80%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M++ R  PNIIVTGTPGCGK++TCE             ISDFAK++DC+EGYDEGRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G +I+DWHVNDVFPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEEN+DAEIMGVV QDA++SY   IVVELQS+T   M  NV RIVAWE  W+ QHP GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEYQ 184
           NE Q
Sbjct: 195 NELQ 198

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  271 bits (694), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 132/184 (71%), Positives = 148/184 (80%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M +RR  PN+++TGTPGCGKS++CE             ISDFAK++DC+EGYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G SIVDWHVNDVFPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           I+ENLDAEIMGVV QDA ESY   IVVELQSDT E M +NV RIV W ++WL+QH  GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NEYQ 184
           NE +
Sbjct: 181 NELE 184

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  270 bits (689), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (81%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME RR+ PN+++TGTPGCGKS+TCE             ISDFAK++DC +GYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G +IVDWHVNDVFPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           I+ENLDAEIMGVV QDA +SYE  IVVELQSD+ E M +NV RIV+WEK+WL+QH DG T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  265 bits (677), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 147/180 (81%)

Query: 3   ARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHIVD 62
           +RRY PN+++TGTPGCGKS+TCE             ISDFAK+++C++G+DEGRKSHIVD
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  EDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKIE 122
           EDKLLD LEPLLR+G  IVDWHVNDVFPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTNE 182
           EN+DAEIMGVV QDA ESY   IVVELQSDT E M  NV +IV W ++W++QH +GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  258 bits (659), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 123/182 (67%), Positives = 147/182 (80%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME  R+ PNIIV+GTPGCGKS+TCE             ISDFAK++DC++GYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VD+DKLLD LEPLLR+G  I+DWHVNDVFPERL+DLVVVLRCDN  LY RL+ RGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEEN+DAEIMGVV QDA +SY   IVVELQSDT E+M  NV RI+AW+++WL+QH  GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  258 bits (660), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 139/186 (74%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M + R  PNI+VTGTPGCGK+STCE             ISDFAK+  C++GYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR G +IVDWHVNDVFPERLIDLVVVLR DNS L+ RL  RGYH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           I+EN+DAEIMGVV  DA +SY   IVVELQSDT E M  NV RIV W   W EQHP+GVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEYQGP 186
           NE  G 
Sbjct: 181 NELNGA 186

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  257 bits (657), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 120/182 (65%), Positives = 144/182 (79%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M + R+ PNI+VTGTPGCGK+STCE             ISDFA+ ++C++GYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDED+LLD LEPL+R+G +IVDWHVND+FPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           I+EN+DAEIMGVV QDA +SYE  IVVELQSDT + M  NV RI +W   WLEQ+P GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  257 bits (656), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 119/182 (65%), Positives = 148/182 (81%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M++RRY PN++++GTPG GKSSTCE             ISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEP+LR+G++IVDWHVNDVFPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           ++ENLDAEIMGVV QDA++SY   IV+ELQS+  E+M SNV RIV+W ++W +QH DGVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  255 bits (652), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 139/181 (76%)

Query: 2   EARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHIV 61
           E+RR  PNI+VTGTPG GKS+TCE             ISDFA  N C++GYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  DEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSKI 121
           DEDKLLD LEPLL  G +I+DWHVNDVFPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVTN 181
           +EN+DAEIMGVV QDA++SYE  IVVELQSD  E M +NV R+V W  MW EQHP+GVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 E 182
           E
Sbjct: 183 E 183

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  254 bits (648), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 121/184 (65%), Positives = 143/184 (77%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M+  R  PNI+V+GTPGCGKS+TCE             ISDFA++++C++GYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDED+LLD LEPLLR+G +IVDWHVND+FPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEEN+DAEIMGVV QDA++SY   IVVELQSD  E M  NV RI AWE  W+ +HPDGV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEYQ 184
           N  Q
Sbjct: 181 NALQ 184

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  244 bits (622), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 147/184 (79%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           M +RR+ PNIIVTGTPGCGKS+TCE             IS+FA+++ C++GYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD LEPLL +G SI+DWHVNDVFPERLIDLVVVLR +N  LY RL ARGYHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           IEENLDAEIMGVV QDA ESYEP IVVELQS+T EDM +NV RI  W   W+E+H DGV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NEYQ 184
           +E +
Sbjct: 181 SELK 184

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  242 bits (618), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 123/182 (67%), Positives = 148/182 (81%)

Query: 1   MEARRYGPNIIVTGTPGCGKSSTCEFXXXXXXXXXXXXISDFAKDNDCFEGYDEGRKSHI 60
           ME+RRY PN+++TGTPG GKS+T E             ISDFA++NDCF+GYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120
           VDEDKLLD+LEPLLR+G +I+DWHVNDVFPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180
           I+EN+DAEIMGVV QDA++SYE  IVVEL SD+ E M +NV RIV+W ++W +QH  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 33.1 bits (74), Expect = 0.49,   Method: Composition-based stats.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 10/101 (9%)

Query: 77  GNSIVDWHVNDV-FPE--RLIDLVVVLRCDNSNLYSRLHARGYHDSKIEENLDAEIMGVV 133
           G  I  W +  V  PE    + + VVLRCD S L+    A   HD K++E +       +
Sbjct: 456 GADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQEVVP------L 509

Query: 134 KQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQ 174
             DA E  EP    E+    K+D ++ V+   A +   L +
Sbjct: 510 PADAPEDAEPEF-REVTKTVKKDSLTVVAHTFALDDKTLNE 549

>NCAS0C01870 Chr3 complement(344877..346679) [1803 bp, 600 aa] {ON}
           Anc_8.590
          Length = 600

 Score = 31.6 bits (70), Expect = 1.4,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 43/92 (46%), Gaps = 10/92 (10%)

Query: 80  IVDWHVNDV-FPE--RLIDLVVVLRCDNSNLYSRLHARGYHDSKIEENLDAEIMGVVKQD 136
           I  W +  +  PE    + + VVLRCD S L++   A    D K++E +       + +D
Sbjct: 459 IAKWEITGLQVPEGAESVPVKVVLRCDPSGLHTIEEAYTVEDIKVQEVVP------LPED 512

Query: 137 AVESYEPHIVVELQSDTKEDMVSNVSRIVAWE 168
           A E  EP    E+    K+D ++ V+   A E
Sbjct: 513 APEDAEPEF-REVTKTVKKDALTIVAHTFALE 543

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,435,657
Number of extensions: 860839
Number of successful extensions: 2932
Number of sequences better than 10.0: 33
Number of HSP's gapped: 2947
Number of HSP's successfully gapped: 33
Length of query: 197
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 93
Effective length of database: 41,556,135
Effective search space: 3864720555
Effective search space used: 3864720555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)